4D6CA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98)(l19 mutant)
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
586
structure length
586
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYHTSAHWLSTSWIDKMYQKYPNLHGIFSTESYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 222
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6cA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6cA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6cA02
2VZSA 2ZX6A 2J47A 2BV9A 4HU0A 2JF6A 2Q8XA 5AC5A 1W9VA 3KL3A 3O2LA 2YL8A 3VILA 1HIZA 2YOCA 3THCA 2UWFA 3AMDA 1NH6A 3ZQ9A 4H2CA 4A3HA 1ITCA 3WNMA 1LOHA 3W81A 2XHYA 4PMXA 1SMDA 5DF0A 3VPLA 4PUEA 4XZWA 4DM2A 1UH4A 1ZBWA 3NUKA 1AVAA 3DC0A 4NSBA 1MWOA 3LPGA 1DWJM 2O9OA 5A2AA 1A47A 2XSBA 4GXPA 3J7HA 1ZBKA 1EA9C 3A4XA 2EEXA 1R87A 1E3XA 5CGMA 1H5VA 3K8MA 1PIFA 1W9BM 5A95A 2WMHA 1BFNA 3VNZA 2X0HA 1OIFA 4UNIA 2E24A 3LPPA 5BROA 1ISXA 1HNYA 3L4TA 3N9KA 4N42A 3S2CA 4CN6A 1JNDA 2X0YA 3BLKA 1PPIA 3CLWA 4NF7A 4KMQA 1MQPA 1C7TA 2ZUUA 4NI3A 4UFHA 4W7WA 1AQ0A 1V3IA 3OIHA 3IAQA 1E6PA 1E3ZA 2YDSA 1OCQA 2WLYA 3W25A 1Q6FA 3GYCA 1HP5A 2VQUA 4J7RA 1UKOA 3T09A 4GKLA 3GNRA 4UOQA 2BHYA 1J10A 1W2VA 3VM7A 4V27A 4QCFA 1LL6A 1HKKA 2JE8A 3WY1A 3NYDA 3WEZA 1BG9A 3GBDA 4ZXOA 2CHNA 3VX1A 4B9YA 1JYXA 5A6LA 5IDIA 3SUWA 3ARUA 2CHOA 1TA3B 1V3MA 5AC4A 4KWUA 3BGAA 1KR1A 4OJYA 2J4GA 1UKSA 1EH9A 2DT2A 1RP8A 3ZMRA 5HPCA 3KEHA 1UQYA 3MV11 4Z2JA 1X1HA 2EPLX 2EPOA 2YKKA 2ZXQA 3O9NA 5E0CA 1CNVA 3K8KA 5CSUA 1LXMA 1JAKA 1H1NA 5A6SA 4MNMA 3MMUA 3ZM8A 5A6JA 1B2YA 2WBGA 4DWSA 4NZCA 1XCXA 3FHQA 2DGAA 1ZBCA 5FOOA 4AD5A 3UR8A 2WHLA 4W8AA 2ZIDA 4M80A 1JD9A 5CPSA 3OZPA 2CNCA 2E40A 3BMWA 1CPUA 5CJ5A 2WPGA 4HZ8A 4GO8A 4PMOA 1I75A 4E4PA 3UR7A 2A3CA 4UQ9A 4DM1A 2XPKA 1UWSA 2VRQA 1ZJAA 3UETA 2Y8KA 4AD3A 2WHMA 3N15A 1DWHM 2FH6A 1J0ZA 5A8OA 3UG5A 5BRQA 3VOCA 2YDQA 4MPKA 5CPTA 4HZ6A 3WUGA 1VRXA 1XH1A 4DUWA 3EDFA 1NM9A 1CGTA 3PBGA 4GINA 2WVUA 3APGA 5I3DA 1QHZA 4JHOA 1PX8A 3AHYA 1ISYA 3GZAA 4MB4A 3BAJA 1GONA 5I79A 3WQ5A 4E8DA 3BAWA 3K1DA 4RL3A 4H41A 2J62A 5D8ZA 4DWSC 1NOFA 4UQEA 2XSAA 1EO5A 4DUXA 1WZMA 1RWGA 3IANA 3CUGA 3OLGA 4Z2KA 4XUYA 3WNKA 4UTFA 4QLKA 1E0VA 2GJXB 4OKDA 4OZOA 2GUYA 1PAMA 5LA2A 4CN1A 5GNXA 3QR3A 5FL1A 1UD8A 1UWRA 1KQYA 2WZHA 1J01A 3CZJA 5TD4A 4UR9A 1PBGA 1WKYA 1JI1A 1V3JA 2OSYA 2YLLA 2GK1A 1E56A 2GDVA 1OIMA 4CD6A 1LG2A 3WQWA 5HOSA 1V6YA 3AS2A 3VIPA 1MQRA 3SCVA 2CERA 2ZUSA 2CBVA 5M3WA 1V0LA 4PSRA 2D22A 3POCA 2DEPA 2BHUA 3VX0A 4UCFA 5EB8A 1B30A 1CXLA 1QI0A 4P7RA 5D9MA 2YDRA 1JYVA 2X8RA 1WDPA 2XVKA 2ZX5A 3BAYA 3T0DA 1HJSA 3WF0A 3DYPA 2DSUA 2OWXA 3WL1A 3BAKA 1XCWA 2WMIB 4WKHA 1CZ1A 2DIJA 2CETA 3OGRA 1KFWA 1MYRA 3ZT5A 3SUVA 4UQDA 1JFHA 2WZIA 1BGGA 1BSIA 2VX6A 1E71M 1HN1A 1JZ4A 5EBAA 3OG2A 4PMVA 4GPNA 1G5AA 3F5JA 1E6ZA 3AIWA 4PEEA 1OT1A 4MNJA 3SUSA 1UR9A 4U2YA 4BCEA 4CD7A 2WMGA 1GCYA 1CGXA 1MXDA 3WUEA 2ZUWA 2OYKA 2BY1A 2W5FA 4F8XA 2BXZA 1IV8A 1QI4A 1EQPA 4OOUA 4PN2A 3MS8A 3KL5A 1DWGM 3B9AA 5EFDA 1UR4A 1C90A 1HL9A 5D9PA 3AIEA 5FIPA 4EE9A 3DHPA 3M07A 1J0IA 3VIFA 1WCGA 1J0KA 6A3HA 3W26A 3POHA 3VIGA 4P8UA 1R86A 4OOZA 3U7VA 2XVNA 4D6JA 4UFMA 4GQQA 1OWQA 1ISZA 1V03A 2W4XA 1V6UA 2O9PA 3ZJ8A 1V02A 2J74A 1PX4A 3FAWA 2C0HA 3WNLA 2JALA 5HXMA 3L4WA 1HMWA 1OINA 1C91A 3K8LA 1JDAA 1UD6A 4AZ5A 1C92A 1X1NA 4TTUA 2D1ZA 4GI8A 1FHDA 1R8LA 4UZUA 4ML4A 3RM9A 1WAWA 1CGUA 3ARYA 1ECEA 3L4UA 1ZL1A 5JUVA 1MFUA 4W8LA 1UWTA 4JIEA 1TVNA 4TVDA 3VD9A 1BTCA 2XM2A 3WQVA 3MUY1 1BQCA 3EDKA 3RCNA 2QMKA 3W4RA 2WCOA 5I0DA 2A3HA 1N7NA 1VEOA 2XWEA 4Z2HA 4D6DA 1QOXA 3EDDA 4P8WA 1TZ7A 4B15A 1XH2A 3ZJ6A 7A3HA 1KXQA 1NWUA 3I3DA 1DWFM 1PZ2A 2XM1A 2QHAA 3A4WA 4J27A 5IHSA 2CBIA 2Y2WA 1BGAA 2VL4A 2VI0A 5I77A 2ZWYA 3WF3A 3L2LA 1OGSA 5E6ZA 1J11A 3WH5A 1JF5A 3AMGA 3W24A 1V6VA 2W92A 4J3WA 3VM5A 2JFEX 5ABHA 3VDHA 4PTXA 1N7RA 2VURA 4S3JA 3VKKA 2EO7A 2YA1A 1QBBA 1HN0A 2IXVA 2VCBA 1V3KA 1JAEA 2FHCA 2V3GA 4MB5A 2Y5EA 3EDJA 5LYRA 1RWHA 2J79A 1QNOA 1NP2A 1X1JA 3WUFA 4U31A 1KBBA 1V6XA 3E1F1 1W3YA 4W7VA 4QLLA 4AC1X 1WZKA 5BRPA 4OIFA 1E4IA 4MJ2A 1MW1A 1EOKA 5ECUA 3CHCA 2VO5A 1EIBA 1KXTA 1VAHA 1CWYA 4CUCA 1K9FA 1XV8A 1HXJA 1NOUA 1W3JA 2EPMX 2DQXA 1V0MA 3FY1A 1OGGA 1E4NA 3GH4A 1JYWA 1FFRA 2WWCA 1E1EA 1FA2A 4TTGA 3WF4A 3MANA 3QHNA 1EDTA 4V28A 3MMDA 1EHNA 3ECQA 2C8NA 1QW9A 5A8QA 1J12A 4IISA 4H7VA 2J7FA 4QP0A 1OSEA 5GPRA 1JG9A 3ARSA 2O9TA 2AOSA 4D6GA 5CPQA 2PWFA 4Z2IA 1OJMA 3AICA 1Y7VA 1KGXA 5D9OA 3BCDA 3MO4A 4PMDA 1QI3A 1TMQA 3L4YA 3SUUA 3GBEA 3HMCA 4MAVA 1OJPA 1HM2A 1FP9A 4Y7EA 5D4YA 4U2ZA 3ZSSA 3LMYA 1JXJA 3DYOA 4A3YA 1N7PA 3T2QA 3AMCA 5A8PA 2BY0A 2PWGA 3GM8A 1VJSA 4BQ2A 2EJ1A 3NSNA 1E6QM 1V0NA 3EYPA 1BVNP 2DT0A 4GIAA 2PWHA 3AIQA 2DSZA 2VOTA 4WKFA 4IM4A 3RMEA 3CUHA 3GDBA 3OGSA 3TOPA 1Z32X 2YBTA 3W6LA 4ATDA 1W91A 1JYNA 4CVWA 2ZOXA 4BS0A 1KWKA 1O6IA 2J7EA 4U3AA 4R5EA 4FF5A 5I2UA 3MUAA 1U30A 5A6BA 1C3FA 1QBAA 1H09A 1M53A 2Z1KA 5DT7A 2GJXA 5JIWA 5BXPA 4BQ3A 1CGVA 1K9DA 2WK2A 2WSKA 3AYRA 1JIBA 1U2YA 3ZSTA 4M24A 3WH7A 2XJ7A 4AXNA 4PMZA 2XVGA 4HZ7A 3U57A 3UG3A 1W9PA 3B8SA 3PN8A 2QMJA 4PCTA 1MW2A 4GO9A 2E4TA 3RO8A 5A6AA 2CCRA 1W1PA 1E5NA 3AIRA 2OSXA 3AQUA 3MUZ1 4HPGA 1CGWA 4TUFA 4UQCA 3AXIA 4PSPA 2J7DA 2CKRA 5E9AA 1K9EA 1QNPA 4YN5A 1JZ6A 1R7OA 4M56A 3VGEA 3WDHA 3WFZA 2CXGA 2NT0A 1CBGA 2X09A 1JXKA 3G6MA 2BVYA 2VRJA 3OA5A 3AYSA 3L4VA 3W28A 3QHOA 1ZS2A 2GVYA 4X0NA 6TAAA 1SFSA 2ZUTA 4PRWA 2WCAA 5JBFA 4PMNA 2WMIA 5HPOA 2ZICA 1D2KA 3W53A 3AZTA 3GXMA 1VENA 4L4OA 3ARXA 3WMBA 1GQLA 1HF6A 2RGLA 4MDOA 1B0IA 3MMWA 3O6AA 1H3GA 1KGUA 3AHZA 4M8UA 3VGDA 1ISVA 3HN3A 1W9DM 3SEPA 1VIWA 2CIPA 2DPEA 1HMUA 1RW9A 1E6XM 3UEQA 3I3EA 2XWDA 4PUDA 2GJPA 1DTUA 2XVPA 4RE2A 3CMJA 1CEOA 3VNYA 3VD4A 1M7XA 3VO0A 1UOKA 5D9NA 2ZX9A 3ARQA 1UD5A 3CPUA 3GXDA 1ZB5A 3IAPA 4D6EA 3AOFA 1UWQA 3T2OA 4HMEA 1HVXA 3MU7A 5ABFB 1I1WA 1UWUA 2G4FA 2O9RA 1WDQA 4BA0A 5FKYA 4AEEA 1EGUA 4CN4A 4J3SA 4JHZA 5E70A 4PTVA 2XYLA 2YL6A 3CHFA 4UZSA 1JNEA 3AHTA 3WENA 2DH3A 4LPCA 2WVVB 1FH9A 1W2PA 1E6SM 2PC8A 3L4ZA 4H8VA 1VFMA 1VBRA 3M7SA 4U3CA 2XUCA 4D72A 1KBKA 5FL0A 4AZ7A 3T08A 1GHRA 1HP4A 5BCAA 3VDAA 3TTOA 1VBUA 4FMVA 4LYPA 1W3KA 1B90A 5E6YA 3AS3A 2WYSA 3CMGA 2W91A 5EMYA 5ABEA 3VTRA 2E8ZA 4MB3A 2VZVA 4W85A 1WNOA 3CUJA 3T0AA 4W86A 4Z2LA 2GFTA 2X05A 2MANA 1Q6EA 4AD0A 4QAWA 1US2A 4UQBA 2WMJA 4AEFA 3WDJA 2WKLA 3EMCA 1L8NA 4AIUA 2IUZA 1KXVA 4K68A 5AYIA 1E55A 1BYBA 1E40A 1C8YA 4ZE5A 3CTTA 2ZUVA 1GZJA 2NSXA 4B9ZA 2E3ZA 4PBGA 4D71A 3ZR5A 1JD7A 1B3ZA 4PMRA 3ARPA 1G01A 3VGHA 3WNOA 3UCQA 1B3XA 1BPLB 5C70A 1UR8A 2Y8VA 1RH9A 2WBKA 1B3VA 5I5RA 2WW5A 1ZBVA 2WB5A 3ARWA 3VMOA 1JI2A 1FH8A 3PHAA 2XTKA 1BLIA 3GXFA 3GTNA 4QCEA 1BHGA 2EQDA 1WZAA 4HMCA 4KH2A 4ZEPA 2W66A 2PI6A 2ZUNA 1FFQA 4CGTA 1UH2A 1KB3A 5A6KA 1EOMA 4JAWA 2NW0A 4XV0A 3WD0A 3MKKA 1F1SA 3PZOA 2DT1A 1E6NA 1BAGA 5CQ1A 3GNOA 2ZWZA 2C7FA 2FH8A 4H8UA 1LWJA 3RM8A 3IJ8A 4AZHA 1PZ3A 5C8BB 2A3AA 2YJQA 4W7UA 1R85A 4AMCA 2ZXBA 2XGBA 1W9XA 2VUYA 4XX6A 2AMGA 3AHVA 3FAXA 2E8YA 4D6HA 1Q6CA 1I8QA 2WHJA 1BF2A 3GH5A 1LXKA 1NWSA 1GOWA 5A6BD 1MFVA 1BYDA 2BY3A 4BQ5A 2BVDA 4B3KA 1BYCA 3CZGA 1H0IA 3SCUA 2VQTA 1UR2A 2V3FA 3VGGA 3SUTA 2YIHA 1JZ8A 3CHEA 3EMZA 1CENA 3SCTA 4CCCA 3CZEA 3IJ7A 2J75A 4ZE4A 3EBVA 1UKTA 4F79A 3WBAA 2F8QA 3ARTA 3VIJA 3BAIA 2YA0A 3TTYA 4LYRA 3SCWA 1TR1A 1AQMA 2DH2A 4JFTA 3F4VA 3BSHA 1X6NA 4MNLA 4HPHA 5A94A 2WMFA 2XFYA 4JFSA 3ARZA 1KXHA 5HNNA 2WLZA 5CSYA 4TVCA 4JCLA 3AXXA 4C7FA 1E4MM 2QF8A 1XD0A 2ESCA 3IJ9A 4GZIA 4M82A 3SCPA 3KE0A 4AZGA 1UD4A 3II1A 4HMDA 1ZU8A 3WH8A 2TAAA 3WN6A 1NWRA 2DIEA 5DFAA 3ALFA 4KGJA 5E09A 4WSJA 3AFBA 1RWFA 4R27A 4CKQA 1J0HA 3QHMA 1XD1A 4TOQA 5IFTA 1M03A 2ZX7A 2O92A 2OWCA 3PZUA 4WIWA 3U5UA 1V3LA 1HVQA 2Y4SA 1CIUA 3N11A 5HDRA 1UD2A 1L0PA 3K46A 3W0KA 3A6OA 1KCKA 2D23A 2WCGA 2D0GA 2W63A 1W1YA 2XG9A 1VFOA 1CTNA 4MDPA 2VZUA 1WDSA 2NT1A 3VMNA 1XYFA 1LL4A 1P6WA 3B9DA 3G6LA 5A69A 3N1AA 2BRPA 3VIKA 1C82A 4CVUA 5JIPA 1B3WA 3BCFA 2DDXA 2E22A 1UR1A 2PF0A 4MB1A 1DHKA 3CH9A 1KCLA 3BH4A 1JZ2A 4D1JA 1U33A 4U33A 3ZJ7A 1WP6A 5BYWA 4A4AA 3VIOA 2EXOA 2UY3A 5M17A 1XC6A 4B16A 3GNPA 2J25A 1QNQA 1WPCA 3AROA 1E15A 4DUVA 4KGLA 4N0RA 4Q7NA 3A4AA 3A3HA 4AY1A 1JDCA 1NWTA 4TX6A 3RJXA 1CECA 1E4LA 5CGTA 1B9ZA 2UY2A 1S46A 1RD6A 2YA2A 2B31A 2CITA 2ZXDA 2XGIA 4JKMA 4EAMA 5HBFA 1V02E 3VVGA 1CB8A 5DEZA 4EKJA 1UZ4A 1XSIA 3AISA 3FHAA 2FDMA 1QI2A 3AHXA 3T2PA 1J0NA 3WD3A 2Y24A 1UKPA 3HJEA 2V38A 3N18A 4AIOA 1XH0A 4QLJA 1CXIA 1WZLA 3OLIA 4HP5A 4J3TA 3OGVA 2JF7A 5AYBA 2YBUA 3EMQA 1FOBA 2XFRA 2FGZA 2BS9A 2BNJA 4UFJA 2W61A 3CZ8A 3ZT6A 1GORA 1JL8A 3WMCA 3TTSA 3AXHA 1NARA 4JKKA 2VRKA 1US3A 4OBRA 1HM3A 2WHKA 1FH7A 1E1FA 4JKLA 2VZTA 3AMLA 1KR0A 1XRVA 5ABFA 3KL0A 3T0BA 5M03A 1JZ7A 1RWAA 1M01A 1VJZA 2PBOA 2GSJA 4X0VA 2E9BA 3N12A 4LX4A 2VX5A 4PMUA 2E9MA 1GOOA 4JFVA 1UA7A 3WMSA 4AZ6A 2BRVX 3VDCA 1QHPA 1OD0A 3K4DA 2PB1A 4P8XA 1GHSA 1RP9A 2WVVA 1EHAA 2XIBA 4CD5A 1LLOA 3WDQA 2G3JA 5GNZA 3W6MA 1SMAA 1ISWA 1N82A 1SYTA 2ZX8A 1HL8A 3BC9A 1VEPA 8A3HA 4PTMA 1B1YA 2D0FA 4QFUA 1MVYA 1W1TA 3FN9A 1CLVA 3I3BA 3L2MA 4IUGA 4Q22A 1EQCA 1NOWA 1OJOA 1MW0A 2J8FA 2VC9A 2WAGA 3NIYA 2J8GA 4WJXA 2D20A 4GI6A 1E5JA 4MADA 4KRUA 4P7LA 5BWFA 1H41A 3W38A 4RE4A 2OLHA 1WB0A 4RE3A 3M46A 4AZBA 1GW1A 1UKQA 2DT3A 1TFVA 3PZGA 4HA1A 4W5UA 1E73M 4W89A 4TX8A 3ALGA 2CYGA 1XHGA 4PYSA 4J3UA 4PCSA 5KEZA 2YL9A 2VX7A 3SURA 5BXRA 1W32A 2F2HA 1F9GA 4W5ZA 3RIKA 4MJ4A 4HOZA 1PJ9A 2CKSA 3PZIA 4D6IA 1D7FA 3DECA 2WANA 4MAZA 4URIA 3QGVA 3ZO9A 2OWWA 2J7CA 4ACZB 1UG6A 1Q6DA 3RM4A 3WELA 3WDPP 4W8BA 2G3NA 1EDQA 2EPKX 2ZE0A 4AD1A 2X03A 1EGZA 1DEDA 2G3IA 4JL1A 1YHTA 1K6AA 4F9JA 4OBSA 1C8XA 5A8MA 3LPFA 2ZXAA 2D2OA 1GQJA 5DT5A 1VB9A 4QDMA 1TVPA 1V08A 3VD7A 2JEPA 5CLTA 4YHEA 3PZMA 1FHLA 2Z1SA 4F9DA 1GNXA 4P7QA 3ZIZA 5JBEA 4S3KA 1GOKA 1OT2A 4IPLA 5A2BA 3PZTA 3N17A 3WL0A 1TE1A 3JUGA 3SCSA 4WKAA 3AIVA 1UHVA 3CZLA 4M1RA 4U5KA 3D5HA 3VIIA 3U7BA 3NCOA 3KWXA 4AZCB 2XFFA 3OZOA 1J0JA 1E43A 1ITXA 1LQ0A 5E0FA 3S6TA 4W87A 3RPMA 3VDBA 2G8ZA 2QV4A 3F5KA 1OGBA 1DWAM 2UY5A 4BF7A 5BXTA 1W1VA 1OB0A 2YL5A 3CHDA 1E6RA 1HX0A 3SCRA 3ZJKA 4GZEA 2Q1FA 2BVTA 1LF1A 3ZR6A 3WQ4A 4NRSA 4F66A 1D3CA 1CYGA 4AD2A 1AQHA 4FLSA 1F4AA 3WEMA 3BSGA 5F7UA 1LJYA 4JL2A 3VGFA 3N04A 4IPNB 3VUPA 4JCMA 3OLEA 4ATLA 1JZ3A 4AZIA 4P7OA 1OD8A 1CXHA 3HU7A 2JIEA 1TCMA 5CXPA 3W37A 1UR0A 2AAAA 3SCNA 3L4XA 5ABGA 2VR5A 1H4PA 3QOMA 1UQZA 3VD5A 1DWIM 2WSPA 5M5DA 2OSWA 1QVBA 2D24A 1E0XA 4D6FA 3CZKA 5DO8A 3VMPA 2D3LA 1GPFA 2WVSA 1J0MA 3WD1A 3AS1A 3WH6A 2VCAA 3NJ3A 4AIEA 4FLRA 3CGTA 2WXDM 1JFXA 4YHGA 2RGMA 1PX3A 5IFPA 3UERA 4ZENA 2PWDA 1HJUA 1W9UA 4JFWA 2WMKA 3WSUA 7TAAA 5IXEA 4D6CA 3W27A 4FLOA 4GI9A 3BLPX 4HOXA 1E0WA 1K9TA 2VVNA 3NSXA 1E9LA 1WE5A 4J28A 1LG1A 1EXPA 1PIGA 1HJXA 4D1IA 3LPOA 4JFUA 1CXKA 4AD4A 1NP0A 1J18A 2WM0A 3AS0A 3ZT7A 3PZNA 1EO7A 4UFIA 1JDDA 2UY4A 4W88A 5BXSA 1AMYA 3PZVA 3WQ6A 2VZOA 2WNWA 1N7OA 4BZYA 1C93A 1X6LA 4MTVA 4TXEA 2G3MA 4WF7A 3DYMA 1V3HA 1GOQA 3ARVA 4HTYA 5I78A 1HJQA 1KGWA 4CCEA 1X1IA 1G94A 1O7AA 2BFGA 2PBGA 4ACYA 5IHRA 1OBAA 3MUIA 3MSDA 3RJYA 4P8VA 2WC7A 1GQIA 5CZKA 4WSKA 2V3DA 2F61A 1HKJA 2WC4A 1CXEA 3VINA 3NDZA 4W84A 2HVMA 4C7DA 5FD0A 1F4HA 4JZ5A 2DSVA 3RILA 1EDGA 2CESA 5A2CA 1WDRA 3WNPA 5CLWA 1V6WA 3WBEA 1VEMA 5A1AA 3TP4A 2JEQA 2QPUA 2WCSA 3PTMA 1HKMA 3WFLA 4H04A 5AY7A 4J3XA 4H8HA 5LA0A 2VNCA 1CXFA 4HU8A 1KWGA 3F5LA 3QOKA 3U5YA 1UUQA 3AJ7A 1IZJA 1ODUA 4FLQA 5EFFA 4CD8A 1RPKA 3WIJA 1QNSA 2X1IA 2FHBA 3RDKA 3NDYA 2QLYA 2PWEA 4NRRA 3M6DA 4C7GA 3A47A 3FNDA 3WQ8A 5A6MA 4LYQA 1UWIA 1H2JA 3WEOA 2WWDA 4UOZA 3AI0A 4WLCA 3WD2A 2BHZA 3AMKA 3ZOAA 1QI5A 5A8NA 3VD3A 2E0PA 3W82A 2CBUA 1UD3A 2OYMA 2V5CA 2VT0A 1HT6A 1PEZA 3VIHA 1MQQA 2HISA 1W3LA 3FW6A 4GQRA 3THDA 5LA1A 1GUVA 3NSMA 3WF2A 4DWSB 1B3YA 6CGTA 4UFLA 2V3EA 5KZ6A 5JBDA 4W93A 2A3EA 4AW7A 3BMVA 1W3HA 1GVYA 4PMYA 1VFUA 5FCZA 1CLXA 3ARRA 2ZUMA 1XGZA 2DSWA 3CUIA 1ODZA 1XSKA 1YQ2A 4HA4A 4CU8A 4UFKA 1JF6A 3WD4A 2VR4A 2WC3A 1ESWA 1G1YA 1B31A 1OJNA 4TVUA 2GDUA 3UESA 2WKGA 4PTWA 4EANA 2W62A 4M81A 1UH3A 3OB8A 4YPJA 2D3NA 3TTQA 1VFFA 4CU7A 3GXIA 1GQKA 1I1XA 3AZRA 1JZ5A 3MSGA 1NQ6A 5I24A 3PZQA 3TA9A 2VJXA 4AISA 5I6SA 1RWCA 1CGYA 3WDRA 1HJWA 2VMFA 4B3LA 4ACZA 4AYSA 4XB3A 1N7QA 5GQBA 4ZXLA 4LGXA 7CGTA 1Q4NX 2D0HA 2X2YA 1A3HA 3TONA 1UYQA 4DWSD 3WF1A 5C71A 4M29A 2BRWA 2E9LA 1XSJA 3B9EA 2QPSA 1C8QA 2WDAA 2JIWA 2FHFA 2BXYA 1J0YA 8CGTA 2G41A 3GH7A 1H49A 5DMYA 3MV01 1H11A 1FP8A 3CO4A 3WKZA 3AZSA 3VU2A 1J9YA 1OM0A 4E2OA 5CG0A 1QHOA 4PMQA 2J78A 2GK1B 2XVLA 4L4PA 4U5IA 1V0KA 2WVTA 2J7BA 1SR0A 5I23A 1MXGA 4UOJA 1IZKA 4MNKA 1DP0A 2CPUA 1GJWA 1WO2A 3WH9A 4P7NA 4AZCA 3K4AA 1JGIA 4OUEA 3IK2A 1XYZA 3SCQA 4CCDA 4GZJA 3WDIA 3WNNA 4LQ1A 1TA3A 4BQ4A 3VGBA 2OYLA 2XIIA 3N13A 1QNRA 1QW8A 1Q6GA 1BYAA 1GOMA 3SCOA 3W29A 1TG7A 1UZ1A 4FK9A 4Z2GA 1G0CA 2DSKA 3CBWA 2A3BA 3CUFA 5D8WA 1KQZA 3VIMA 1BG4A 2W67A 1LL7A 1HKIA 3OLDA 3PZ9A 3DHUA 3KZSA 4AWEA 5A3HA 2VTFA 4CD4A 2GJRA 2J7GA 3SIMA 3PTKA 5GNYA 9CGTA 1E70M 4ZFMA 3D3AA 1H0GA 2EPNA 2CEQA 4HA3A 4KRTA 1G9HA 1UA3A 1CDGA 1GOIA 4EK7A 4LXFA 3WUBA 4X9YA 1GVIA 2VCCA 1LWHA 1E72M 3UG4A 1M04A 1IT0A 1GJUA 4E8CA 3PTQA 1ZJBA 1QPKA 2IXUA 2V5DA 3BAXA 3CIVA 1VF8A 4WK9A 1TUXA 1BVZA 2FGLA 3BXWA 4HOWA 1C7SA 4CU6A 3AIBA 4ATWA 2YLAA 2VVSA 2BY2A 1R7AA 2J77A 1MW3A 2J7HA 4V2XA 2CBJA 2EBNA 4J3VA 2VX4A 1HJVA 2WZEA 3FXYA 3OBAA 4XZBA 4UQAA 3EDEA 3AIUA
chains in the Genus database with same CATH superfamily
2ZX6A 4N7QA 5IM51 3RFAA 3ABRA 1HO4A 4DHGA 2CWNA 3O2LA 4DO6A 3VILA 3THCA 3AMDA 1JCYA 4H2CA 2HROA 1J2BA 4F0RA 1MEWA 4NAEA 2V67A 4PMXA 1SMDA 4IIDA 1KLZA 1J5TA 1S2AA 4XZWA 5CC3A 3LLFA 5J8LA 1UH4A 3WBYA 4GJIA 2E5CA 3UWQA 4NSBA 1LTDA 5A2AA 3M43A 4GXPA 3J7HA 4LS1A 4FR6A 2R1NA 1BQGA 4WRHA 1E3XA 1DJWA 2WMHA 2X0HA 4UNIA 2E24A 2AGKA 1YDVA 5CEWA 3L4TA 3N9KA 4N42A 4XQ6A 2X0YA 3TXZA 3BLKA 3V0TA 2CLLA 1PPIA 3UYCA 2OT0A 1MQPA 2ZUUA 1AQ0A 3WK3A 5AOUA 3FYOA 5KZMA 2P0IA 1OCQA 1Q6FA 3GYCA 1VP5A 3IVSA 2J8TA 2ZTJA 1RSCA 4MY9A 3STGA 1R3TA 3H7UA 3T09A 4GKLA 1F8MA 4UOQA 2O7SA 2BHYA 2R8WA 3QTPA 1ZALA 2X7VA 2JE8A 1DXFA 5HAOA 3WEZA 2QS8A 1BG9A 4TR9A 4GRSA 1UASA 3VX1A 6XIMA 1JYXA 3BMXA 3M47A 1V3MA 4KWUA 3BGAA 3N34A 1EH9A 1YBQA 1RP8A 3ZMRA 4IIFA 2PC4A 4LUYA 4JD4A 1X1HA 1R2TA 2EPOA 2ZXQA 4DAFA 3PBUA 5E0CA 3AALA 1JAKA 4KT2A 5A6SA 1MXSA 3GNDA 3MI6A 5C9ZA 4DWSA 2BTMA 4O0ZA 4K36A 3MCOA 2WHLA 2GGHA 3VZXA 4DBDA 3CJPA 4NY2A 2B4GA 3ONBA 4O52A 3I68A 3EWXA 1DJQA 3DHDA 4H9XA 2DZSA 4E4PA 1QFEA 3MBFA 1ZJAA 3DKJA 3S9ZA 3T9PA 4NAFA 4CNUA 2OKOA 4K37A 1DWHM 2CW6A 1AA1B 1YDYA 1J0ZA 3VOCA 4IFOA 5CPTA 3WUGA 3OJGA 4DUWA 1IEWA 3A12A 2P3EA 4E38A 1PX8A 3AHYA 5M1TA 5J5DA 4H41A 3EB3A 1IR1A 1EO5A 4DUXA 1WZMA 3IANA 1XLBA 4Y2WA 1AK5A 3OLGA 3L21A 4Z2KA 1KC7A 4XUYA 2TMDA 1R9ZA 4F0MA 3SJ3A 1IGWA 1I2PA 4MF4A 2B7QA 2GUYA 3KX6A 2QAPA 1Z69A 4CN1A 1UP0A 5GNXA 4LB3A 4IXHA 4UR9A 1PBGA 3QMRA 4OGZA 4UR7A 4XAZA 9XIMA 4QXIA 3W2NA 5FJTA 4Z0SA 4MWAA 2ISWA 5CJMA 3BTNA 2CERA 2ZUSA 5M3WA 1Q3NA 3KBNA 3P7YA 1UJQA 1V0LA 1TV8A 2D22A 3POCA 3NO5A 4ORIA 3R13A 4UCFA 5EB8A 4H6RA 3BGGA 1B30A 4AHOA 4ZFCA 3GR4A 3B0VC 5D02A 2B7NA 1CXLA 4P7RA 5D9MA 3EZ4A 5DRCA 4ROQA 2AKZA 2A7NA 2X8RA 3PWGA 2IKJA 2OX1A 4I5XA 3COTA 5I3FA 3BAYA 5MKGB 1HJSA 1EIXA 2OWXA 4UTTA 3HG4A 5KTLA 3INPA 4WJ8A 5CSSA 2WMIB 1VCVA 4A29A 5C7HA 1Q65A 2OMAA 3CEPA 2OO0A 2NXIA 4IPIA 1BSIA 1ZCCA 1C9WA 1TJ0A 5C54A 3CC1A 2E7FA 4GD0A 3N9SA 3LHWA 4GPNA 1TWZA 1OT1A 4ILSA 3CM4A 3SUSA 2R1PA 3GAKA 1W56A 1MEHA 3F2CA 1MXDA 3MSYA 2ZUWA 4OT7A 1RV8A 2Z25A 2FZBA 4GNJA 4AG0A 1TMLA 1EQPA 4OOUA 4MG4A 2NXGA 3FEMA 1DWGM 3B9AA 2DZBA 1N8FA 1QO2A 3DHPA 1DIDA 3M07A 1OFBA 3STCA 1J0IA 1WCGA 1J0KA 3HJZA 4RX0A 3H8AA 3POHA 3ELFA 4P8UA 4NL1A 4OHQA 2XVNA 5G5IA 3L0NA 1V03A 3IJDA 1V6UA 4IQEA 4J2PA 3F03K 3RMJA 1PX4A 2C0HA 2NUYA 3DAQA 5HXMA 1HMWA 2E67A 3FDGA 3GQYA 3W83A 3E2RA 4X2PA 1OVDA 3WLQA 1S1PA 4HJWA 3UZJA 3GTHA 4Q4QA 1FHDA 1KTBA 1R8LA 3FS2A 3RPDA 2YFOA 3G1FA 1ZZMA 3ARYA 3VNKA 2C1IA 3M0LA 1ECEA 3D0CA 3L4UA 5JUVA 1MFUA 3V0UA 4W8LA 1QW7A 1TVNA 4EWND 4V1YA 3HV8A 1BTCA 4DEFA 1GG1A 3MUY1 4D2JA 2PU0A 2QMKA 4C6BA 2FMNA 1K8YA 5AECA 1UP2A 1TZ7A 4LBRA 2UBPC 5K9DA 2NQZA 1YNPA 4NJIA 1WX0A 2W6RA 4IP5A 1GYMA 1NWUA 3A4WA 5IHSA 4K6AA 2VI0A 2ZRXA 2ZWYA 4GUJA 3WF3A 3L2LA 4QISA 1Q4WA 2JFEX 1LUCB 4RW5A 3CIXA 3KDOA 1A80A 2VURA 1FCUA 6REQB 4BI7A 3BG9A 3REQA 2V3GA 2Y5EA 2PFHA 5TAOA 1V7AA 5LXXA 4K38A 3K13A 1PKNA 3U2EA 4B91A 2VDHA 1KBBA 4INFA 1EUNA 5J5RA 3E1F1 2EPHA 4QLLA 3NPWA 4HN4A 1E4IA 1O5XA 3M0ZA 5ECUA 3CHCA 3E3HA 1KXTA 2HXUA 3P5ZA 3Q37A 1KFEA 1XV8A 4OV9A 1HXJA 1NOUA 1W3JA 4WY0A 2DQXA 1V0MA 3C61A 3FY1A 1OGGA 1EPVA 1JCJA 2WWCA 2FZDA 2RKXA 4Q8TA 1TQXA 1FA2A 1NEYA 4TTGA 2PGRA 3UA3A 3DG7A 3MMDA 3AWOA 5H6HA 3HPZA 1QW9A 5A8QA 4UR8A 1U1UA 4ZSTA 2WOQA 1FUYA 5GPRA 1JG9A 5EMJA 4KCVA 6TIMA 1QPRA 4EPBC 2PWFA 4Z2IA 2A3LA 3MO4A 3KTXA 2ZZ1A 3A4JA 1QI3A 3SUUA 3GBEA 2YCIX 1OJPA 3W7IA 3LMYA 1JXJA 1KW1A 3T2QA 1CLKA 1J6OA 3N4FA 1EF2A 1OX6A 2Y85A 3GM8A 3NSNA 5DCEA 3TVAA 1ZPTA 1V0NA 4LJ3A 1BVNP 3AIQA 4JTAA 3SECA 2DSZA 2VOTA 4HNVA 4IM4A 3CUHA 3GDBA 3W7RA 1Z32X 3W6LA 4ATDA 2NVCA 1IQ8A 1KWKA 2J7EA 1S2UA 7REQA 4JX5A 4ZQCA 3IIZA 3RX4A 4C5YA 1C3FA 3PJXA 2Z1KA 3LCWA 5DT7A 2GJXA 3GKFA 5BXPA 2WK2A 1P7TB 2WSKA 1JIBA 1HKVA 1OCNA 4DF1A 1XC4A 1VLIA 2XJ7A 1R3VA 4XVDA 3GXNA 1XIEA 3KXQA 3UG3A 1W9PA 3B8SA 3TZFA 1MW2A 4GO9A 1DIKA 4P2VA 2CU0A 2E4TA 3WJYA 1LORA 3E38A 1POJA 2CCRA 2ISSA 3N3TA 3YPIA 2OSXA 3MUZ1 5DMMA 3Q2DA 1EP2A 4TUFA 4Z1AA 4PSPA 1MNZA 5E9AA 1DJHA 3U9IA 3IGSA 3IGHX 1R7OA 4S3EA 3VGEA 5C5YA 1CI1A 1FY6A 4GKTA 3WDHA 3WFZA 2QDEA 1ZTVA 4HK6A 3P61A 3USZA 3AO0A 3WLSA 3L4VA 4GYFA 3N2TA 2GVYA 2WCAA 5D2VA 5JBFA 1NELA 3GHSA 4ZZ9A 2ZICA 1D2KA 3CL7A 3GE7A 3LENA 3DG6A 3FGCB 1TV5A 3N2OA 2ISVA 4NZJA 5D04C 1VENA 1HF6A 3OW1A 3CUZA 2ZCGA 1H3GA 1KGUA 3LZ3A 4M8UA 1ISVA 3W2JA 5FF3A 1PWLA 4PFHA 2FPVA 1I2QA 3SIZA 3OA3A 2A0NA 1WBHA 1FWBC 2YZRA 5HWJA 4GQGA 2Z27A 2OEMA 2QCLA 2Z1BA 3CB8A 4Q4SA 4Y9NA 4RE2A 4LRSA 4MZYA 3CMJA 3ZLHA 3VNYA 3FSUA 4H83A 3VO0A 2RJGA 2X1RA 3UGRA 1DBTA 2FJUB 4S3AA 1TWSA 3AOFA 4JTTA 4L9YA 3UWZA 3ZVIA 3DUGA 4LU0A 1I1WA 3VOFA 5ABFB 3W9ZA 5B7YA 4AWUA 1JR1A 5FKYA 1QMLA 2TYSA 4AEEA 5E70A 4PTVA 1Q2SA 3G0XA 3C6CA 2O4QA 2XYLA 1LLZA 5BOFA 1T96A 3C8FA 3QBUA 4K8HA 2DH3A 1NSJA 3Q65A 3L4ZA 3EWCA 1VFMA 1VBRA 2DIKA 3L68A 2PDXA 4CQ8A 1Q85A 3GWQA 1OX4A 3H2MA 5DLCA 3KWSA 1PTDA 4RNHA 3SQLA 1HP4A 3SAZA 2V6AA 4FMVA 2EG7A 3WJZA 3AS3A 3IIXA 4BR1A 2W91A 1VPXA 2VZVA 4W85A 3T0AA 4W86A 2GFTA 2X05A 2YCLB 4QAWA 2WMJA 3WDJA 2WKLA 3C0JA 1E9IA 1XJBA 5E0KA 1E40A 3PVFA 4ZE5A 5BMXA 3ZYZA 4D71A 3W1RA 1B3ZA 3N6QA 3QH2A 2QF7A 4OU1A 5DCDA 4XZMX 3QKZA 1XYCA 3VGHA 3WLLA 1B3XA 3G1YA 5C70A 3W72A 3BQ6A 3PWIA 3QQ0A 2HTMA 2Y8VA 1TTPA 1F5ZA 4JIHA 5TF0A 2WW5A 2WB5A 1YW1A 1BLIA 2VOMA 5CBJA 4HBKA 4QCEA 4HMCA 5DQPA 4ZEPA 4UTWC 2ZUNA 3IT4B 1EOMA 1TPH1 3MKKA 1C8VA 4JGDA 4L1GA 2PU1A 3OODA 2ZWZA 4FXFA 2YSWA 1WQ5A 3IJ8A 1H51A 4AZHA 2RDWA 4P61A 2DZPA 3LRMA 3W2KA 1YXYA 2ZXBA 3H2OA 1TVLA 4R7JA 3LNPA 1W9XA 4XX6A 2AMGA 3GTXA 2E8YA 2H6RA 2P8CA 5IRPA 1UW9A 2BY3A 3S8HA 2C71A 3GXTA 1BYCA 1M7PA 4QROA 3S0CA 1QT1A 3S83A 2VQTA 2BZNA 4JTUA 4TQTA 1DQUA 4KKXA 3VGGA 4HNLA 1FVPA 5AB3A 1CENA 3SCTA 2BGQA 4CCCA 4JTDA 3EBVA 1UKTA 3V5CA 3WBAA 2F6XA 3VIJA 2YEPF 3BAIA 1F6PA 3O63A 2Y88A 4UUIA 3M6YA 3QLDA 4IF2A 4JFTA 3F4VA 4GUHA 3BSHA 1X6NA 2HXTA 2XFYA 3W2MA 4QSFA 3AXXA 2VFDA 5TNVA 1E4MM 2QF8A 2PPGA 1XD0A 4RCXA 4FXSA 4DPQA 2PTDA 1T0OA 5B80A 3CV2A 3KE0A 1F73A 1JQXA 3N25A 3II1A 4HMDA 1R5YA 3V4BA 1W17A 3N2MA 1EX5A 5DFAA 4ASTA 3S5YA 1KRCC 3BOFA 3GX9A 5E09A 3GK0A 4GVHA 1KA9F 2I14A 2PD9A 2QVNA 3LY0A 1KFKA 3H70A 1XD1A 4KCWA 3KLKA 4MKSA 1L0PA 3NM1A 4Q4MA 2V2DA 3VA8A 3E5BA 2ZZ6A 2E09A 1VYRA 3LBOA 4XAGA 1VFOA 4LVFA 4Q8NA 4MDPA 2NT1A 1XYFA 1LL4A 3WBWA 3B9DA 3ABXA 2EHHA 3FOKA 1P0KA 1B3WA 4H01A 4KEZA 3MT1A 1UR1A 1EWDA 4XISA 1JZ2A 4D1JA 1BRLB 1A53A 1U33A 4N6EA 1JPKA 3ZJ7A 1OEPA 1WP6A 4RZ5A 3TYBA 2AQVA 3LEPA 2ZKMX 2UY3A 2E77A 1SZNA 4B16A 1D7KA 1B9BA 1WPCA 3V35A 3AROA 4S1FA 1ZRQA 3G77A 4NNAA 1JDCA 4MKVA 1NWTA 4TX6A 2VGGA 2V5BA 1ONWA 5CGTA 1SR9A 2QJIA 2C79A 2YA2A 1KM1A 2CITA 3USBA 5HBFA 2ISFA 3W7OA 4EKJA 4O53A 1MMFA 3WD3A 3HJEA 3NQFA 1YMYA 5AYXA 3JU2A 2QXWA 1UROA 4KCUA 3OLIA 4HP5A 2Y61A 3W86A 2Y5SA 2C1GA 2VC6A 1JPHA 4BY3A 2W61A 3CZ8A 5EMUA 3GC4A 3TLLA 4WEVX 1JL8A 4PUMA 3AXHA 1XXXA 4AB4A 4GUIA 5EYWA 4JKKA 1HM3A 2WHKA 3RX3A 4US5A 3RAOA 2NQLA 3WLOA 5FSDC 1AJ2A 3BOXA 1V51A 3W1PA 1RWAA 1M01A 3U7BA 4LX4A 2VX5A 4JFVA 3HV9A 4WQ6A 4QTGA 2QNEA 4GWEA 3UCCA 3NQDA 2FVMA 4LF2A 4HNOA 1QHPA 3WJWA 3V1HA 3HQ1A 4P8XA 1EHAA 2XIBA 3QZAA 1LLOA 3NQBA 4I5UA 3WBXA 3WDQA 2G3JA 3BOLA 3W6MA 1ZY9A 4GA8A 2NLYA 1SYTA 1KD0A 3UG8A 1H63A 2Y89A 3MO7A 4HCLA 4MLJA 3NYZA 4PTMA 1B1YA 3QY6A 2WM1A 4L5ZA 1NOWA 1OJOA 4B2DA 1H62A 1MRQA 3GY1A 4QITA 1OFQA 1KM6A 1YX1A 4F48A 5EPDA 5H8UA 1E5JA 4MADA 1XP3A 2DV0A 3PSWA 1JRCA 2YPIA 1FDZA 3M16A 4HVXA 3UWVA 1GW1A 2DT3A 1TFVA 4UNKA 1SZRA 2TPSA 2CYGA 2VX7A 1LYXA 4DBEA 3M0MA 1PJ9A 1S5NA 4D6IA 4LUTB 3DECA 3LQGA 2DZWA 3TJ4A 3ENLA 4H6EA 3NEVA 1YEYA 2A5HA 3S47A 4ACZB 5C6MA 3WELA 2V5KA 3L0KA 4W8BA 2G3NA 2EPKX 3MVTA 2VFIA 1LRTA 1EGZA 3P2VA 3GZ3A 1RK6A 4PBFA 5A8MA 2XIOA 3T81A 3TYCA 4FIRA 2QULA 1GQJA 2BOEX 1ITUA 4XTDA 1V08A 1G4TA 3IVUA 3HFYA 3CPRA 4ECLA 2JEPA 1VZWA 3PZMA 3NQ8A 3W1AA 2Z1SA 3SB0A 1GNXA 2MUCA 3N14A 4P7QA 1L6FA 3ZIZA 4S3KA 2GVEA 4IPLA 4C6MA 1S38A 3N19B 1TE1A 3SCSA 4E5TA 1SUXA 3QFWA 1UHVA 3V3WA 4M1RA 3ABOA 3AU2A 3B97A 3W01A 3LGEA 1R38A 1XIIA 4WGHA 3KWXA 3T7VA 2XFFA 1JULA 1E43A 3OZOA 1V93A 1FWTA 4B5VA 1RCXB 2OELA 2PDYA 2J27A 3B06A 2PDCA 1O5RA 3WQPA 4YWSA 4ZTXA 3PK7A 1OGBA 3M5YA 1DWAM 2UY5A 3LTYA 3MWAA 4BF7A 1T6MA 1BXBA 3UJEA 1OB0A 2VEPA 3CHDA 3OG3A 1Z3NA 3WCZA 2E68A 3HG3A 4UIOA 5K9XA 2Q1FA 1U83A 3B4YA 4DYKA 2GOUA 3W7HA 3ES8A 2Q02A 1FTXA 1XIDA 4DZAA 2PDMA 3BE7A 4TV5A 1D3CA 2CLFA 1AQHA 4DJFD 3E96A 3T40A 1VYSX 1R3WA 3N04A 2RJHA 5K3VA 1GK8A 3V1PA 5KETA 1CXHA 2JIEA 2GJNA 1UR0A 2AAAA 3G0SA 4EX4A 1GEQA 4S2BA 5ABGA 1H4PA 5FAGA 1UQZA 2WSPA 3WFAA 1FX6A 2INZA 4YS1A 5T8GA 1GPFA 1J0MA 1A50A 2ZVIA 1EJ7L 3WH6A 4HYWA 5EMKA 3BQ5A 4EVZA 4JNMA 2RGMA 3T8QA 4WOZA 1PX3A 3PJWA 3BV7A 3UERA 4ZENA 4Z17A 3GU9A 4D6CA 4FLOA 4PH6A 1B5TA 1ME7A 1E9LA 3CQKA 1LG1A 3UZWA 4JFUA 4Z1YA 2B81A 1CXKA 5XIMA 3VE7A 1U5JA 2YGYA 3L0GA 1NP0A 2H90A 1J18A 1H60A 1NTHA 1EO7A 4UFIA 2UY4A 1UJPA 2MNRA 3SGUA 1C93A 1X6LA 4MTVA 3KVJA 3F4WA 4HTYA 1QU4A 3C3UA 2FTYA 1G94A 3T0CA 4ACYA 4JX4A 3TH6A 2WC7A 3QV6A 1DTNA 3TR9A 3APTA 2JQXA 3EWDA 2D73A 3LDVA 3GSMA 3T78A 4O0KA 1L8PA 2F61A 2YW3A 1PYFA 4QG8A 5H2ZA 1YPFA 4C7DA 3OIXA 4JZ5A 3RILA 1EDGA 3VUSA 3PWAA 3OTRA 2CWXA 3F4NA 3MTWA 3TP4A 2QPUA 2WCSA 1HKMA 3TE9A 3F2BA 5LIXX 5LA0A 2VNCA 1AJ0A 1TV7A 3G3MA 1UUQA 1PTGA 3LHTA 1ODUA 3LUTA 3GFYA 4CD8A 2AL2B 3IT6B 2V5LA 4H2HA 3NXLA 3GNNA 1XISA 2KXSA 2ZE3A 2PWEA 3H7VA 4XIMA 2Z6JA 4C7GA 2PS2A 3KLLA 3QRHA 4LYQA 4CNOA 4F2BA 3P0XA 1V7YA 3AI0A 4WLCA 2V63A 1QI5A 5A8NA 1X7FA 3VD3A 5BWAA 4KFOA 1UD3A 1V6TA 2OYMA 1JCXA 3TNOA 2V5CA 4NP7A 4L7ZA 3TAKA 1O5KA 4YJ5A 3R0KA 4XWUA 3AWNA 1K4GA 5CZTA 2VUNA 4GQRA 3THDA 3FYPA 5T9BG 5LA1A 3OBEA 4G2DA 1KBJA 2G97A 5G1TA 3QMSA 3MKCA 1X7IA 4UFLA 1T5AA 4PB3A 2V3EA 3P14A 3WLJA 3IUIA 2CLMA 4W93A 4LF1A 1BEUA 4FA3A 2NQ9A 3A9IA 3H26A 4PMYA 2EGZA 4B4HA 3BLFA 1CLXA 1ZFJA 2ZUMA 4AC7C 1VRDA 1SFTA 2E5DA 4XO7A 5KMYA 1FCVA 3LMZA 3GR8A 3VCNA 1G1YA 2Y1HA 3LLXA 3CV1A 3NQ7A 3UESA 2WKGA 4M81A 5CJNA 1OYBA 2W27A 2YX0A 2R91A 3OB8A 4HD5A 3TTQA 1F3EA 2IS7A 2XFWA 6ALDA 1I1XA 2V8ZA 4GYPA 1JZ5A 4GCXA 4AY7A 3TA9A 3S5SA 3C5QA 3OYXA 4M6QA 3ID7A 2A21A 2HK0A 1HJWA 2J13A 3CS2A 3W7GA 4AYSA 5DY3A 5GQBA 7CGTA 3S42A 3TONA 3TIMA 3NPUA 4DWSD 4UTJA 3P93A 4O8AA 3B4UA 1Z44A 1US0A 1F3TA 2E9LA 3KOYA 3T4CA 2QPSA 3W6YA 3GKAA 1FWEC 2V9DA 4NKCA 1Q63A 2FHFA 1RY0A 2Y7FA 5LNRA 2BXYA 3PNZA 2G41A 1H11A 3CO4A 4RR4A 2GK1B 1M5WA 1PIIA 3F4CA 1U5HA 5E1QA 2QVHA 1XL9A 4ROPA 3P80A 4FR1A 4F40A 5I23A 2GJLA 5DX7A 3CWHA 4S3GA 4MNKA 3U0HA 1GJWA 2DVUA 1DJGA 3W7DA 4Z08A 4AZCA 1HG3A 4OUEA 4R33A 2NUXA 1XYZA 2ODOA 2DZTA 4CCDA 3WDIA 1KTCA 4LQ1A 3VGBA 2INFA 4Y9PA 3CAWA 4ENLA 4C1NB 1AD4A 3NZ1A 1KKRA 1SPQA 2QT3A 1UZ1A 3U3HA 4Z2GA 5D8WA 1KQZA 4ZQRA 3LGDA 3P8JA 4A3UA 1G7VA 1I2RA 1LL7A 3PZ9A 4AWEA 2GZXA 1OCBA 4JTGA 3S5NA 3D3AA 4KRTA 4NVTA 1WOAA 4EK7A 1ZAJA 2ALDA 1IEQA 4O4VA 2VCCA 3S1GA 5D33A 1HGWA 4N4QA 1GKPA 3UG4A 1MZRA 1AW1A 1U5VA 1B57A 3CIVA 1VF8A 3TFXA 4MWAD 4M7SA 5G1YA 3DI0A 5D32A 4ZMGA 3HF3A 3T4WA 2POZA 3AIBA 4DY1A 1JDEA 1AH4A 1LROA 2A4AA 4PTNA 1HJVA 2WZEA 3FXYA 1O95A 5I3GA 4JIRA 3GHUA 2Z0IA 3O6DA 3IS4A 2VZSA 3PPHA 3O07A 4XO6A 5LXEA 4KWWA 3CIWA 3SQMA 3KTCA 3FYYA 2BV9A 3SN0A 4QG9A 4S39A 1K4HA 1TV4A 1Z6KA 2Q8XA 3EKZA 1W9VA 3B8TA 1TYGA 1FWNA 2YL8A 1HIZA 4JS3A 4IFKA 3S3GA 2PDFA 1EC9A 1BKHA 5I3KA 3KBSA 1MEIA 4A3HA 2H9AB 3W7CA 3ZZ1A 3W81A 3T8LA 1QK0A 1GWJA 2PDIA 1OC7A 3UPBA 2Z29A 1ZBWA 3NUKA 3DC0A 3HZ3A 2Q3OA 1EUAA 2FZNA 3RYSA 4GVIA 2O9OA 2XSBA 5AHFA 2VKZG 2PRLA 1EA9C 3A4XA 2EEXA 5CGMA 3EX1A 4GVFA 3K8MA 1PIFA 1OF8A 1TRIA 4AIBA 1QATA 4MVAA 3M5ZA 3R89A 3S2CA 1JNDA 3BJSA 2WKJA 3C86A 4KPLA 4NI3A 4W7WA 4DPPA 3QYSA 1QPOA 3IAQA 1E6PA 1TWWA 1Z48A 2WLYA 3FJ6A 4K1GA 3PY2A 4FIQA 3H2EA 3RLVA 1IGSA 4Q7IA 3GNRA 3JZEA 1J10A 2OQHA 4QCFA 4A8NA 1HKKA 3DG3A 4LS2A 1RUSA 3G1HA 4KEVA 4Q4PA 4GNKB 3R10A 1AZ2A 2CHOA 1TA3B 5AC4A 4RLIA 1IZCA 4RE0A 4OJYA 2AQOA 2XH4A 2DT2A 4GYKA 5I3IA 4RV8A 2OG9A 4YCOA 1UQYA 2QKFA 4L56A 2I57A 1SW7A 3H12A 1LXMA 3NO3A 1EC8A 3R0DA 3C4UA 3E49A 4RXGA 2WBGA 3NTYA 1XCXA 3FHQA 3H2CA 5LIUX 4W8AA 4M80A 1JD9A 4BJHA 3OZPA 2E40A 1CPUA 3M0KA 1BXNA 5JVLA 2Z1VA 4HZ8A 4GO8A 3DX5A 1XLHA 1KFBA 1TQJA 3PG9A 1F3WA 1XLCA 4DM1A 1UWSA 3R43A 4OE7A 2Y8KA 3UETA 4AD3A 5FF2A 2OJPA 2WHMA 3N15A 1VJIA 2FH6A 5DANA 2QJGA 5A8OA 2YDQA 1TB3A 5D05A 1VRXA 3KCLA 4HA0A 3EDFA 4WJEA 1CGTA 3PBGA 2WO5A 3LHZA 1JCNA 1AODA 5I3DA 4LCQA 1ISYA 4RNIA 2FQIA 2VEGA 3JRKA 5I79A 3W00A 4E8DA 3KAOA 3O7UA 3P5YA 4XKYB 1NOFA 1ADOA 4MY8A 2XSAA 2R1LA 3EXSA 1L6WA 4ZQPA 5D2YA 1KM0A 3BG5A 2IW0A 2OGJA 3KS5A 1GKQA 2GDQA 1NFBA 3OPSA 1EB3A 4S3FA 1SJCA 1RQBA 4OZOA 2G0WA 1TV2A 4TIMA 4LV9A 4JQ4A 2GGIA 4WCJA 2Z6IA 2I9UA 3QR3A 5FL1A 1UD8A 1UWRA 1KQYA 3QQWA 3PQIA 1J01A 5TD4A 1WKYA 2YLLA 1VFTA 2GDVA 4CD6A 4DJEC 2C3ZA 1OZMA 3W1NA 3I10A 1CW2A 4PB4A 1MQRA 2VWSA 2GQ9A 3SADA 1XBYA 3VX0A 1K1DA 3LLDA 3ICJA 2Z4GA 2B7PA 3I6TA 4NNCA 5E5CA 3N9RA 3KDNA 1QI0A 4MUZA 2YDRA 1WDPA 4O1AA 3MVIA 1YADA 2ZX5A 2RDXA 1D3GA 3WF0A 4IUOA 1XPGA 4GH3A 3BAKA 1XCWA 4Y96A 3NXFA 3Q67A 2CETA 4TV6A 4XIAA 4LUSB 2YFNA 3ZT5A 1OG0A 1DHPA 3OHIA 3T07A 1BGGA 1YBQB 3ANUA 1E71M 1HN1A 2PGEA 4NJJA 1SZEA 3TN5A 2YW4A 3OG2A 4DJDC 1KBLA 1G5AA 1K8XA 4FEZA 5B7ZA 4MNJA 4RKAA 1YRRA 4UMBA 3IJLA 4BCEA 4QDWA 1TPVA 1LBFA 2OYKA 3ITLA 4FP1A 4JN7A 4UWMA 5HR6A 1FCBA 2W5FA 1ZQ5A 4F8XA 1IXOA 2BDQA 1IV8A 1S2TA 4JQ1A 3VKBA 3MS8A 1IEIA 3KL5A 3UPWA 1C90A 1W1A1 1NAL1 5FIPA 4A2SA 2B7OA 6A3HA 2RDTA 3KZPA 3W26A 1R86A 3U7VA 4FNQA 4UFMA 1ISZA 2W4XA 5FJUA 4AF0B 4LANA 3RHGA 3ISIX 1NY1A 1VCFA 5G2HA 5C9WA 1UWAA 1EBHA 1JDAA 1UD6A 2WJDA 3BLIA 1Y5VA 1TRDA 2D1ZA 3FA5A 3UJFA 3Q94A 3C0LA 1WAWA 3PTDA 1QJWA 2F6UA 1EEXA 2BASA 1ENUA 4JIEA 5I3JA 4R7OA 4TVDA 3VD9A 2RUSA 5F1VA 2AL1A 1XRTA 3WQVA 2VFHA 4NZ5A 3UXLA 3LCXA 1R0MA 4P8WA 4M3PA 3CV7A 3Q58A 2DZUA 7A3HA 1PZ2A 2XM1A 1M7OA 4J27A 2CBIA 1RHCA 1BGAA 5HUOA 5I77A 1M7JA 1IT7A 1OGSA 5E6ZA 1J11A 1JF5A 5FEPA 1DE6A 3AMGA 3W24A 4IJCA 4NX0A 1V6VA 2W92A 4J3WA 3VCRA 5A5WA 4NNBA 5ABHA 3VDHA 4BF9A 4PTXA 2Y7GA 1GOXA 4Y90A 3VKKA 2YA1A 1HKWA 4L6DA 1V3KA 5AHLA 3U2CA 2QIIA 5LYRA 1NP2A 4DO5A 2Y63A 4QE5A 4DIAA 3H2FA 1IYXA 1OX5A 1W3YA 4OIFA 1H1ZA 3EA3A 4B5TA 1LLQA 1LBLA 1VAHA 3W75A 1FWDC 1S5TA 3PPGA 4CUCA 1GZGA 4QBXA 2OO6A 3QEZA 1B3OA 1DE5A 1IWAA 2IQDA 3BSMA 3H4WA 1VGAA 3LSCA 3MANA 3JW7A 1EDTA 4QX4A 4BHYA 3K1GA 2NLIA 5DBTA 3O6YX 1H7WA 4JTKA 3BW3A 4QP0A 3ARSA 2PDPA 2Z24A 3A22A 5L6UA 1OJMA 1K8CA 1Y7VA 3WQCA 3L4YA 1YNQA 1WUFA 2OODA 4MAVA 2ZA1A 4Y7EA 5HMFA 2RDUA 3ZSSA 2EG8A 3TWBA 5LZLA 4A3YA 4GC4A 1TR9A 2YCEA 3V7PA 5A8PA 4LW7A 1ML1A 1XLJA 1PSCA 2PWGA 3O1NA 3K5XA 2EJ1A 3B40A 4XSMA 4N9CA 3TQ0A 2DT0A 2P5NA 4GIAA 4U4MA 2PWHA 4DZ5A 1EKOA 3WJSA 3O05A 4CVWA 1ZP3A 1S1RA 3NDOA 1O6IA 4GGBA 2AGTA 3HPAA 3MUAA 9RUBA 1QBAA 2QPXA 1Q7QA 3M7WA 5JIWA 3R5EA 5I7GA 1VPYA 4BQ3A 1CGVA 4PL1A 1Q13A 4M0XA 3AYRA 4LSBA 1U2YA 3UZZA 2WNNA 3G2GA 4W4QA 2HNEA 2OEKA 3I7RA 1MI3A 8RUCA 3A23A 4GX9A 4QSHA 3U57A 3PN8A 2QMJA 2XN1A 2VD9A 4G9PA 4AHQA 3AIRA 4JTLA 2Q01A 4QS6A 1ZP4A 3QGAC 3AQUA 4HPGA 4A3RA 4N02A 2HRWA 3QMTA 5HATA 4LC8A 3F1QA 3SO7A 2W3ZA 2CZFA 3G6MA 1U22A 3AYSA 2VEFA 3W28A 4FNPA 1ZS2A 3GDKA 1SM9A 6TAAA 2VGIA 1GT8A 5MKGA 4GIYA 3W7LA 4L4LA 4PMNA 2WMIA 3W53A 4YTTA 3CQIA 1HGYA 5CAHA 3AZTA 2FB3A 1V8EA 3ARXA 3WMBA 4A05A 3HQPA 1ITQA 4REQB 2RGLA 4LWWA 3T05A 1B0IA 3MMWA 2OZ3A 3O6AA 4LY8A 3R0UA 4H4IA 3LV6A 1F74A 1XFBA 1ME8A 3IJIA 3SEPA 1VIWA 1OF6A 2OLSA 5FJJA 2PODA 3UXAA 2XWDA 4M7TA 4PUDA 4MOZA 1GVEA 1XIJA 3GVWA 3LCLA 1TTQA 4QQ3A 2XVPA 5LHEA 3VD4A 4GE8A 4MZ8A 3CU2A 2IPJA 4JX6A 2ZX9A 5EBUA 3GU2A 4Q8OA 2CZDA 2CFFA 5C9UA 3GXDA 4B5WA 4IMFA 3LZ5A 4KETA 4KIEA 1VBJA 4GNVA 4HZMA 1HVXA 3MU7A 4EACA 4DNHA 5HINA 4FS9A 4ZSUA 4ORMA 1RJPA 3NQMA 4JEQA 1XRSA 2UV8G 4H9YA 3MW7A 1JNEA 1EL3A 4QEHA 3WENA 2WVVB 1RBOB 1W2PA 4I3GA 3CAVA 3M7SA 1R9XA 4U3CA 5I03A 4QJ3B 4Q4OA 4QHRA 3T08A 3O8AA 1EJRC 1KO0A 4H9ZA 4RDWA 3VDAA 3S6OA 3EOOA 1QAPA 3E2VA 3QPZA 4AAJA 5AZ1A 5EMYA 4YCPA 1W3NA 3NAVA 5HWMA 5T9CE 4Z2LA 3S1XA 2Q3RA 4BF5A 1TPFA 2AAMA 3WLRA 1GTEA 3EA1A 4AEFA 3EMCA 3LM3A 1KXVA 3NURA 1NF7A 4IXXA 4US5D 3NVDA 3WQEA 3GUGA 1EJUC 4FX7A 1EJVC 4HCHA 1F2JA 2NX1A 3WNOA 2DUXA 3A64A 3BGJA 1UR8A 4B5SA 2WBKA 1B3VA 1ZBVA 2JKPA 3VMOA 2XTKA 1LUCA 1PCWA 3OP2A 3VC5A 1BHGA 2QAFA 2W66A 1DJXA 1FFQA 2ACQA 4RNJA 6REQA 1KCZA 1KB3A 3ME3A 2WQDA 2NW0A 4AWSA 4XV0A 3WD0A 1F1SA 2DT1A 1BAGA 4XD3A 3UT0A 5DELA 4MJMA 4H8UA 5CPMA 3UWUA 2CLKA 1YE6A 3BVJA 3AUOA 4F2TA 2ZTKA 2Z2AA 5C7VA 3MYPA 2VUYA 3GB6A 3FAXA 4D6HA 1BF2A 1LXKA 3TFCA 1AMKA 3GG8A 4L1XA 4BQ5A 3P67A 5D03A 2XIJA 1UR2A 2V3FA 3W22A 5L9FA 2YIHA 3CHEA 1PXGA 5F4SA 3IJ7A 2J75A 4JEJA 4H8NA 3KRBA 1RZMA 2F8QA 4R9OA 3M9YA 1MZHA 2OU4A 2YA0A 3TTYA 3GC5A 1XUUA 2CLHA 3TAOA 3M0JA 1AQMA 1E9YB 2DH2A 3QQ1A 4DXXA 2QUNA 3NG3A 3TN4A 1W1ZA 1B54A 1O12A 4MWAE 4JFSA 2GLKA 1EP3A 3H4XA 2ACUA 4S2CA 3NZPA 3BLOA 1DIOA 1W5PA 2ESCA 3IJ9A 3VDGA 4ERGA 4Q32A 5F2MA 4AZGA 2BG5A 4US6A 1ZU8A 2HDJA 3I7SA 2DIEA 3KRZA 2WNQA 4KGJA 1VHCA 1VLWA 2F84A 3UVIA 3NZRA 1A5UA 4WSJA 3AFBA 1RWFA 2ZFAA 4GGHA 5I02A 4TOQA 1MO0A 2O92A 3PZUA 5AHMA 1V3LA 2Y4SA 1CIUA 1JVNA 1P7TA 1TTIA 3GYEA 1XPYA 1UIPA 3A6OA 3M5VA 1KCKA 2VFFA 3E0FA 2D0GA 2TODA 1KCXA 1A0CA 1T8QA 2W63A 2XG9A 1CTNA 1SW3A 4GK8A 4DNMA 3VMNA 3A21A 1LBMA 1P6WA 2PCQA 3N1AA 3KBUC 4QG6A 4UTMA 2WSQA 3PG8A 4A4AA 4V1XA 2EXOA 3VIOA 1VS1A 2V30A 3H6OA 5M17A 2XN0A 1XC6A 4IL2A 3GNPA 3PSVA 1DOSA 4O10A 5GJPA 2KXRA 3WK1A 4KGLA 2I7GA 3MHGA 3SSJA 2I5IA 1TPC1 4E3TA 3RJXA 4F0SA 2JBMA 1B9ZA 3HPFA 3FGCA 2UY2A 1HFBA 4AY8A 7XIMA 1N2VA 4BWLC 5U7SA 1CB8A 5ABTA 3GC2A 5I07A 3OZMA 5BZAA 3AHXA 3MUXA 4IG2B 2XGZA 1UKPA 3GNXA 3N18A 2J9XA 4C6NA 4I90A 1J79A 1EEPA 1AG1O 1CXIA 4Q8VA 3IV8A 3OGVA 5AYBA 2YBUA 3EMQA 3BW2A 2XFRA 4MLRA 1L2UA 2FGZA 2BNJA 4UFJA 4MFDA 4DBUA 3ZT6A 3LSBA 1GORA 4I9TA 1AL8A 3WMCA 4DF0A 4YTSA 3TTEA 3DIPA 1JUKA 3SW6A 1CB7B 1FDJA 1KR0A 1KM3A 1XRVA 1V77A 5ABFA 1F9CA 5M03A 4GIEA 1VJZA 2PBOA 4P5UA 2E9BA 3N12A 1UOZA 4PMUA 1GOOA 3OOQA 4I7WA 1UA7A 4AZ6A 2XH7A 3F7JA 1TO3A 3K4DA 2PB1A 5GVJA 1RP9A 9XIAA 3ERPA 3SI9A 4CD5A 4FNUA 2KAUC 1JPMA 4IPPA 1K7EA 5GNZA 4UTLA 2QCMA 3OEXA 4E6MA 1SMAA 1AW5A 2WZMA 3NM3A 4H7CA 2ZX8A 4G7FA 2I1OA 2P10A 1GTHA 1RLDA 3TOYA 4EOUA 2DW6A 1LOLA 4GFSA 2OVLA 2D0FA 4QFUA 1ELSA 4N4PA 1TUFA 5FF7A 1MVYA 1ZUAX 2QCHA 4G6CA 1CLVA 3VCCA 5HJLA 3GU1A 3WLTA 4Q22A 2PTZA 4ZBCA 4YMZA 2CLIA 2VC9A 2PDQA 3T1GA 4D8ZA 2YCLA 1SQ7A 1P0BA 4O8RA 4I9JA 3KOFA 3EWBX 5F4XA 4MZ1A 4TMCA 2OLHA 2ZZ2A 4RE3A 4HKPA 1P6CA 4UTUA 4LB4A 4W5UA 1E73M 4W89A 4TX8A 2PWUA 3N6HA 4PCSA 3SURA 5DXYA 2CLPA 4H00A 1W32A 2F2HA 2NX3A 2WSRA 5AZ0A 1DVJA 4W5ZA 3N29A 3RIKA 2NQ5A 1RCOB 3BLEA 3CYJA 3LK6A 4URIA 3QGVA 3CT7A 3ZO9A 4MHBA 2Z2UA 1AJZA 4HNUA 3RM4A 3WDPP 2BXVA 1Q2RA 5C9XA 2DJXA 4PTDA 1YHTA 2VELA 1K6AA 3KOXA 4F9JA 4OBSA 1C8XA 3LPFA 2HS8A 1AH0A 4OTKA 4QDPA 2D2OA 4D8OA 4AMAA 1VB9A 1TVPA 4IP7A 3BICA 5RUBA 4YHEA 3ZXWA 1PVNA 5JBEA 1IEVA 1OT2A 1D3HA 1NU5A 1FHUA 3MYOA 4JYFA 3TKFA 2V0TA 3HTWA 3JUGA 4U5KA 1XR2A 3VOGA 3NCOA 2JGQA 2ZADA 3H7RA 1W6TA 4KS0A 3O0KA 4DELA 3T42A 3WQDA 4DO7A 1W1VA 3U4FA 2OR2A 3R11A 1HX0A 4C6EA 3SCRA 1OC6A 4IOTA 3C2YA 1QDSA 2NSOA 5HQMA 2PGWA 4AD2A 1PCKA 4EWJA 2PP1A 1F4AA 3BSGA 3E2QA 5F7UA 4RDVA 1LJYA 4KEMA 2YYUA 3VUPA 3PUDA 4JCMA 5HWNA 2QUVA 4C1KA 4ATLA 1JZ3A 3N73A 4P7OA 1OG6A 1UCWA 4GFIA 4TMBA 3I6EA 5CGQA 3SCNA 2BGSA 5REQB 2ASHA 2VR5A 2OSWA 3UD1A 3NGFA 2D24A 3W88A 4D6FA 1RJRA 4YTQA 3IEBA 2WVSA 4XZNX 3WD1A 4RNFA 5JMUA 2VCAA 3ZLFA 5I06A 1LRNA 1UIOA 2BOFX 3L67A 2HEJA 4HN8A 5HMEA 2D2GA 3N2CA 1W9UA 4Z1CA 4JFWA 1CB2A 7TAAA 1LDCA 5IXEA 1OFAA 4GI9A 4E2BA 1E0WA 1K9TA 2EG6A 1WE5A 4J28A 5PTDA 3MJMA 4ZB2A 1A49A 3QV9A 1BRLA 2XDFA 4RJEA 4AD4A 1QASA 2XN2A 1EP1A 3ZT7A 4ZODA 3MCNA 3M4HA 3BK0A 4J40A 3TW9A 1AMYA 2ZA2A 3PZVA 2V4IB 4E4FA 3HURA 1N7OA 3R1ZA 2C1HA 1SSGA 2V69A 1GOQA 4WD0A 3FXGA 3MHFA 4JY8A 1XYLA 4TX9A 2PA6A 5IHRA 1OBAA 4JDYA 3THUA 1YXDA 5IBXC 2FPYA 3HFTA 4NU7A 2VDIA 3ITXA 4LTSA 4HSHA 1R9YA 1HKJA 3D47A 1XICA 3QR0A 2WC4A 3FDKA 3NDZA 3EX3A 3FA4A 3THAA 1W5MA 4PRRA 4AH7A 5A2CA 5CLWA 3LNMA 4AFYA 1ZHAA 1L9WA 5D2WA 3GR7A 2JEQA 3PTMA 3WFLA 4H04A 4JTJA 3TJLA 4QE1A 5AY7A 4V33A 2QDDA 2WJEA 3U5YA 5FEWA 3AJ7A 1WKEA 1OFPA 4FLQA 5EFFA 1UPPA 1P4CA 3RDKA 4JTIA 3NZQA 2E1WA 2QLYA 2PLJA 4NRRA 4DB7A 4JNZA 3HB9A 3RF9A 4HHPA 3SY8A 1BD0A 3VE9A 4XG1A 3A47A 3WQ8A 5A6MA 2X0SA 3AJXA 1XFCA 2QUMA 3WEOA 4UOZA 3WD2A 5AC6A 3AMKA 4M19A 1TX0A 2AQWA 1E1CB 2CBUA 1RD5A 3URAA 1P6BA 3V0SA 1HT6A 1I9CB 5FESA 4ZCWA 2DUAA 2ZQ0A 3ZWSA 2PLMA 5IOBA 3TV8A 1RY8A 2QCNA 1NQKA 1TPB1 3NGJA 3QR1A 5TQLA 3NSMA 2DVXA 2R9RA 3MJYA 3EKGA 3TEVA 2EKCA 3LCFA 3C0QA 5JBDA 1Q5MA 4QE4A 4AW7A 3G1RA 2F38A 1EJXC 1LWIA 3M5XA 7TIMA 2YXXA 1R47A 3ARRA 4RPQA 2GGJA 2CZVA 3CUIA 1PKLA 1A0EA 2VR4A 5LNSA 2WC3A 4PCPA 1ESWA 3DGRA 1FRBA 1B31A 1OJNA 4C6FA 2GDUA 4Q8MA 2NVAA 2W62A 4A8RA 3SR7A 4YPJA 4LVAA 4G56A 4HU3A 1GQKA 4LUTA 1F7BA 1QTWA 3OYZA 4CQBA 1OZQA 4DAIA 5I24A 4AXKA 3TDFA 2VJXA 3ITOA 4AISA 5I6SA 5BOEA 3EGJA 3B3DA 4B3LA 4ACZA 1ONXA 3NR0A 1VBGA 1N7QA 4ZXLA 4LGXA 2D0HA 2X2YA 1A3HA 2FMOA 4L65A 1LM1A 3TUUA 3PM6A 4X3ZA 4M29A 2BRWA 2WDAA 1DKWA 4ZB0A 2FZMA 8CGTA 4I9AA 5DMYA 4NIRA 3DOPA 1ZNNA 4MM1A 2ZDRA 3LS9A 1OM0A 3CLMA 5CG0A 4F0HA 1DJZA 3P84A 2WNZA 1SZFA 1E0UA 2J7BA 5D30A 2J88A 2Z7GA 3V18A 4B90A 4FNSA 2B0MA 4JQAA 2CPUA 3WH9A 4CQCA 3MDUA 5CAKA 4P7NA 1PDZA 4H9TA 1JGIA 2Q8ZA 3IK2A 4GZJA 1S2WA 3SBFA 3WNNA 2CZEA 3VZYA 1K77A 3NQ6A 2XIIA 5H8MA 3EKLA 1BYAA 2A85A 1TG7A 4FK9A 2KZHA 4LVBA 2DSKA 5EL1A 2O55A 1EBGA 3CUFA 3Q4DA 1BG4A 4Z42C 4AQLA 3DHUA 1ALDA 2VTFA 4DJFC 2J7GA 3SIMA 2Y62A 2OZ8A 9CGTA 4ZFMA 4TO8A 4UMCA 1PDYA 4UTHA 1G9HA 4XSLA 1A5AA 4LXFA 3FFSA 3WUBA 4W9TA 1GVIA 4NASA 3ABQA 2VWTA 4LH8A 4M6PA 3ZS4A 1M04A 3DN5A 4BEUA 4WOQA 1BWKA 1POKA 3PTQA 5JH2A 2V5DA 5JH1A 3BJFA 4WK9A 1BVZA 3IRSA 3HPXA 3BXWA 3R79A 5FEXA 3MY9A 2YLAA 3TMQA 1A5LC 3GDTA 2J7HA 1XRFA 3GVGA 1FKXA 2VX4A 1XLIA 3OBAA 4XZBA 5ECVA 3URBA 1HL2A 4IL0A 2J6VA 4B5XA 4F3HA 3E74A 1VH7A 1I6NA 5AC5A 3KL3A 2VM8A 3V16A 1SJDA 4IZGA 3FKRA 1XQLA 4DBSA 3KOZA 5FJPA 2FLIA 3LI0A 3WYZA 3CB3A 3WNMA 1LOHA 3V36A 3P6LA 2O7QA 3FA3A 2A6LA 2DZVA 1AVAA 1P1MA 4UMAA 3S4TA 3CWNA 1YE4A 1MWOA 2REQB 3LPGA 1YIXA 1A47A 4AYGA 4DQWA 2PZ0A 4UNLA 3U6WA 1ZBKA 4X61A 1XDLA 1UBPC 3S2JA 3I4KA 1EJWC 1BFNA 4I8YA 2DY3A 1OIFA 5I00A 5MF5A 1IXPA 4IJRA 1HZYA 1ISXA 5CZSA 2BSLA 3CLWA 1VYPX 4KMQA 2BGNE 3PFRA 4UFHA 5LKYA 1F61A 4EPEC 3A24A 3HMJG 3NVTA 1E3ZA 3GVVA 2YDSA 3PB2A 2PCEA 1ZGDA 4HYRA 5AVHA 3QM3A 5AC8A 2VQUA 4J7RA 1SO3A 2HE8A 2AL2A 1W2VA 1QPQA 3BLDA 1RJQA 4UC5A 3C2OA 2E6FA 4V27A 1LL6A 1X1OA 2HVOA 3UD6A 1VFHA 4ALDA 4ZXOA 2CHNA 3QSTA 4B9YA 1TIMA 1DV7A 5IDIA 3SUWA 3ARUA 1Q7MA 3LXBA 3CL8A 1KR1A 1UUMA 2J4GA 4LAZA 3DH7A 1WDDA 1ECQA 2BODX 2GGGA 5HPCA 4PODA 4IMDA 5HULA 3H22A 1DL3A 1NVMA 5LNVA 4NHVA 2EPLX 2YKKA 3O9NA 3NOYA 4FOKA 1CNVA 3B8IA 3K8KA 1AUSL 5CSUA 2IPFA 3QKEA 1H1NA 2HE5A 3PBYA 4MNMA 1FBAA 3MMUA 4NZCA 3F59A 2DGAA 2YXOA 5CH9A 5HUPA 4AD5A 3EPOA 3UR8A 4GQBA 2JKAA 2ZIDA 5CPSA 1BXCA 4JIQA 1PWMA 5CJ5A 4HTBA 2WPGA 1W8GA 4PMOA 5D38A 1I75A 3H23A 3UR7A 2A3CA 1JDFA 4R53A 3BANA 1TWDA 2PDWA 1VPQA 1XLAA 4B92A 2ADAA 1S3TC 4QS5A 1TIWA 4IJBA 3O0FA 5BRQA 4MPKA 4OQVA 5C9RA 3ZFHA 2GOKA 5FA5A 3SM0A 2ZDSA 4GOAA 3KOWA 1QHZA 2QCGA 4JHOA 3EX4A 3GZAA 3BAJA 1FWHC 2X42A 3WQ5A 4LAMA 3BAWA 4N2YA 2J62A 5D8ZA 4DWSC 1G4PA 3GFZA 5AYZA 3L66A 4DUOA 2VEMA 1CX9A 2H8XA 2IMRA 1RWGA 3E2SA 3CUGA 1K7XA 1IF2A 3WNKA 2P8BA 5HANA 1E0VA 1JPDX 1Y0EA 1HQTA 5HMDA 2OTDA 5LA2A 4A2RA 3W3OA 2FDSA 1M68A 2WZHA 3DFHA 4ZTYA 3HG5A 1V3JA 4ICCX 1FCQA 1QR7A 2GK1A 1OFDA 5FF0A 3WQWA 3RO6A 3W71A 1V6YA 4JXCA 3VIPA 3OU8A 1KTNA 4Z0JA 3TZNA 1B4KA 2DEPA 2BHUA 3CYVA 4WGXA 1QOQA 3WO8A 4DZIA 5BU6A 2DVTA 4C1NA 3K2GA 1GW9A 3GO2A 3T0DA 4YTRA 4ICMA 4Q4KA 3BG3A 3DYPA 3QY8A 3WL1A 1XW8A 4WKHA 1CZ1A 2DIJA 2XIQA 3LHVA 3KBVA 3PUEA 5C0QA 3I6RA 1S5WA 1KFWA 1MYRA 3SUVA 4UQDA 5CPNA 3H4GA 3ITCA 2WPBA 3TSMA 3LG3A 2VX6A 1JZ4A 1OYAA 1XLLA 4MWAC 4S23A 1ZJHA 4PMVA 1E6ZA 4PEEA 5G4HC 4QEEA 3EX2A 2KX9A 1GCYA 3WUEA 1YTKA 1I45A 2BY1A 1Z8AA 4Q8UA 2V5JA 2BXZA 1RK5A 4N9EA 3W23A 4WVXA 1G6CA 2PDJA 4DLOA 5KZEA 1R46A 4PN2A 1KFLA 5EFDA 1UR4A 5D9PA 3AIEA 3E5PA 4EE9A 1P48A 2DFAA 3I65A 3FCPA 4UTTC 3VIGA 5C55A 1ADDA 4OOZA 2VR2A 4D6JA 4H9VA 4A6GA 2O9PA 3ZJ8A 4PEKA 3RN6A 1V02A 3S5ZA 4BK9A 3WNLA 2JALA 2H9AA 3L4WA 2BVWA 1L6YA 5HQEA 1C91A 3K8LA 1C92A 1O68A 4TTUA 1GG0A 1XINA 2NVDA 1IWBA 1BKSA 3RM9A 5C2CA 3TA6A 1O60A 4ZOBA 4F0LA 3MWCA 3TYAA 2CC0A 1UWTA 4GY1A 2X7WA 1FDYA 1BQCA 3W1QA 3H54A 3ANYA 5I0DA 2A3HA 1NDYA 2C16A 3B0PA 2XWEA 5KINA 4D6DA 5F2GA 2A6NA 1QOXA 3EDDA 3QZEA 3WLHA 1M3UA 3UWEA 2HQAA 4O11A 3W70A 4KFPA 4GACA 3CXOA 1XH2A 4QM1A 1KXQA 3HIJA 2QHAA 3BARA 2Y2WA 4JN8A 3WH5A 2QZRA 2NQHA 2PTXA 3GIPA 3VM5A 1O1HA 4KWSA 1N7RA 1FWJC 2V81A 2EO7A 1QBBA 3NQCA 3W7EA 4CNTA 3G8EA 1PKYA 1HN0A 2IXVA 5KITA 1XIGA 4NZ1A 4MB5A 3KVLA 1SO4A 1VKFA 1OY0A 5T26A 4CEUC 4HIBA 4GJJA 3WUFA 1WDWA 1QO5A 1K8ZA 1QXLA 4Y9AA 1X8CA 4H3DA 4AC1X 5BRPA 2WQPA 4PCFA 3AC0A 1MW1A 1EOKA 2DZAA 1NJJA 2VO5A 3L5MA 3C8NA 4WDWA 1E4NA 3MBDA 1JYWA 3VKAA 2W0UA 4O12A 1FFRA 2YBVA 3WG6A 3CT2A 4G5DA 4NZFA 4O1FA 2X1UA 3WF4A 4QJ1A 3ECQA 2C8NA 2VHLA 3NQEA 5FJIA 1RQEA 1J12A 1XX1A 2J7FA 1OSEA 5A6TC 3VYLA 4HSOA 4D6GA 1K7FA 5CPQA 3A13A 3M64A 1KGXA 4GUFA 4PMDA 3ATYA 4DJDD 1SGJA 1TMQA 3P82A 4CEXC 4O16A 4C6CA 2C91A 5D4YA 2BOGX 3LB0A 1RR2A 3DYOA 2E5BA 3AMCA 3IJ6A 4GVGA 4BEQA 4O14A 1VJSA 1CCWB 1E6QM 3EYPA 4UXDA 4KESA 4WKFA 2YB4A 2UZ9A 3OGSA 3TOPA 4XKYA 2YBTA 4XD6A 1M1BA 1W91A 4MSSA 3KP0A 2ZOXA 3IGXA 4R5EA 4FF5A 5I2UA 1A3XA 1U30A 2OLAA 1H09A 2ZC1A 1E0TA 2Y8UA 1PO9A 4C6IA 1R3SA 1BTMA 3O6CA 4IICA 3B05A 4NJKA 4AXNA 4ADTA 4I6KA 3OQ8A 1XLFA 2XVGA 1G7UA 3LQLA 3RO8A 5A6AA 3R6IA 4IMAA 3UJ2A 1W1PA 2QCDB 4H7ZA 4LBUA 5TBOA 3MMTA 3KHDA 4O57A 3W07A 1VFLA 4DYEA 4O19A 3GHTA 1A0DA 2J7DA 1QNPA 3MSRA 1JZ6A 3TU9A 2R6OA 4YTUA 1B4EA 2CXGA 2X09A 1CBGA 4A22A 4CNSA 4E4UA 2BVYA 3KRSA 2VRJA 4FAMA 3HGRA 2PZNA 4JN6A 3QHOA 4X0NA 2ZUTA 1GVSA 2ZRVA 4KF1A 4H6KA 1H50A 3GXMA 4L4OA 3R4IA 3RR1A 1A3WA 4LUSA 4IMCA 1MRAA 3VGDA 3HN3A 3WQFA 5H1WA 1W37A 1W9DM 1Z7AA 4PGLA 1KV8A 2CIPA 2ZBTA 4PB5A 2DPEA 1HMUA 3KCJA 4GHRA 4QNWA 3V75A 3I3EA 5D2TA 2GJPA 4YLWA 4IMEA 4F0KA 3LTSA 4OBTA 1J6PA 1MSSA 4CQ9A 1UOKA 1EZWA 4Q3MA 2WZTA 1UD5A 1ZB5A 2Q6ZA 5SWUA 4Z1BA 1UWQA 4FF7A 2PP3A 3KBJA 4YIWA 3T2OA 1J5SA 4Q6JA 3OVQA 3PBMA 3TYZA 1JEZA 1UWUA 1Y5WA 4PUWA 2G4FA 2O9RA 3PBVA 1WDQA 4AVNA 4LS0A 1EGUA 4CN4A 4JHZA 3B0XA 2YZ5A 4IGMA 1K02A 1KRAC 2YDAA 4UZSA 2OT1A 3L9CA 4LPCA 4IH3A 1WOBA 3BCJA 4AF0A 2QIWA 5FEZA 4D72A 4GQ0A 3WLPA 2DUZA 1MNSA 1QRQA 4AZ7A 1YKWA 4WSHA 4Y9MA 4UTWA 4LRTA 4ZQMA 1FWIC 1TX2A 3TTOA 1R3YA 1DXIA 4LYPA 1W3KA 1U1HA 3KW3A 2WYSA 3TWAA 3GLCA 3CMGA 3QFEA 4ZGYA 3S9YA 2E8ZA 4MB3A 1VQTA 4O1DA 2FGBA 4O1BA 4NYYA 1Q6EA 3GAYA 4JQ2A 2P50A 4UQBA 3B0YA 4HCDA 2R24A 4NI8A 1J93A 5AYIA 1E55A 1BYBA 1C8YA 3CTTA 1IEXA 4L80A 1TJRA 4PUNA 4PBGA 4NILA 3ZR5A 4NUWA 4PMRA 3RLGA 2C19A 3S1UA 4HK5A 1BPLB 4C6PA 1RA0A 1RH9A 1UC5A 2QR6A 4XVEA 2NQJA 1DQXA 3ARWA 1JI2A 3PHAA 2PRHA 5CSRA 5LGXA 5DMNA 2EQDA 1WZAA 4NZ3A 1D8WA 2PI6A 4CGTA 3KCOA 5ENLA 3VNLA 3XISA 2LLEA 3DFOA 4X63A 3PZOA 1OFEA 4Q33A 3GTFA 4JIPA 2NX9A 3GNOA 4C6OA 5CPOA 2C7FA 2IPGA 4G7EB 2E1DA 1LWJA 1EF3A 1F05A 3HO8A 3L12A 3IVTA 4AMCA 2XGBA 1IXNA 2TSYA 3AHVA 3WLNA 1Q6CA 3I7QA 1I8QA 2WHJA 3GDMA 3W73A 5A6BD 1MUCA 1GOWA 4Y9OA 1MFVA 1BYDA 3FJ4A 3G8RA 5EMLA 3