2KXRA

Zo1 zu5 domain mc/aa mutation
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
118
structure length
118
Chain Sequence
TVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVAAGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tight junction protein ZO-1
publication title Cdc42-dependent formation of the ZO-1/MRCKb complex at the leading edge controls cell migration
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 8
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00791 ZU5 ZU5 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.30 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Chondroitinase Ac; Chain A, domain 3 2kxrA01
3UD1A 4D8OA 2KXSA 3KBTC 3KBUC 3UD2A 2KXRA 3F59A
chains in the Genus database with same CATH superfamily
1N7QA 4D6HA 4DLOA 4D6IA 4D8OA 2KXSA 4D6GA 1OJMA 1J0MA 1N7PA 2BRVX 3KBUC 3QR8A 1LOHA 1I8QA 1OJOA 2X03A 1HMWA 1RW9A 1N7OA 1F9GA 3UD1A 4D1JA 2BRPA 2BRWA 3KBTC 4DLQA 2WMIA 2WMFA 3UD2A 1EGUA 2Q1FA 1C82A 1RWGA 2WMJA 4D6JA 1N7RA 2E24A 1HM2A 2WMHA 1LXMA 3PQIA 1X1IA 4D6DA 2WMKA 1X1HA 2WMIB 2WMGA 2WDAA 3U7VA 1HN0A 1HM3A 4D6CA 1F1SA 1W3YA 1LXKA 4D1IA 1RWFA 2WCOA 1OJNA 2E22A 4D72A 1J0NA 1CB8A 1HMUA 1OJPA 1RWCA 1N7NA 1RWHA 1X1JA 2KXRA 4D71A 1RWAA 4D6EA 4D6FA 3F59A
chains in the Genus database with same CATH topology
3UD1A 4D8OA 2KXSA 3PQIA 3KBTC 4DLQA 4DLOA 3KBUC 3QR8A 3UD2A 2KXRA 3F59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UD1 A;  4D8O A;  2KXS A;  3KBT C;  3KBU C;  3UD2 A;  2KXR A;  3F59 A; 
#chains in the Genus database with same CATH topology
 1N7Q A;  4D6H A;  4DLO A;  4D6I A;  4D8O A;  2KXS A;  4D6G A;  1OJM A;  1J0M A;  1N7P A;  2BRV X;  3KBU C;  3QR8 A;  1LOH A;  1I8Q A;  1OJO A;  2X03 A;  1HMW A;  1RW9 A;  1N7O A;  1F9G A;  3UD1 A;  4D1J A;  2BRP A;  2BRW A;  3KBT C;  4DLQ A;  2WMI A;  2WMF A;  3UD2 A;  1EGU A;  2Q1F A;  1C82 A;  1RWG A;  2WMJ A;  4D6J A;  1N7R A;  2E24 A;  1HM2 A;  2WMH A;  1LXM A;  3PQI A;  1X1I A;  4D6D A;  2WMK A;  1X1H A;  2WMI B;  2WMG A;  2WDA A;  3U7V A;  1HN0 A;  1HM3 A;  4D6C A;  1F1S A;  1W3Y A;  1LXK A;  4D1I A;  1RWF A;  2WCO A;  1OJN A;  2E22 A;  4D72 A;  1J0N A;  1CB8 A;  1HMU A;  1OJP A;  1RWC A;  1N7N A;  1RWH A;  1X1J A;  2KXR A;  4D71 A;  1RWA A;  4D6E A;  4D6F A;  3F59 A; 
#chains in the Genus database with same CATH homology
 3UD1 A;  4D8O A;  2KXS A;  3PQI A;  3KBT C;  4DLQ A;  4DLO A;  3KBU C;  3QR8 A;  3UD2 A;  2KXR A;  3F59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...