2KXRA

Zo1 zu5 domain mc/aa mutation
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
118
structure length
118
Chain Sequence
TVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVAAGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Tight junction protein ZO-1
publication title Cdc42-dependent formation of the ZO-1/MRCKb complex at the leading edge controls cell migration
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00791 ZU5 ZU5 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.30 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Chondroitinase Ac; Chain A, domain 3 2kxrA01
3UD1A 3KBTC 2KXSA 3F59A 2KXRA 3UD2A 4D8OA 3KBUC
chains in the Genus database with same CATH superfamily
2E22A 1LOHA 1N7OA 4D6FA 3QR8A 1X1HA 1N7QA 1CB8A 1OJMA 1OJOA 1OJNA 2KXSA 1LXKA 3F59A 1HN0A 1N7NA 2BRPA 1HM2A 2KXRA 4D6DA 3KBUC 2BRVX 1J0NA 1RWGA 1HMWA 2WMIA 1J0MA 2WMKA 4D71A 1W3YA 3UD1A 1RWFA 2Q1FA 4D6CA 3KBTC 1X1JA 1F1SA 3UD2A 1C82A 4D6IA 2WCOA 4D8OA 4DLOA 1HMUA 1RW9A 2BRWA 3U7VA 1RWAA 4D6GA 2WMHA 1X1IA 1OJPA 1F9GA 3PQIA 1N7RA 2WMGA 2X03A 2E24A 4D6JA 1I8QA 2WMJA 1RWCA 2WMFA 4D72A 1LXMA 2WDAA 4D1JA 4D6EA 1RWHA 4D1IA 1EGUA 4DLQA 2WMIB 4D6HA 1N7PA 1HM3A
chains in the Genus database with same CATH topology
4DLOA 3QR8A 3UD1A 3KBTC 2KXSA 3F59A 4DLQA 3PQIA 2KXRA 3UD2A 4D8OA 3KBUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UD1 A;  3KBT C;  2KXS A;  3F59 A;  2KXR A;  3UD2 A;  4D8O A;  3KBU C; 
#chains in the Genus database with same CATH topology
 2E22 A;  1LOH A;  1N7O A;  4D6F A;  3QR8 A;  1X1H A;  1N7Q A;  1CB8 A;  1OJM A;  1OJO A;  1OJN A;  2KXS A;  1LXK A;  3F59 A;  1HN0 A;  1N7N A;  2BRP A;  1HM2 A;  2KXR A;  4D6D A;  3KBU C;  2BRV X;  1J0N A;  1RWG A;  1HMW A;  2WMI A;  1J0M A;  2WMK A;  4D71 A;  1W3Y A;  3UD1 A;  1RWF A;  2Q1F A;  4D6C A;  3KBT C;  1X1J A;  1F1S A;  3UD2 A;  1C82 A;  4D6I A;  2WCO A;  4D8O A;  4DLO A;  1HMU A;  1RW9 A;  2BRW A;  3U7V A;  1RWA A;  4D6G A;  2WMH A;  1X1I A;  1OJP A;  1F9G A;  3PQI A;  1N7R A;  2WMG A;  2X03 A;  2E24 A;  4D6J A;  1I8Q A;  2WMJ A;  1RWC A;  2WMF A;  4D72 A;  1LXM A;  2WDA A;  4D1J A;  4D6E A;  1RWH A;  4D1I A;  1EGU A;  4DLQ A;  2WMI B;  4D6H A;  1N7P A;  1HM3 A; 
#chains in the Genus database with same CATH homology
 4DLO A;  3QR8 A;  3UD1 A;  3KBT C;  2KXS A;  3F59 A;  4DLQ A;  3PQI A;  2KXR A;  3UD2 A;  4D8O A;  3KBU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...