2KXRA

Zo1 zu5 domain mc/aa mutation
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
118
structure length
118
Chain Sequence
TVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVAAGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cdc42-dependent formation of the ZO-1/MRCKb complex at the leading edge controls cell migration
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Tight junction protein ZO-1
total genus 8
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00791 ZU5 ZU5 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.30 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Chondroitinase Ac; Chain A, domain 3 2kxrA01
3UD1A 3F59A 4D8OA 3KBUC 3UD2A 2KXRA 2KXSA 3KBTC
chains in the Genus database with same CATH superfamily
1J0NA 2WMKA 4D6DA 1W3YA 2WMGA 3F59A 1RW9A 4D72A 1RWCA 3KBUC 1RWAA 1EGUA 2Q1FA 4D71A 1X1JA 4DLQA 2BRWA 2BRPA 3KBTC 2WDAA 1J0MA 1OJPA 1LXMA 1CB8A 1X1IA 1RWFA 2WCOA 1I8QA 1HM3A 1RWHA 1HMUA 1HMWA 1C82A 2WMJA 4D6CA 2X03A 2WMFA 2WMIB 4D8OA 1N7QA 1N7OA 3QR8A 1F9GA 1HN0A 2KXRA 2E24A 4D6EA 1OJOA 1LXKA 1N7RA 2BRVX 2E22A 2KXSA 1OJMA 2WMIA 3PQIA 3UD1A 4D1IA 2WMHA 1HM2A 1OJNA 4D6HA 3U7VA 1LOHA 1RWGA 4D6FA 3UD2A 1N7PA 1X1HA 4D1JA 4D6IA 1F1SA 1N7NA 4D6JA 4D6GA 4DLOA
chains in the Genus database with same CATH topology
3UD1A 3F59A 3PQIA 4D8OA 3KBUC 3UD2A 3QR8A 4DLQA 2KXRA 2KXSA 3KBTC 4DLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UD1 A;  3F59 A;  4D8O A;  3KBU C;  3UD2 A;  2KXR A;  2KXS A;  3KBT C; 
#chains in the Genus database with same CATH topology
 1J0N A;  2WMK A;  4D6D A;  1W3Y A;  2WMG A;  3F59 A;  1RW9 A;  4D72 A;  1RWC A;  3KBU C;  1RWA A;  1EGU A;  2Q1F A;  4D71 A;  1X1J A;  4DLQ A;  2BRW A;  2BRP A;  3KBT C;  2WDA A;  1J0M A;  1OJP A;  1LXM A;  1CB8 A;  1X1I A;  1RWF A;  2WCO A;  1I8Q A;  1HM3 A;  1RWH A;  1HMU A;  1HMW A;  1C82 A;  2WMJ A;  4D6C A;  2X03 A;  2WMF A;  2WMI B;  4D8O A;  1N7Q A;  1N7O A;  3QR8 A;  1F9G A;  1HN0 A;  2KXR A;  2E24 A;  4D6E A;  1OJO A;  1LXK A;  1N7R A;  2BRV X;  2E22 A;  2KXS A;  1OJM A;  2WMI A;  3PQI A;  3UD1 A;  4D1I A;  2WMH A;  1HM2 A;  1OJN A;  4D6H A;  3U7V A;  1LOH A;  1RWG A;  4D6F A;  3UD2 A;  1N7P A;  1X1H A;  4D1J A;  4D6I A;  1F1S A;  1N7N A;  4D6J A;  4D6G A;  4DLO A; 
#chains in the Genus database with same CATH homology
 3UD1 A;  3F59 A;  3PQI A;  4D8O A;  3KBU C;  3UD2 A;  3QR8 A;  4DLQ A;  2KXR A;  2KXS A;  3KBT C;  4DLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...