2KXRA

Zo1 zu5 domain mc/aa mutation
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
118
structure length
118
Chain Sequence
b'TVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVAAGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tight junction protein ZO-1
molecule tags Protein binding
source organism Homo sapiens
publication title Cdc42-dependent formation of the ZO-1/MRCKb complex at the leading edge controls cell migration
pubmed doi rcsb
total genus 8
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00791 ZU5 ZU5 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.30 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Chondroitinase Ac; Chain A, domain 3 2kxrA01
2KXSA 3KBUC 3UD1A 3KBTC 3F59A 4D8OA 2KXRA 3UD2A
chains in the Genus database with same CATH superfamily
1X1HA 1J0NA 2E22A 3U7VA 2Q1FA 4D1IA 1W3YA 2BRPA 1RWGA 1J0MA 3UD1A 1EGUA 4D8OA 3UD2A 4D72A 2KXSA 3QR8A 1RWFA 4D6GA 1HN0A 1X1JA 4D71A 3PQIA 1I8QA 1HM2A 2WCOA 1HMUA 1RWAA 2BRVX 2E24A 2WMGA 3F59A 3KBTC 4D6FA 2KXRA 1RWCA 4D6HA 4D6DA 4D6IA 1HMWA 4D6JA 1OJPA 2WDAA 3KBUC 4D6CA 1LXKA 2WMIB 1LOHA 1F9GA 2X03A 2WMJA 1N7OA 1N7RA 1N7PA 1N7QA 1C82A 1F1SA 1OJMA 1RWHA 2WMHA 1OJOA 4D6EA 1X1IA 1OJNA 2WMFA 2WMKA 2WMIA 1HM3A 4DLOA 1CB8A 1RW9A 1LXMA 4D1JA 4DLQA 1N7NA 2BRWA
chains in the Genus database with same CATH topology
2KXSA 3QR8A 4DLOA 3KBUC 3PQIA 3UD1A 3KBTC 3F59A 4D8OA 4DLQA 2KXRA 3UD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXS A;  3KBU C;  3UD1 A;  3KBT C;  3F59 A;  4D8O A;  2KXR A;  3UD2 A; 
#chains in the Genus database with same CATH topology
 1X1H A;  1J0N A;  2E22 A;  3U7V A;  2Q1F A;  4D1I A;  1W3Y A;  2BRP A;  1RWG A;  1J0M A;  3UD1 A;  1EGU A;  4D8O A;  3UD2 A;  4D72 A;  2KXS A;  3QR8 A;  1RWF A;  4D6G A;  1HN0 A;  1X1J A;  4D71 A;  3PQI A;  1I8Q A;  1HM2 A;  2WCO A;  1HMU A;  1RWA A;  2BRV X;  2E24 A;  2WMG A;  3F59 A;  3KBT C;  4D6F A;  2KXR A;  1RWC A;  4D6H A;  4D6D A;  4D6I A;  1HMW A;  4D6J A;  1OJP A;  2WDA A;  3KBU C;  4D6C A;  1LXK A;  2WMI B;  1LOH A;  1F9G A;  2X03 A;  2WMJ A;  1N7O A;  1N7R A;  1N7P A;  1N7Q A;  1C82 A;  1F1S A;  1OJM A;  1RWH A;  2WMH A;  1OJO A;  4D6E A;  1X1I A;  1OJN A;  2WMF A;  2WMK A;  2WMI A;  1HM3 A;  4DLO A;  1CB8 A;  1RW9 A;  1LXM A;  4D1J A;  4DLQ A;  1N7N A;  2BRW A; 
#chains in the Genus database with same CATH homology
 2KXS A;  3QR8 A;  4DLO A;  3KBU C;  3PQI A;  3UD1 A;  3KBT C;  3F59 A;  4D8O A;  4DLQ A;  2KXR A;  3UD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...