4D6CA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98)(l19 mutant)
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
586
structure length
586
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYHTSAHWLSTSWIDKMYQKYPNLHGIFSTESYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 222
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6cA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6cA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6cA02
5F7UA 4XX6A 2VQUA 1TMQA 2W62A 1ISXA 2WXDM 1HKKA 5C70A 2EQDA 5D9OA 1FP9A 4EK7A 2D0HA 4V2XA 2WNWA 3WDIA 3BGAA 4D6GA 1KXHA 5JBDA 3VIMA 1WB0A 1YHTA 1GHSA 3FY1A 4GO9A 1OGBA 1JGIA 1UR1A 8CGTA 1HJQA 5DF0A 1FH9A 1VEPA 1X1NA 1UD6A 1GJWA 1QNOA 3BAWA 3AMLA 3OZOA 4PSPA 1HX0A 4LX4A 1CNVA 3WUFA 3NDYA 4GZJA 4ATWA 5CGMA 3QOMA 4DWSC 1VAHA 1JFXA 3WIJA 3WENA 4PTMA 1JXKA 1N7QA 1ZJBA 3GZAA 1E6SM 2OYKA 5JUVA 3IJ9A 1BFNA 3L4ZA 1IZKA 3VIPA 4BQ5A 2XSBA 4RE2A 4ATDA 3VIGA 1UKQA 4HOZA 4TVDA 4QCEA 1BHGA 1QNPA 4UQBA 3N12A 4UQ9A 2A3AA 3CHEA 1E4IA 2DT0A 1ZB5A 4UZSA 3WN6A 2QMKA 5IDIA 3CTTA 2DSVA 1C7SA 4ZXLA 1EA9C 1N7PA 2PWEA 3IJ7A 4RE3A 1JZ8A 5D8WA 3WQ4A 1NWRA 3ECQA 3VD4A 5FIPA 1V3IA 1FHDA 1H3GA 3PZOA 1CWYA 1PX8A 5HBFA 4DM2A 2G41A 3AS2A 4PMQA 4B16A 3KL3A 1TCMA 3RM9A 3BH4A 1W3LA 4PSRA 2CEQA 4TXEA 2WMGA 2XJ7A 2JALA 1KCKA 2CBVA 2E40A 3RIKA 3W24A 4P8UA 4BA0A 5A6AA 3WNLA 2CETA 3EMZA 4AISA 2VNCA 1HKMA 1MW0A 2WHMA 1JZ4A 3O2LA 4XZBA 3THDA 4V27A 1J0JA 4W7VA 3I3DA 1MW3A 3PZVA 3SUVA 7CGTA 4ZXOA 4MDPA 4CD6A 1KWKA 1FA2A 3ZOAA 1CDGA 1O6IA 1GW1A 2VCAA 1NWTA 3RDKA 4P7RA 4MJ4A 3AHTA 3EDEA 3DHUA 1QI0A 3VILA 1UZ1A 5I78A 3VKKA 3VX0A 1GQLA 2WMIA 3WQWA 3VO0A 1OJNA 3BSHA 4CU7A 3CGTA 4JL2A 3VD7A 4B9ZA 5BXSA 4CN1A 3BAXA 1GORA 2UY3A 3ZJ8A 2O9TA 4MNJA 4P8VA 4CN6A 3GDBA 4CVWA 1JG9A 2YL6A 4CCDA 3CPUA 4ACZA 4ZEPA 4TX6A 5I3DA 2GVYA 3ARYA 3RM8A 1R85A 4UZUA 1CEOA 1FFRA 1UHVA 3OIHA 4X0NA 3OGRA 4GI8A 2WZIA 3CUGA 4M24A 1KBKA 2VT0A 4HP5A 3WUBA 1IZJA 4GO8A 4P8WA 3WSUA 3WD3A 3VMPA 2PBOA 1LL6A 1JFHA 1BF2A 1XHGA 3AHYA 1FHLA 3DC0A 5EFFA 1M7XA 1VEMA 1JDAA 1MYRA 3VUPA 4MNLA 1QVBA 3SCNA 3WNMA 4WK9A 1ZU8A 2G4FA 2UWFA 2WVVB 3VPLA 6CGTA 1O7AA 2BS9A 2VTFA 1V6XA 2O9RA 1UA3A 3VOCA 1WDSA 3AZTA 3GYCA 3AS0A 1EHAA 2XPKA 3WD2A 2VZUA 3FHAA 4M56A 5BXTA 2D0GA 1NP0A 2VVNA 4AZCA 4JCLA 4Y7EA 2VI0A 4D6HA 3ZIZA 1M53A 4U5KA 4Z2KA 1V02A 2WSPA 2FH6A 1PX3A 3AMCA 4D6CA 2EPNA 4J3TA 2D1ZA 1KFWA 1QHPA 1US3A 4AD0A 2W5FA 3KZSA 3ARUA 3VD9A 4PN2A 6TAAA 4AZ7A 1N7OA 1BGAA 2VC9A 3UERA 1LXMA 3EDKA 3SCTA 2C0HA 2UY5A 2WPGA 1WE5A 1Z32X 5EMYA 2WDAA 1UD3A 1G0CA 4S3KA 4EE9A 3ZQ9A 2D22A 1XSIA 3DYOA 2XHYA 4PMVA 2A3BA 5D4YA 1HN1A 2G3MA 1SMAA 3BAKA 2CHOA 3SUWA 3T0AA 1JYNA 1CXLA 3VM5A 2J8GA 3AZRA 1RH9A 5JIPA 4GINA 2YBUA 2BVDA 4YPJA 2BXYA 1GNXA 3WEOA 2VX6A 1US2A 2YIHA 1EGZA 3GBDA 1BTCA 4J3UA 1MFVA 4W8BA 1W3KA 2VX7A 4J3VA 1E5JA 1JF6A 3CUIA 4FF5A 1FFQA 3HJEA 1TVPA 5A8PA 1TFVA 1OJPA 3MMWA 3WNPA 2FDMA 1MW1A 4PMUA 1KXTA 4AZ5A 2ZIDA 1N82A 4WKAA 2X0YA 4JKMA 1MQPA 4MB5A 4U33A 3OG2A 3T2QA 3W37A 1BVZA 3WNOA 4Z2IA 3CZEA 3IJ8A 5A2BA 9CGTA 3AJ7A 1E56A 3JUGA 4OIFA 5BWFA 4YN5A 1W9DM 3VMNA 3OLEA 1M04A 3KEHA 2GSJA 2BHUA 2XTKA 2BVTA 3AIQA 3BMVA 3ZJ7A 2O9OA 4E4PA 4E2OA 2ZOXA 1C92A 1FOBA 1VEOA 1BQCA 1VFMA 1C3FA 2X1IA 4PTWA 2YA2A 1J9YA 1ZBKA 2CBIA 2WWCA 3VGGA 4NZCA 1IT0A 3WF4A 3WF1A 3B8SA 3FXYA 2DSUA 1BGGA 3IK2A 3CMGA 3FAWA 3HMCA 1JDCA 1J0YA 3AIEA 1RW9A 1HP5A 3K8KA 3B9AA 5IXEA 1B90A 2FHCA 4N42A 2WANA 2ZUNA 2VRJA 1WDRA 1JF5A 1GQJA 4Z2GA 4PMXA 3MS8A 1XRVA 3FNDA 1UH3A 3II1A 1TZ7A 5EFDA 1E3ZA 4HMDA 2XVKA 5A8OA 3GXIA 1UD8A 2TAAA 3ARWA 2BY3A 4DWSB 5BROA 3GXMA 4UOJA 1JNEA 3CO4A 2OYMA 1D7FA 2BFGA 5FKYA 1HL9A 1UD2A 5DMYA 2XYLA 3AFBA 2IUZA 2WCOA 3WMCA 4UFMA 1E4MM 2D20A 4Z2JA 1CGVA 3O9NA 1UR8A 1WZAA 2GJXA 1UR4A 4PRWA 4CD4A 1V3KA 4HA1A 3WF0A 4MJ2A 2O92A 3F5KA 1KB3A 5DEZA 5EB8A 4CD5A 3WF3A 2PF0A 3LPOA 3WH6A 1J0NA 3AS3A 4AZHA 1CXHA 1ECEA 3VGFA 2CYGA 1W91A 3LPGA 4AC1X 3DECA 3AZSA 4W8LA 2W4XA 2W92A 5GNXA 1OJOA 4UFIA 2YLLA 5CLWA 3WDHA 2V3FA 1UKPA 1PZ2A 2WW5A 3WMBA 4OBSA 3SIMA 1U2YA 2WZHA 3QHMA 1PIFA 3GXDA 4J27A 3N15A 3VM7A 3SUSA 4GQQA 3TOPA 5A94A 1OJMA 2HISA 3W27A 1OM0A 3ZT7A 2ZXDA 5FL0A 4P7LA 1ZBWA 1E40A 1W1PA 2VJXA 4IUGA 2JFEX 3OBAA 1WZLA 1JDDA 4F8XA 1U30A 2YL9A 1LJYA 1RWAA 2EPOA 2XGIA 3B9EA 1HJVA 2DH2A 2WCAA 2J4GA 3LPFA 1QPKA 2CHNA 1HP4A 2XVNA 3AICA 1OB0A 2WC4A 3ZJKA 2FGZA 3L2MA 1EQCA 2WMIB 3DYPA 3TP4A 2WLZA 4JKKA 2JF6A 4HPGA 2XIBA 2CITA 1ITCA 4MNKA 5D9PA 1EO7A 5D9NA 1EH9A 3QOKA 4ACYA 4QCFA 1CZ1A 2EXOA 3WY1A 1HM3A 4W7WA 4JHZA 2QV4A 1XSJA 4ACZB 4ATLA 2J7BA 4WSJA 2J75A 1F4HA 5E09A 1GQIA 1F1SA 5E6ZA 1AQ0A 5M5DA 4PMNA 3EBVA 3WF2A 4CD7A 4W89A 5E70A 5C71A 2CBJA 1UG6A 4OOUA 3SCUA 1MQRA 3T2PA 4A4AA 3U5YA 1U33A 3CHCA 2ZUMA 1HJXA 4KMQA 2E0PA 3ALFA 3PN8A 1VF8A 2GDVA 3AOFA 4MB1A 5CJ5A 1JI2A 5GNZA 3L4YA 4NF7A 3VD3A 1NP2A 1NOFA 2PC8A 4GXPA 5ABFA 1KWGA 1LLOA 1LL7A 5I0DA 4D1IA 1TE1A 5GPRA 2BY2A 3ZR5A 4C7DA 1JZ3A 1HVQA 3SCSA 1R86A 1QI5A 2QHAA 1E71M 2VZSA 1JXJA 3VD5A 1ISZA 4OBRA 4AZCB 1B9ZA 1TVNA 1OSEA 3M6DA 4HMCA 2X05A 5A6LA 2WVTA 3SCVA 3TTQA 4AZBA 5A6KA 3CIVA 1UR2A 2UY2A 1V0KA 2E24A 4B9YA 4F79A 1J12A 3WUEA 1RWHA 5M03A 2JEPA 5A6MA 2CXGA 4B15A 3L4UA 1GOIA 4MPKA 2YDQA 4HU8A 3ARTA 4AZ6A 2OYLA 2J7GA 4HPHA 5I24A 1KXQA 4GQRA 1L0PA 2WC3A 1H1NA 3W81A 4TTGA 3U7BA 3A4AA 1J0MA 4V28A 3ZSSA 3K1DA 2WKGA 3UR7A 4M1RA 3BSGA 4KWUA 3AS1A 3N9KA 3N17A 2ZX8A 1HJUA 3NJ3A 1QBBA 2E4TA 5ABEA 1M03A 5FOOA 1E4NA 5CZKA 1MW2A 1OT1A 4AD2A 5M17A 2WHLA 1N7NA 2J7DA 3SEPA 3WBAA 1QHZA 2IXVA 1AVAA 1E6XM 3W4RA 2VX4A 3F5JA 5C8BB 3MKKA 2G3JA 4HZ8A 3BLPX 2VO5A 3CHDA 5CPTA 1W1VA 1LXKA 1UD4A 2EJ1A 4PBGA 5BYWA 2WCGA 1ZBCA 3VU2A 2VZOA 3QGVA 1E1EA 2XM2A 2WAGA 2OWCA 1BYDA 4H7VA 2C8NA 2YL8A 3W0KA 3MO4A 4M80A 1E55A 4BQ4A 1C93A 2PWFA 3MMDA 4PMYA 1W3JA 1KQYA 1DWHM 1LOHA 4AY1A 5AYBA 3EMCA 2D2OA 4GZEA 1UQYA 3RJYA 1V6VA 2WVSA 3WKZA 2OWWA 4UFJA 4IM4A 3K46A 3PTMA 2Y5EA 3S6TA 1HT6A 1LWHA 5A8NA 1C8YA 1W1YA 4FLQA 3AHZA 1UKOA 3SCRA 1EQPA 4DM1A 3E1F1 4BS0A 1EDQA 2W63A 5HOSA 1GPFA 3WQ8A 1E6NA 3PTKA 1MWOA 1XV8A 5FCZA 2DSZA 1G1YA 1DTUA 5ABHA 1SYTA 1EHNA 2XVGA 5IHRA 1D2KA 1W32A 3MUY1 1NH6A 3SCQA 5E0FA 2VX5A 2ZXAA 4QLJA 1UD5A 3IAPA 3ARXA 4FK9A 4PMZA 2WCSA 4UFKA 4WJXA 2DT1A 4X0VA 4MAZA 1JD9A 3VIFA 4W7UA 1L8NA 1RWGA 4M82A 1ESWA 3GNPA 4W88A 4WKFA 3T08A 1H0IA 1QOXA 3PZMA 4GIAA 1P6WA 3A47A 5ECUA 2Y4SA 1PEZA 1GUVA 4AZGA 1OINA 2BHYA 2YA0A 1ODUA 2GJXB 4OUEA 5KZ6A 3IAQA 2OSYA 1NM9A 2WMJA 3AXHA 2RGMA 4S3JA 3L4TA 5A1AA 1UWRA 1DWFM 2EPLX 1BPLB 2Y8KA 2J74A 5AC4A 2BXZA 2XGBA 2VVSA 2OSWA 4AXNA 1V0MA 2JIEA 3WL0A 3WQVA 2EPKX 2EO7A 3WDRA 2GFTA 3AYRA 2PWGA 4C7GA 2VL4A 2W66A 4HMEA 3AQUA 2F8QA 3EDFA 2BV9A 4MAVA 4LYPA 1X1HA 1E0XA 2D23A 3ZR6A 3IANA 1Q6EA 3BXWA 2GDUA 1X6NA 2VMFA 2PWDA 2G3NA 3U57A 1VFOA 2OWXA 1DWAM 3W6MA 4F9DA 2CBUA 4JCMA 4A3YA 4WIWA 1HIZA 3ARPA 2GUYA 2EBNA 4B3LA 4M81A 4PTXA 3CUFA 1Q4NX 2AMGA 1HF6A 5A6JA 2X8RA 4TVCA 2ZE0A 1K9FA 1R7AA 1HVXA 1J0HA 3BCDA 1BLIA 4GZIA 2E9BA 2A3EA 3WD0A 4L4PA 1UZ4A 1MXGA 4H2CA 4DUWA 3AXIA 1RWFA 1J0KA 3FN9A 2AOSA 3FAXA 1I75A 3NYDA 3WH8A 1JZ7A 1OGSA 3VX1A 1DEDA 3N18A 3D5HA 1TA3A 1RPKA 3W6LA 2Q8XA 2VCCA 2D3NA 3HN3A 5E6YA 1B3ZA 4U2ZA 1CGTA 1G5AA 2ZXBA 5A2AA 3PTQA 4AMCA 4W87A 1JYXA 3WQ5A 3MMUA 3KL5A 5D9MA 3WUGA 5ABFB 2CPUA 1OWQA 3NCOA 1KQZA 5A3HA 2WBGA 4DWSD 4D6JA 4ZFMA 3K4DA 4CU8A 4LXFA 5A8QA 1CGXA 3VIJA 1QI2A 2X2YA 5IFPA 3OZPA 2XSAA 4D72A 7TAAA 1CGWA 2WM0A 7A3HA 4J3XA 1HM2A 1OT2A 1PIGA 2VOTA 3OLIA 4YHGA 4CN4A 1V3LA 2W61A 4UFHA 3W82A 1BVNP 1PAMA 2WHKA 1PX4A 4QAWA 4P7NA 3SCPA 3LPPA 1OIMA 4ZENA 4UOQA 2V3GA 1GQKA 1AQMA 5TD4A 1QNRA 3WQ6A 2CNCA 3VGDA 4LYRA 4W85A 3CZGA 3TONA 5I2UA 1BYAA 3CZ8A 1HMWA 1CXIA 3QR3A 4WKHA 1XH2A 3SUUA 2ZUUA 3FHQA 1B31A 1G01A 4W86A 4JFUA 3UG3A 3LMYA 3BLKA 1I8QA 1PPIA 1PBGA 1W9VA 3T0BA 4GPNA 1H49A 1JZ5A 3BCFA 3WH9A 1GONA 2HVMA 2MANA 1DWGM 3THCA 3OGSA 5A6SA 1UUQA 2VR5A 3G6MA 3OLGA 2WYSA 5BXPA 3ZSTA 2BRVX 1V6WA 1EO5A 4A3HA 5AYIA 5DFAA 1E4LA 1B0IA 1J0ZA 3RJXA 6A3HA 3VTRA 1VJZA 1UR0A 1UYQA 3UR8A 1E3XA 4JIEA 4PMRA 1GJUA 2WHJA 2WWDA 2QLYA 4D6IA 1AQHA 1VBUA 3M7SA 1JI1A 4JFVA 3AMKA 1GZJA 1JIBA 1H09A 2JF7A 2NT0A 1X6LA 1V03A 1I1XA 4QLKA 1SMDA 3N1AA 2OSXA 5A95A 1BYCA 1XD1A 1DP0A 4FMVA 4GI6A 5A2CA 2WMFA 4RL3A 1V0NA 3KWXA 3VINA 4W5ZA 4KRTA 3VIIA 4E8CA 1XYFA 4FLRA 1UWSA 2WLYA 1DWJM 1NOUA 3TTOA 2WVUA 4IPLA 2E8ZA 2VUYA 1IV8A 3AMDA 4H41A 1E72M 1GVYA 2IXUA 4FLSA 4LGXA 1J01A 1TR1A 3L2LA 3MV01 1AMYA 1K9DA 2NT1A 5IFTA 5BRQA 2ZUWA 2DGAA 1WNOA 2BRPA 4GI9A 1HNYA 3WL1A 1B2YA 1CIUA 4JKLA 4NRRA 4MTVA 4XUYA 3VIKA 3N04A 3GTNA 1C8XA 3MANA 5I77A 3T0DA 2C7FA 3WEMA 2CESA 3AXXA 2VRQA 1ITXA 1EGUA 4B3KA 2Q1FA 2XIIA 4BF7A 1CPUA 3GBEA 4J3WA 5FD0A 2PWHA 1H4PA 1BG9A 4TUFA 4MNMA 5E9AA 1C8QA 5CGTA 1KGXA 3GH4A 1XH1A 4Z2HA 1DWIM 1UH4A 2PB1A 1NWUA 3M46A 2DIEA 1EDTA 2XUCA 3K8LA 4F9JA 5GNYA 2YJQA 5LA2A 2BVYA 1HMUA 4AYSA 3ALGA 2VURA 1RP9A 3W26A 2O9PA 1EOMA 4AZIA 5DT7A 4RE4A 4CCEA 1FH7A 2WBKA 2VRKA 1RWCA 3NUKA 1QHOA 3K4AA 3MUIA 4LYQA 3ZO9A 3OLDA 1H2JA 2BHZA 2X09A 1LF1A 4ZE4A 1ISVA 2BY1A 3WNKA 1OD0A 1V6YA 5KEZA 2VCBA 2DSWA 1QBAA 4U3CA 4NSBA 1E6QM 4D6DA 1UA7A 5JIWA 2GK1A 2J8FA 4JHOA 1VFUA 2CERA 2YKKA 1JAEA 1QI3A 4PMDA 3APGA 4PTVA 4XB3A 3VIOA 3AHVA 3PZTA 2ESCA 1CTNA 2V3DA 1EXPA 1E0VA 1UKSA 2J25A 3GXFA 4H8HA 4WLCA 3CZLA 3FW6A 4KRUA 2WB5A 2FHBA 2V5DA 5ABGA 3W29A 3WBEA 2WMHA 3W53A 2X03A 5CXPA 3MSDA 1MXDA 1OGGA 2V5CA 1V0LA 2J78A 3NSXA 2QF8A 3ZMRA 1CXEA 2GJRA 1E15A 3MUAA 1E5NA 2ZX7A 2VR4A 4U31A 1UOKA 3EMQA 2QMJA 3PZ9A 4MADA 3VNZA 3WH5A 4R27A 3NSMA 4HTYA 1NOWA 1JYVA 2J79A 1W2PA 1UH2A 4HZ7A 1EIBA 1J11A 3POHA 2ZWZA 4DWSA 1VENA 4UQAA 5HPOA 1MFUA 1OD8A 2XWDA 4UQEA 3BAYA 4AEEA 3WD1A 5BXRA 1LG2A 1W1TA 1G9HA 3A3HA 3W25A 2J7EA 3U7VA 3EYPA 3BAIA 1CXKA 1KCLA 2W91A 1X1JA 4TVUA 3AISA 1H0GA 1B1YA 1K9EA 4PCTA 3NSNA 3RO8A 1GHRA 1CENA 1TA3B 2A3CA 3AYSA 1HN0A 3CUJA 4HZ6A 3GH5A 1XD0A 4K68A 2XG9A 5CQ1A 1N7RA 4PMOA 3VMOA 3WFZA 1E9LA 3ARSA 4YHEA 3N11A 1B30A 2J62A 2DIJA 2WZEA 1WDQA 4HA3A 3CZKA 3PZGA 1E0WA 3RILA 4F66A 1JZ2A 1OIFA 4BCEA 5CSYA 3QHNA 4CCCA 2JIWA 2YA1A 1BG4A 4QP0A 1V02E 4TX8A 4OKDA 1HJWA 5BRPA 2ZXQA 3CHFA 2EEXA 3EDDA 2WMKA 2ZUTA 4LQ1A 2WSKA 4J28A 4TTUA 5EBAA 4UOZA 2E3ZA 4CUCA 5LA0A 4W8AA 4XV0A 1CGUA 1WZMA 3RM4A 1TG7A 2FGLA 2AAAA 1KR0A 3T2OA 1ZL1A 1XYZA 3OB8A 4PUEA 2FH8A 1X1IA 1CXFA 1OCQA 1JD7A 3O6AA 3S2CA 2JEQA 4L4OA 3CBWA 4HA4A 3MV11 4W93A 3VDCA 1LQ0A 2V3EA 1A47A 3WMSA 1W9UA 1VFFA 2CKSA 2Z1SA 2J47A 1EOKA 2J77A 3WDQA 1VB9A 3CH9A 3UEQA 3AIUA 1B3VA 4EKJA 4KH2A 1LG1A 4CKQA 3GNRA 2E8YA 4UTFA 8A3HA 3AIRA 3BMWA 1CB8A 1KGWA 3WELA 1WKYA 1WP6A 1EDGA 1H5VA 1QI4A 5DT5A 2YOCA 3WDJA 1QNSA 1NARA 4UQDA 5A8MA 2ZUVA 2YBTA 2RGLA 1WAWA 1J0IA 4W5UA 4AW7A 3UG5A 1E73M 2GJPA 2X0HA 3UCQA 4CVUA 3T09A 2ZWYA 4OZOA 4GKLA 4BZYA 5I79A 4N0RA 1LL4A 5HXMA 4AWEA 1HXJA 1LWJA 3ARZA 3AROA 1GCYA 1C91A 2XFYA 2VZTA 1HKIA 1ZBVA 5I6SA 2XWEA 4JL1A 4UFLA 3RMEA 5A6BD 2VZVA 4J3SA 5HPCA 5I23A 1B3XA 3SURA 4PUDA 1GOMA 4X9YA 4AEFA 1GOWA 1G94A 1XSKA 3POCA 2FHFA 2E9MA 2XFRA 3VIHA 3VGHA 3N13A 2WKLA 4H8UA 4JFSA 3PZUA 1XCWA 1JZ6A 1V6UA 5CG0A 5LA1A 4KGJA 3OA5A 1JYWA 3VDBA 2F61A 3RPMA 3J7HA 1V3HA 5JBFA 2BRWA 1VJSA 2DPEA 3VDHA 5JBEA 4ML4A 4TOQA 5IHSA 1ZS2A 2A3HA 1E6ZA 1KGUA 2CKRA 3L4VA 5AC5A 3AI0A 2DEPA 2YDSA 5CSUA 2PBGA 4H8VA 3MUZ1 3WFLA 4Z2LA 1UR9A 2V38A 4BQ2A 3NDZA 1GOQA 3NIYA 1WO2A 2QPSA 1V3JA 5HNNA 4D71A 1M01A 3F5LA 1ZJAA 1B3WA 3RCNA 3MU7A 3KE0A 4JZ5A 3GH7A 4Q22A 5M3WA 4AD1A 1KBBA 3A6OA 4D1JA 1MQQA 5D8ZA 2XM1A 3M07A 1W9BM 2J7HA 3F4VA 3ARQA 5CLTA 2NSXA 4C7FA 1CECA 3I3BA 1BAGA 1UWTA 3K8MA 3PZQA 2D0FA 3AIWA 3WDPP 2WC7A 4URIA 3VNYA 4AIOA 4UCFA 3UETA 4CD8A 2E22A 3W28A 1A3HA 5HDRA 1E70M 2OLHA 2UY4A 2PI6A 1WPCA 3A4XA 3MSGA 5AY7A 4AD4A 1ISYA 1Q6DA 2CCRA 3D3AA 4JFTA 4QDMA 4FLOA 3ZT6A 1DHKA 1KR1A 4DUXA 1CGYA 2GK1B 3ZT5A 1CBGA 3UESA 4EANA 1TUXA 2NW0A 5LYRA 1C82A 1VIWA 4CU6A 4U2YA 4JFWA 4MDOA 1XC6A 4UNIA 1HKJA 4H04A 2BY0A 4EAMA 1C90A 1WZKA 2WK2A 4AIUA 1UWQA 2YLAA 2EPMX 3AIBA 3U5UA 1BSIA 2D3LA 1ISWA 1XH0A 3ZJ6A 1JL8A 1Y7VA 2F2HA 4J7RA 1Q6CA 1K9TA 2G3IA 1R7OA 3WEZA 1W2VA 1JNDA 4AD5A 5FL1A 1PJ9A 3AIVA 2XVLA 1F9GA 1UWIA 3SCWA 1E6PA 4W84A 3ARRA 2DSKA 4WSKA 2VQTA 4HOXA 1B3YA 1J10A 2JE8A 4UR9A 1E43A 1Q6GA 4M29A 3BAJA 2DDXA 3B9DA 3SUTA 2B31A 3AHXA 3VVGA 4PEEA 3WNNA 2Y8VA 2QPUA 2Z1KA 1RP8A 1W3HA 2DT2A 3GNOA 2CIPA 1HJSA 4AD3A 3L4XA 2ZUSA 4XZWA 2DH3A 3AMGA 1SFSA 4CGTA 5CPQA 1GOOA 3HU7A 4P8XA 2WVVA 1BYBA 1W9PA 1XCXA 4ZE5A 4D6FA 1S46A 4IISA 1MVYA 3CUHA 1R87A 4PYSA 1VRXA 1W3YA 1YQ2A 2W67A 3PHAA 4MB4A 4NRSA 5A69A 2XFFA 2DT3A 3TTSA 4DUVA 1HL8A 1FP8A 1PZ3A 5BCAA 4OOZA 4R5EA 1SR0A 3EDJA 3G6LA 2ZX6A 3PZIA 2ZX5A 4PCSA 1K6AA 3WH7A 2J7FA 3DYMA 1E1FA 1NQ6A 4E8DA 1FH8A 3ZM8A 4P7QA 1QNQA 2D24A 4KGLA 4NI3A 2XVPA 1J18A 2Y2WA 1I1WA 1XGZA 2E9LA 1R8LA 3TA9A 4IPNB 4U3AA 2DQXA 1C7TA 3SCOA 3L4WA 1W9XA 3A4WA 1VBRA 3OGVA 4BQ3A 1ODZA 1CLXA 1NWSA 4AIEA 1E6RA 3PZNA 4JAWA 1UKTA 1H41A 4D6EA 1RD6A 1QW8A 1WDPA 2YL5A 1JAKA 2J7CA 1KXVA 4LPCA 4M8UA 3QHOA 5A6BA 1UQZA 4MB3A 4OJYA 4Q7NA 2ZX9A 3BC9A 5CPSA 1CLVA 3VGBA 1GVIA 2G8ZA 5DO8A 3KL0A 3CLWA 3TTYA 1CYGA 3VGEA 5E0CA 2YDRA 2Y24A 1UWUA 3DHPA 1GOKA 3I3EA 5GQBA 3WD4A 3PBGA 3VDAA 4HU0A 2BNJA 1WCGA 3CZJA 1D3CA 4U5IA 1H11A 1OBAA 4QFUA 1V3MA 4QLLA 5I5RA 4UQCA 1QW9A 3ARVA 3W38A 3CMJA 1F4AA 1V08A 4HOWA 3UG4A 4P7OA 4WF7A 2ZICA 3GM8A 1Q6FA
chains in the Genus database with same CATH superfamily
1MNSA 1ISXA 1V8EA 3EPOA 3PJWA 5AC7A 2E5DA 4WZHA 3GR8A 4V2XA 2WNWA 3WDIA 4GACA 3LYEA 2FIQA 1U5JA 4YTTA 1OGBA 3XISA 2FLIA 1VD6A 1VEPA 1JUBA 4JIIX 4XZNX 2NUWA 1A3WA 4LX4A 3NAVA 3P67A 5CGMA 3SSJA 5CEWA 3WJYA 2QIIA 1JFXA 1Q8JA 3WIJA 1N7QA 1XLMA 1ZJBA 1E6SM 1W8GA 1XW8A 4PUKA 2FZDA 2I14A 4UTHA 1PDYA 3P61A 3W1NA 4TO8A 1SFLA 1DIEA 1UKQA 4Q8NA 2A7RA 3QGKC 4RW5A 3N73A 1E4IA 3B0VC 1MZHA 1KFBA 3V0SA 4QEHA 4UZSA 1AA1B 3AC0A 2ISFA 4K1GA 4XG1A 1N7PA 4B5XA 2OGYA 3IJ7A 4DO4A 1NWRA 3M0KA 1GVFA 1C9WA 5FIPA 1PX8A 1PE1A 4DM2A 1OC7A 1JJKA 2Z1VA 5K9XA 1THFD 1PV8A 1OFEA 2CEQA 1U5HA 1EF3A 2CBVA 4GA8A 4P8UA 4C1NA 2BGSA 3LCGA 1J5TA 3WNLA 2VNCA 2GJLA 4FIRA 4M3PA 2Q71A 3THDA 4MHBA 3PNZA 3IJ6A 3PZVA 3SUVA 2ZCGA 4MDPA 4CD6A 5CSRA 1FA2A 3ZOAA 5AHIA 1CDGA 4FXFA 1O6IA 2TSYA 3NNTA 2VCAA 1EJTC 1DVJA 1X38A 4NZFA 1JVNA 1UBSA 2C0AA 3IARA 1FWAC 4L56A 2OXNA 1UROA 5LIKX 4O14A 5C54A 2TRSA 4ZB0A 1GK8A 4EXBA 4GQBA 1YDYA 1KRBC 4DF2A 3H2FA 3BAXA 5HR7A 4P8VA 4CN6A 4B91A 4DO5A 2YL6A 3VUSA 4HU4A 3CPUA 4ACZA 5DMLA 2QNEA 3MHGA 2GVYA 3RM8A 4GVFA 1XUUA 4DYEA 3OIHA 3CUGA 4M24A 1OK4A 2VT0A 3WUBA 1IZJA 2O4MA 4GO8A 1IIGA 4J3ZA 4P8WA 1TKKA 4XQ6A 3WSUA 5HMFA 2R1KA 3EWBX 4HNCA 2WSQA 1QTWA 1BF2A 3AHYA 3GVRA 1FHLA 4AWTA 1SSGA 2ZA2A 4R34A 3KBNA 1ZU8A 3QPEA 4GY0A 3IGSA 3VPLA 1O7AA 5CCZA 2P10A 2VTFA 1UA3A 1RVKA 3AS0A 4MUPA 4DQWA 3QEZA 2W6RA 4PMJA 4O57A 1ZP4A 1KRCC 4Y7EA 4LC6A 3MI6A 5AC6A 3KCOA 4Z2KA 1KBJA 1R3SA 4GFSA 1PX3A 5CC5A 3CB3A 2PDCA 4J3TA 2BP1A 1LROA 1QHPA 2W5FA 2YYTA 3PPCA 5D32A 3OQEA 2EKGA 6TAAA 1I0BA 1V93A 5DXYA 2QCLA 4JYFA 3C2YA 3CAVA 4H6QA 4KT2A 3EDKA 2UY5A 1WE5A 4K2SA 4XK2A 1RY8A 3LQGA 4S3KA 1LORA 1X97A 4D8AA 1XSIA 2XHYA 7PTDA 1PKYA 4IIGA 1A0CA 4F40A 1VJIA 5D4YA 4ZB5A 1HN1A 2FZ9A 2PLKA 5CG7A 4QNWA 2J8GA 1XG4A 3EKGA 4GC3A 4YPJA 3HQOA 3RCMA 3P80A 4O52A 1TWDA 1VRAB 3KRZA 1UUOA 2VX6A 4C6IA 4J3UA 3WBXA 1MFVA 1U5VA 3NQCA 2XN1A 1H1ZA 2ZRUA 3CWNA 3E0LA 5A8PA 3C56A 1TFVA 3MMWA 2INZA 3WNPA 4PMUA 3MI3A 1RQEA 4UTJA 1GTEA 4WKAA 2X0YA 1MQPA 5HJXA 1UOZA 4U33A 1REQA 2TODA 3PB2A 3N2TA 3B03A 2IPJA 3VKJA 4JNYA 4OIFA 1DXFA 4YCOA 2HPIA 5DCBA 3EOUA 1M04A 2V6AA 2GSJA 5FSDC 4LBUA 1UB3A 1IXOA 2EF9A 2NXIA 2X1IA 1ZBKA 4NZCA 1IT0A 3HF3A 4JICA 4C1LA 4EF9A 2BODX 2PODA 2OX1A 2QPXA 4MFDA 3AIEA 1FBAA 4GBUA 3HM7A 3LBCA 3ABZA 4GH3A 4TR9A 1JF5A 1TJ2A 3GTXA 4XO7A 5D09A 4DJFA 5C2GA 3TYEA 3MS8A 1XRVA 1ZUAX 3U2OA 3II1A 5EFDA 3HJZA 5BRBA 3IGXA 3GXIA 1V6TA 1F5ZA 3SQMA 3S8HA 4H00A 1QASA 1P1MA 4V1XA 4DWSB 3IS4A 3IT6B 3GXMA 1JNEA 1HL9A 2QS8A 4MMWA 1TTPA 2YCJA 4HK6A 4UFMA 2G4JA 1XWYA 4Z2JA 1CGVA 3R0KA 1TRDA 2GJXA 1N2VA 1UR4A 1F9CA 3IJIA 3IGHX 2Q09A 1TV4A 3T44A 1RPXA 3WF0A 4MJ2A 2DZVA 3UXKA 1XKJA 4HPXA 4UIOA 5EB8A 2PF0A 1VLIA 4CQBA 3A9IA 3B8VA 3NWRA 4BFAA 1EJXC 1J0NA 3AS3A 3P3BA 3MTWA 2NUYA 3RU6A 2CLHA 4W8LA 2W4XA 3PUOA 4DBWA 1M6JA 1X7IA 4UFIA 2YLLA 5CLWA 1H5YA 2GVEA 2VZKD 3WMBA 1HKWA 1LLZA 4XO6A 2HV5A 3B0YA 1XLEA 4Q8UA 1ONWA 4J27A 2X40A 2VC7A 3TOPA 3BICA 2HISA 3M0HA 2ZXDA 3L65A 1E40A 2CZEA 3SO7A 3OBAA 1FY6A 3QYSA 3UZZA 5LNWA 2YL9A 4I6KA 1RWAA 1IEWA 1UCWA 4ADSA 2WCAA 1EJWC 1IGSA 1QPKA 2DORA 5ENLA 2GQAA 3AICA 4DJEA 3ZJKA 1AG1O 3F4NA 1LZOA 4FR1A 1MI3A 3V36A 2QW5A 4NJHA 1S3TC 2JF6A 4HVXA 1S5MA 4JGDA 4AHQA 4KEZA 3SAZA 1XM3A 3G24A 1SJAA 1EH9A 3ZVHB 1GGOA 1YE6A 4IQLA 3TZFA 1CZ1A 3OU8A 1HM3A 4W7WA 2QV4A 4PCFA 4BWLA 4JTLA 1SW0A 2GGJA 3UWWA 1AJZA 2J7BA 4WSJA 4Y9MA 2FB3A 1GQIA 1F1SA 5E6ZA 4B4FA 1AQ0A 5M5DA 1T6MA 1XIHA 4W89A 4Q4KA 4W9TA 1UG6A 1DPMA 1E9IA 2GJNA 3APTA 3T2PA 5AKQA 1U33A 3CJPA 3ALFA 2J6XA 4JTCA 4F0RA 2G97A 4O54A 1NP2A 3R10A 4QG6A 4BEQA 3MBDA 3QZ6A 1EWDA 2R94A 3C3NA 3RLGA 3BL3A 4GLEA 5GPRA 1ZHAA 4XD3A 1HVQA 4DBUA 1G67A 1QI5A 3NQ7A 1E71M 1JXJA 3A3WA 3GHRA 3I7QA 3M6DA 4HMCA 1VGAA 1BWLA 1W5NA 1EIXA 3TTQA 4IG2B 1OC5A 1UR2A 1UP3A 2Y7FA 1ZP3A 2I16A 1RWHA 5M03A 2JEPA 2H8ZA 2CXGA 4L6HA 2C18A 3QZEA 4B15A 3TQVA 4CNTA 2R1LA 1D8CA 1IWPA 1L2UA 3ES7A 3U7BA 2G95A 4ZMGA 1J0MA 2X2GA 3EEZA 2NX1A 3K1DA 4I7UA 3LCLA 2QR6A 3ZLGA 3GU9A 1G6CA 4HT3A 4KWUA 4ERAA 3AXMA 3NGFA 4K8HA 2GGEA 4ZQMA 5HWMA 2CLPA 5FOOA 3S46A 4JIQA 5CZKA 1OT1A 1EX1A 4KWOA 1N7NA 2J7DA 2XU2A 1XRTA 2Z4GA 1AVAA 3W4RA 3LDVA 1AODA 3MKKA 2G3JA 5FI8A 3W84A 4X60A 1UD4A 5LIYX 4PBGA 5BYWA 1VCVA 2P50A 2VZOA 4GYJA 1FHVA 2OLSA 2DZWA 2XM2A 1QPQA 2YL8A 5FSEC 4JIPA 1VLWA 4QJ3B 1C93A 3GC2A 1WXZA 3MMDA 1W3JA 4KWVA 1CB2A 4GRSA 4LWWA 5CH9A 4LFYA 4IM4A 4AB4A 3SRHA 3P8IA 3S6TA 2AQWA 1LWHA 1QO2A 5FESA 1UKOA 1EQPA 4DM1A 2W63A 1GPFA 5G4EA 4NXSA 4I90A 3W71A 5J8LA 2DSZA 1G1YA 1FWRA 5ABHA 2UZ9A 3MUY1 1OJXA 3PANA 4PBEA 4YLWA 3EX1A 2XH0A 5E0FA 2DZAA 2R91A 4IQDA 1UD5A 2BWGA 3ARXA 3A21A 4PMZA 4YNGA 1AZ2A 1QPNA 1JD9A 2CLIA 3FYOA 1A5BA 3FEMA 3VIFA 4IUOA 4W7UA 4WJ8A 4DXVA 3W7OA 3T0TA 2XH7A 1TWSA 1R3RA 3GNPA 1ZZMA 1QRQA 3L9CA 3DZ1A 1E1CA 5A6TC 1P6WA 4J2MA 1AW2A 2Y4SA 5A5WA 1KTNA 2HNHA 1MNZA 1OINA 4F0HA 5MHBA 1ODUA 2B7NA 3FK4A 5KZ6A 3IAQA 1DIOA 2OSYA 4WOQA 4FHAA 1MUMA 1TPDA 1DL3A 2PDNA 3HOJA 2Y8KA 1M5WA 2CZ5A 3R12A 2BXZA 2VVSA 3ATYA 1R47A 1O1HA 3NGJA 4XBSA 3WL0A 1O0SA 3VNKA 4NT0A 5D2YA 2GFTA 3AYRA 1EL3A 4C7GA 2W79A 2GLKA 3LCHA 3MSYA 3RG6A 2BV9A 3KLKA 3TC6A 1WDWA 1NDYA 2B0MA 3BXWA 1FWDC 3C2FA 3TLQA 2OT1A 4F2UA 3M44A 2Y61A 2G3NA 1E0UA 3U57A 4KESA 3LGDA 1S39A 2REQB 2CBUA 2E6YA 3G1VA 1DJHA 4WIWA 4MYAA 2EBNA 3TH6A 2LLEA 1S2UA 1J8VA 1OFAA 1U83A 2C71A 3V1HA 3TFCA 2PMQA 3LV6A 1R7AA 3NZQA 3FYPA 1Q4WA 5MKGB 5E0KA 2CWNA 1XIBA 2A3EA 4WQ6A 4EPKA 4A8RA 5HR6A 3PBMA 1QOQA 1Z89A 4MZ8A 3AXIA 1J0KA 3FN9A 2AOSA 3GU1A 5F2LA 2W0UA 4ASTA 3N18A 3D5HA 1AD1A 2QAPA 2D3NA 4IXXA 3G3DA 3WQDA 4A05A 3ORWA 1G4TA 1S2VA 1CGTA 8XIMA 3DUGA 3IJQA 4CQAA 1FCQA 5DELA 2A7NA 1LOLA 2RKXA 3OOQA 3WQ5A 3MMUA 2G37A 3DBPA 1T0OA 5ABFB 2F38A 4NZ4A 1YW1A 3QSTA 5A3HA 2RDTA 1R9ZA 3EWXA 3Q37A 4ZFMA 2PDXA 2ISVA 2B7OA 3VIJA 2HVNA 3QRHA 1G69A 4D72A 1CGWA 3UCCA 1KM2A 3OJGA 2VOTA 5CBJA 4YHGA 3B3DA 3FJ4A 1V77A 3BW4A 1V3LA 4OT7A 1ITQA 5HA7A 2E1DA 4I7VA 4DJFC 4RDZA 3V18A 1XLIA 2WHKA 1AH3A 4YVVA 4JQAA 1F2JA 1PX4A 3AYTA 1TV2A 4HK5A 3MBFA 4JTKA 4ZENA 3LHWA 2Y70A 3MVTA 2CNCA 3VGDA 3HPFA 4KWWA 2ZTKA 1BYAA 1KA9F 4C6OA 3CZ8A 3P74A 1VPXA 3PP7A 2YFOA 3QR3A 5DRIA 3EOEA 5HWNA 3Q58A 1L6FA 4ROPA 4S23A 4LBSA 3FHQA 1B31A 1G01A 1JCYA 3DFOA 1RJPA 1PPIA 1PBGA 4DF1A 3P5ZA 4XKMA 3JVAA 3BCFA 2OEKA 2MANA 5A6SA 1UUQA 2VR5A 3ZR4A 4A3RA 1UJQA 2O7QA 3ITLA 1OABA 4A3HA 1P6BA 1E4LA 3S1VA 2G50A 2E28A 1VJZA 3H2NA 2Q3OA 5C6MA 1E3XA 4GH1A 4NJGA 4LNCA 2L5HA 1W1A1 3SSZA 4D6IA 3M7SA 1GZJA 1V03A 4DXKA 3N1AA 4H9ZA 2OSXA 1Z6KA 3E0WA 3JW7A 4GI6A 2WMFA 2QDGA 4E8CA 5CSSA 1UWSA 4IGHA 3UNTA 2WLYA 4DJEC 2QCFA 3TTOA 2WVUA 7ODCA 5JH2A 5C9RA 2P5NA 3BMXA 1XP3A 2IXUA 4LGXA 1KV8A 2TYSA 5BRQA 2DGAA 1MRQA 2QCCA 1A3XA 3QQ0A 1B2YA 4BWLC 2RDUA 3M0LA 5U7SA 3CYVA 1XISA 4REQB 2ZKMX 2QZRA 4ES4A 3N19B 3AXXA 2VRQA 2VZKB 3WLPA 3G1XA 2R24A 1CPUA 1S2CA 2GGIA 5FD0A 3G1DA 4MNMA 3UU0A 1KGXA 3GH4A 2I5IA 3UJRA 5CPLA 1TWIA 4A29A 1DWIM 3LXAA 3H24A 3QTGA 5GNYA 4QE4A 3AXKA 2VKZG 3S1UA 3W2UA 4IFKB 2O9PA 4CCEA 3NUKA 2NQLA 2IKHA 2HXTA 4A8NA 2ABAA 4RNFA 1E6QM 4D6DA 1W1IE 5JIWA 2CLKA 4LUTB 4JHOA 1JAEA 3WX7A 4XB3A 3TYCA 4AVFA 1D8WA 4MUZA 2ESCA 1EJSC 4WGHA 4MLJA 1EXPA 3WLSA 4HB7A 4H8HA 3B9NA 2PDQA 1S2TA 1K3UA 3FEQA 3FW6A 3MP5A 1LRTA 4POCA 2OTDA 3SB0A 1L8PA 5DLCA 3JU2A 2WSRA 3WBEA 3CL8A 4DLMA 3LUTA 3DGBA 3G1AA 5AOUA 1KBLA 4I6VA 1MXDA 3KVLA 2YW4A 1V0LA 2J78A 2QF8A 3ZMRA 4R7OA 3LBMA 1E15A 3QKZA 4U28A 2YFNA 4CNOA 1E5NA 2ZX7A 4R27A 2J79A 2A1YA 4HZ7A 5REQB 3IUIA 1EIBA 5IOBA 1J11A 4H01A 3POHA 2ZWZA 2XWDA 4S3DA 4E2VA 3UPMA 1SJBA 3U7VA 2D2JA 3D47A 3K4WA 3JS3A 3W7MA 3P14A 4GNJA 2W91A 5D2VA 3ES8A 3LTSA 3HPXA 3NSNA 4IP5A 1R6WA 4KEMA 3RO8A 1TA3B 2A3CA 3N3MA 3ZYZA 1XD0A 2XG9A 3G0UA 4D8LA 5I03A 4IGNA 1R5YA 4YHEA 4K1WA 3B04A 4HHPA 5BNKA 2XINA 3N11A 4DAIA 1B30A 1RLCL 4D8OA 4H6KA 1WDQA 3QY6A 1JZ2A 2NV9A 2AMXA 4BCEA 4CCCA 3OG3A 1V02E 2PDGA 1HJWA 2YZ5A 1XLGA 2WMKA 4LQ1A 2GWNA 4IP4A 2YPIA 4J28A 4TTUA 5EBAA 4UOZA 1X7FA 4H83A 3TDFA 5H8MA 3SY1A 4XV0A 3PJUA 1WZMA 3LCFA 3RLUA 4K8GA 3EX3A 5D30A 4WUIA 3OB8A 4WGXA 3G0XA 2WOQA 2HDJA 3O6AA 4L4OA 4NI8A 4TX9A 3LENA 1E51A 3UBPC 4LYKA 1LQ0A 2V3EA 2DFAA 1OF6A 1W9UA 2Z1SA 4A8IA 2J47A 1L6WA 3CEUA 1QK2A 1WBHA 1A5NC 3LSCA 4CKQA 3BOFA 1OHLA 8A3HA 3FGCA 2BLEA 3BMWA 1X98A 1KGWA 1OFPA 1WKYA 1H5VA 5AHLA 3SFKA 4IMEA 4C6LA 3N9RA 1FWTA 4IICA 2YYUA 2YOCA 3N4FA 1XRSA 3CV1A 1NARA 2AKMA 4UQDA 3P62A 4NAEA 2ZUVA 2CU0A 2EGZA 4AW7A 1QT1A 4R53A 4LVDA 4PGLA 2KXRA 3DIPA 4GKLA 4BZYA 4XSMA 1MEWA 1VYSX 2RAGA 4N0RA 1EBGA 5FEZA 5G1TA 5HXMA 3COTA 4M51A 3E74A 2VZVA 4J3SA 2FPTA 1NIUA 4XAYA 2R6OA 1WKEA 3A12A 3ERPA 1GOWA 1XSKA 3POCA 5G5IA 3H2CA 2FHFA 2GSEA 4D8ZA 5HNTA 2XFRA 4LS0A 5D37A 3VGHA 4JFSA 1JZ6A 5LSMA 2PWUA 3PJTA 4MYXA 5FJJA 2PCQA 3TSDA 5CG0A 3W01A 1LT8A 1JYWA 4LAZA 1KW1A 1GW9A 5T9CE 3ITXA 4Z42C 1V3HA 2A6LA 4LAMA 5JBFA 2DPEA 2PFHA 3CM4A 5JBEA 3SECA 4R85A 3U8GA 4O19A 1MMFA 1Q6QA 4E4FA 3ISIX 4KW2A 2DEPA 2YDSA 1EP1A 3QQ1A 3LNMA 1P0BA 4H8VA 2VUNA 5FAGA 2NUXA 2NVAA 2GUUA 2PPGA 2WSYA 3SW6A 1TPB1 4DI8A 2PDFA 3SY5A 4IX0A 4GKTA 2R8WA 3NPXA 3WQCA 3MU7A 3TR2A 3IIOA 3KE0A 1O12A 4WD0A 3M4HA 1ONXA 4AD1A 1MQQA 5FJPA 2XSXA 2XM1A 1Q6OA 3TAOA 3R8GA 3NURA 4FX6M 1MDLA 5FJOA 1BAGA 5EMUA 3PZQA 4EP8C 2D0FA 2D2HA 2WC7A 4CD8A 3C5QA 1TTQA 2OLHA 2J24A 2WJDA 4PRTA 3BW3A 1Q6DA 3AJXA 3MWAA 3SQSA 3R8RA 4JFTA 5CAHA 4D2JA 3W7RA 4FLOA 3ZT6A 1ALDA 2NQZA 3VCRA 3HQPA 2P8BA 2GK1B 2HK1A 1CBGA 4PL1A 2NW0A 2P88A 4M6VA 1VIWA 5GVJA 2ZZ4A 4NU7A 4ZQPA 1H7RA 5HWJA 2H9AB 1C90A 3L2IA 2C19A 4XKYB 1WZKA 1LM1A 4LW7A 1UWQA 3LA4A 4ZQCA 2EPMX 3OO2A 1B5TA 1XH0A 3GDMA 1KFCA 4FNSA 4IMAA 1K9TA 2F6XA 3WEZA 1W2VA 2QKFA 1DJZA 1JNDA 4PR4A 4AD5A 1X8FA 1IWBA 1RCXB 4NX0A 1Q7QA 3AIVA 2XVLA 4L4MA 3GHTA 3SCWA 4Q6JA 1E6PA 3R7MA 4W84A 3ARRA 2DSKA 4WSKA 1R3YA 4U4MA 1WKFA 1SJCA 1E43A 2DDXA 3SUTA 2B31A 4Q4PA 1TZZA 5KSWA 1HL2A 4QJ1A 1EPVA 3N4AA 4OE7A 4AVNA 1R9XA 3VNMA 1RP8A 1O5XA 3GNOA 4GYKA 2CIPA 1HJSA 3I68A 4Q4OA 1TO3A 1XQKA 4XD6A 3IWPA 4CGTA 2DUZA 1GOOA 3T78A 3W07A 4MJZA 5CC6A 2PWVA 4RDVA 4JQ3A 4EF8A 4LANA 4ZE5A 1S46A 4IISA 1XYLA 3CUHA 3P84A 4PYSA 5EBUA 2HBXA 4OQVA 1XIDA 3TXVA 2W67A 3PWAA 4ZGYA 2VFGA 2PTZA 1HGWA 4Q8PA 1A5UA 5T26A 4GG9A 4O0ZA 3TTSA 3BUVA 1FP8A 4A21A 1ZRQA 3T8QA 1UZDA 2ZX6A 3PZIA 2WZTA 2ZX5A 4DF0A 3B8DA 3QV7A 4JDBA 4EACA 2VELA 1K6AA 2J7FA 3DYMA 1I2PA 4E8DA 4S3BA 1U1HA 1GJPA 2OZ3A 2D24A 3DDMA 4NI3A 1IEXA 2OFJA 2ZE3A 4BI7A 3BWWA 4U3AA 3HGRA 1C7TA 3UWQA 4O0QA 3EOOA 1TJPA 3ITOA 1I9CB 4BQ3A 1CLXA 3N2MA 4UMCA 5B7ZA 1NWSA 3TLLA 1E6RA 5K4ZA 3PZNA 4JAWA 1PXGA 5HK4A 2OO6A 3PM6A 3B0UX 2J7CA 4GJJA 4L1WA 1F3WA 1J93A 1PO9A 4MB3A 4ZZ9A 4OJYA 2ZX9A 3BC9A 5IBXA 1LBFA 3KL0A 3NQDA 1U1UA 2PU1A 3C8NA 3GNNA 1UWUA 4HMNA 1GOKA 3WD4A 3SRFA 2OQYA 1WCGA 4HHHA 4U5IA 1OBAA 4J35A 4DZIA 5K3VA 4B2DA 1KRAC 2FFIA 1TV7A 4QLLA 1A5KC 3H70A 1F4AA 1V08A 2YGYA 4WF7A 3A23A 1R2RA 1Q6FA 3JZEA 3CV7A 1M7JA 5JQ9A 3BTNA 3ITVA 2OJPA 5C7VA 4GQ0A 2W62A 1LP6A 3O16A 3NO3A 1BTMA 2EQDA 5D9OA 1WA3A 3FCPA 1ENUA 3IUHA 2MUCA 3TEVA 1YNQA 1QCWA 3BGAA 4D6GA 1KXHA 2OODA 5JBDA 3VIMA 1RLDA 3M43A 4EOUA 2QUUA 1YIXA 3W85A 4H8NA 3W1MA 1FH9A 1S5VA 2YXOA 1GJWA 1OCJA 2FVMA 4Q7BA 1CNVA 2PP0A 2VFIA 3WUFA 4GZJA 4YL2A 1W54A 3EOSA 3QOMA 3NQ6A 3CS2A 4Y9PA 4QR6A 3AALA 2VDHA 1KLZA 3V5CA 4R7WA 2OYKA 2VDGA 5JUVA 1BFNA 3L4ZA 1IZKA 1VFLA 3KLLA 5CPMA 4HOZA 4TVDA 1BHGA 2A3AA 3WLKX 2DT0A 5D2WA 3CIXA 3NQ8A 3CTTA 5AVNA 3ICJA 3NYZA 3KP0A 1WOAA 2PWEA 3EZ4A 3URQA 4JTQA 1JZ8A 3AUJA 5D8WA 1EGMA 3KOFA 3PZOA 4RK8A 1CWYA 3O0KA 5HBFA 1FDYA 2PEVA 1OX4B 1CB7B 3UWVA 3BH4A 3VC6A 3MW7A 1S2WA 2JALA 3H7UA 1KCKA 1AH0A 2ZQ0A 5CBBA 2CETA 4AISA 1HFBA 1HKMA 1ONEA 1WX0A 1MW0A 1JZ4A 3O2LA 5AVHA 3QBUA 1TE6A 2V8ZA 1Q6RA 2GPTA 4XZBA 4IMDA 2QDEA 1J0JA 4AF0A 3L66A 2IKJA 2FFCA 4RPPA 4GGBA 7CGTA 4KPLA 4X3ZA 1KWKA 4UNLA 4GUJA 2NQHA 6TIMA 1GW1A 4O4WA 3P6LA 5EMKA 4P7RA 1EC9A 3AHTA 3DHUA 3AWOA 1QI0A 3L0NA 4NQ1A 4RV3A 2PRLA 3TE9A 5I78A 1UMYA 3E2RA 1Z42A 2WJFA 5DBTA 3LHZA 8XIAA 3VO0A 1OJNA 1TZ9A 4A6GA 3CGTA 3PFMA 4AX6A 2YSWA 1MUCA 4B9ZA 4IMFA 1GORA 1ZLPA 3ZVHA 4Q8VA 4CVWA 5DBUA 1JG9A 1W37A 3KOXA 1RBLA 1R85A 1KM1A 1M41A 8RUCA 4X0NA 3OGRA 4GI8A 2WZIA 3HURA 4H19A 4MFEA 2BZNA 2PBOA 4FOUA 4XD4A 5EFFA 2P0IA 1M7XA 1OYBA 1MYRA 2ZVRA 3VUPA 1W1ZA 4MNLA 4IMGA 1RA0A 1GYMA 3SCNA 2VGGA 1PHQA 2WVVB 3HPSA 1V6XA 1WUEA 5TBOA 4Q6XA 3CB8A 3VOCA 3AZTA 1EHAA 1PZ1A 4QX4A 2QJGA 4X63A 3ZIZA 1M53A 4U5KA 5G4WA 5CJNA 1FWHC 1BWKA 1V02A 1QNVA 3O05A 4I9MA 4M6UA 3N14A 3Q2DA 2D1ZA 2ZZ5A 1KFWA 3YPIA 1H1YA 1O1ZA 2ZADA 3ARUA 1XIIA 3UD2A 9RUBA 3CQIA 2F9RA 2HVOA 1XPYA 1TV8A 1XBVA 3GB6A 3UERA 1Z32X 1UD3A 1W5OA 5HUPA 2R1MA 1G0CA 3P0XA 4EE9A 9XIAA 2GWGA 4PMVA 3QC3A 2A3BA 1L6YA 1JYNA 6ENLA 3B05A 5XIAA 4RNHA 1RH9A 3AUOA 1Z44A 4WVXA 2BXYA 1KFJA 1GKQA 2OO0A 3E0FA 1Z69A 2YIHA 1EGZA 1BTCA 3MKCA 2HQAA 1SO4A 2VFDA 3NVTA 4JN6A 3MY9A 1FFQA 4HSHA 3VYLA 3GXPA 2PAJA 2CLFA 1MW1A 4DZHA 1KXTA 1N82A 3S5NA 5LZLA 4LUIA 2ZTJA 4F0MA 4KFNA 1UIOA 1FCVA 3OG2A 3T2QA 3W37A 1BVZA 3CPGA 3CZEA 3MDWA 3IJ8A 3OHMB 2QJIA 3M41A 5BWFA 4YN5A 2XIOA 3WK0A 4BKNA 3MZNA 1GT8A 4PB4A 3HGSA 3KBMA 1L9WA 2BVTA 3BMVA 2PU0A 2O9OA 3Q65A 4E2OA 2ZOXA 4Y8EA 3L0GA 3HBLA 1C92A 3IK4A 3HG2A 1VEOA 4M1BA 5AHNA 2J9YA 2VHLA 1VFMA 1UC5A 1ZTVA 4PTWA 1MEIA 4HSNA 7ENLA 4HJWA 3VGGA 3WF4A 3B8SA 2DSUA 4L1GA 2BBFA 2QJNA 3IK2A 4JYDA 2YXXA 1J0YA 5FJIA 1L6SA 1RW9A 1HP5A 4DJDD 3DI1A 1OZMA 3K8KA 5IXEA 4N42A 1T5AA 1WDRA 1YE4A 1BKHA 4XISA 4Y2WA 1XPGA 4Z2GA 1IGWA 3T55A 1SZGA 1TVLA 3FNDA 1LBLA 4KWSA 4HMDA 5C9WA 2DZPA 4HYVA 4LUSB 5A8OA 3NXLA 2O0TA 3QV6A 2HMCA 3MO7A 1TPVA 2BY3A 1E9ZB 5BROA 1R38A 1F3EA 2OYMA 1D7FA 2DV0A 5DN1A 1R3WA 2OPJA 5DMYA 2XYLA 3AFBA 4QSHA 4PCNA 2IQTA 2QCGA 4GVIA 1UR8A 4QROA 4DO6A 3PWGA 5I00A 3H21A 3LZ5A 3UWEA 4WHBA 3F4WA 1V3KA 1XXXA 3FOKA 2O92A 3F5KA 3H2EA 3LGGA 1N7KA 1ZENA 3WF3A 3W1TA 4JPGA 3WH6A 3DHDA 4AZHA 3VGFA 4AHPA 2Z0IA 5GNXA 1OJOA 1KC7A 3BCJA 3WDHA 2V3FA 1OVDA 1FKWA 1A5SA 2WW5A 4OBSA 5CGQA 4C5YA 1P5BA 3VM7A 3OVQA 4JY9A 4GQQA 5C2CA 3ANYA 4ZO8A 4C6JA 2DZTA 1I8JA 3U4FA 1DTNA 2HE5A 5HAOA 2JFEX 4L64A 4M5PA 3RUBL 2NVDA 1LJYA 2REQA 2EPOA 2XGIA 2DH2A 2ATMA 2Z1BA 5LKYA 3LPFA 3O63A 4FIQA 1HP4A 2HZGA 5F4SA 2FGZA 1W3TA 4N2YA 2WMIB 3DYPA 4NHVA 5IBXC 1AL8A 1IZCA 2OELA 5MKGA 3LMZA 4O10A 5L9FA 3A13A 3ITCA 1EKOA 3DH7A 3SI9A 1EO7A 5D9NA 1AMKA 1KFLA 2TMDA 4ACYA 3WY1A 4JHZA 5LGXA 4GNVA 1RXOB 3GDLA 3BJTA 1O68A 4PMNA 4Q8QA 2KAUC 1K77A 5E70A 5KZMA 3CQHA 4OOUA 4IIFA 1UIPA 4IMCA 4DRSA 2ABBA 1VBHA 3U5YA 3PC0A 2QUTA 3CHCA 3S1GA 1HJXA 2E0PA 3PN8A 2QCEA 2BVWA 2ZVIA 1VF8A 3AOFA 4MB1A 3VAVA 5CJ5A 3E02A 3SFWA 1NOFA 4GXPA 5ABFA 5DX7A 2A79A 1KWGA 1AH4A 3C3UA 2PDBA 1LL7A 5I0DA 4D1IA 2XIQA 3INPA 2BY2A 1KM4A 4DHGA 1JZ3A 1XINA 4Y6GA 4C7DA 2PGEA 1R86A 2DU2A 4AZCB 1ISZA 3WQEA 3TAKA 1B9ZA 5AC8A 1XX1A 1OSEA 2NSOA 2OMAA 4L9YA 5A6LA 1RCQA 3SCVA 5A6KA 4GXWA 3BO9A 1OZQA 2QULA 4WY0F 1V0KA 2E24A 4IXHA 4B9YA 3MUXA 2NVCA 1H60A 4LSBA 4A22A 1R30A 3WUEA 4N9BA 4C6PA 1GEQA 3L4UA 1GOIA 3TV8A 4B5SA 2YDQA 4OWGA 1A5AA 4HPHA 5I24A 1KXQA 4GQRA 1L0PA 2WC3A 3L12A 3W81A 4HHMA 4NYUA 3QTPA 2Y6ZA 4A2SA 4V28A 3IT4B 1Q3NA 4H9MA 5IRPA 1P4CA 1TTIA 3AS1A 1F3XA 3KFTA 3TROA 1HJUA 3NJ3A 1WKDA 2Z6IA 3KWSA 4GNKB 4UC5A 1PUDA 3VOJA 3OEXA 4XIAA 4AD2A 1T8XA 2PDIA 2WHLA 1XBYA 4MZ1A 3PFRA 4HPNA 4GY1A 4NJKA 3WBYA 2UV8G 1EB3A 2JGQA 3I65A 5EA9A 3WLRA 3BLPX 1YNPA 2E09A 3CHDA 5CPTA 5J04A 4L6DA 2PLJA 4YYFA 5XIMA 2WCGA 4ICNA 4ADTA 1AQFA 2D2GA 4OGZA 1E1EA 4LY4A 4H7VA 4PBFA 4O11A 3W0KA 3MO4A 1E55A 4BQ4A 1DJYA 5JXQA 3DEQA 1PKMA 4OU1A 2D2OA 4GZEA 3N3TA 1UQYA 3RJYA 3IV8A 1PYFA 3GVVA 1QDSA 3WKZA 3VOGA 2OWWA 1A4MA 3K46A 2Y5EA 3AU6A 5A8NA 1W1YA 3MCNA 3SCRA 1XLFA 4BS0A 1EDQA 1K7XA 4O1FA 1ZJIA 1LRQA 3K5XA 3PTKA 1VYRA 4J2PA 4FXRA 1DTUA 2XVGA 5IHRA 4H7CA 1D2KA 1GOXA 4XBKA 3SCQA 4J9JA 3LTYA 3P7YA 3A22A 1Y65A 3IAPA 1GQNA 4AWSA 5JU6A 4WJXA 4REQA 4X0VA 4MAZA 1VBGA 4UBPC 3TQKA 3DFTA 3QYQA 4JN8A 1AFSA 1L8NA 1H63A 3UGVA 2XFWA 2DZBA 1F6KA 1QOXA 3PZMA 5ECUA 3TX9A 3F1QA 4AZGA 1JPDX 3P60A 2BB0A 3RX2A 5CJMA 3BG5A 2WMJA 2C6QA 3AXHA 4FEZA 4IFKA 1NDZA 2V68A 1NELA 4WDXA 4EPDC 2DUAA 1UWRA 1DWFM 2EPLX 1BPLB 3D46A 1BXBA 3S0CA 2E67A 2ALRA 1SSDA 3PPGA 3E49A 1BQGA 4LUTA 4MM1A 3SR7A 1M7OA 1WYIA 3UZ5A 2PP1A 3V16A 3AQUA 3EDFA 1PYMA 4RZ4A 3OPSA 4JN7A 1TPFA 4LYPA 4B5TA 1OYAA 1Q5MA 3P0WA 1ONRA 3TMQA 4GJ1A 2NX3A 3HA1A 4L9XA 3W02A 3KBVA 4B3ZA 3BSMA 1VFOA 3S83A 1DJIA 3W6MA 2YCLB 4JCMA 3W7HA 2BGNE 4RCXA 4M81A 1Q4NX 2AMGA 4BJHA 3TSBA 3VNLA 4ZSUA 3TKFA 5A6JA 4HZMA 5REQA 3G3MA 1JDEA 1BLIA 3RX4A 2E9BA 1PCKA 4L4PA 4MZYA 3MCOA 5C0QA 3EGJA 4GABA 1RWFA 4XD5A 7REQB 4B4HA 3FAXA 3A64A 3GUGA 3NYDA 4A3QA 3CLMA 4KERA 3CQJA 3FFSA 3TJ4A 1K1DA 1H50A 2GVJA 1TA3A 3MJYA 1ELSA 5E6YA 3UZJA 4U2ZA 4NJJA 2V2HA 3VE7A 1G5AA 4O4VA 1WUFA 3E3HA 4K6AA 5A2AA 1OG0A 3F59A 4YTUA 4W87A 4H9XA 4NYYA 3F2CA 1RZMA 4G8TA 3KL5A 3TSMA 2CPUA 1I2QA 3TVAA 2WBGA 4DWSD 4Z1BA 1ADSA 3T0CA 4JTDA 2ACQA 4JQ2A 1B3OA 4MJMA 1QI2A 3HV8A 2VGBA 2XSAA 5AZ0A 5E5CA 9XIMA 2WM0A 3EOLA 3C2VA 4ZQNA 3WLJA 2W61A 4UFHA 5G2WA 3QGAC 4NZ1A 3W74A 1NF7A 1F61A 4CEXC 1MO0A 4QAWA 4OV9A 3W76A 1KM6A 3LPPA 4YYCA 4UOQA 3ZVIA 5TD4A 1BXCA 3WQ6A 2PRHA 1TPC1 2QCDB 4LYRA 1A5OC 1H62A 2P3ZA 5I3JA 5I2UA 2Y7GA 5D04C 1XR2A 2VEIA 1EZ2A 4JTFA 2C79A 2YCEA 3SUUA 2OLAA 3ITTA 3UG3A 2DVTA 3CTLA 1NF0A 1XG3A 3IUDA 4GPNA 4UXDA 5B80A 3BE7A 2VFEA 4OHQA 3LHVA 1EYWA 2FPYA 3DGRA 2QUMA 3OGSA 4GUFA 1I0DA 1VQTA 3PPHA 3G6MA 4RXGA 1I4NA 3BLFA 1EEXA 1FHUA 2EG7A 3RRAA 4LUJA 3QM3A 3GTFA 3BLEA 5DFAA 3RJXA 3VTRA 4HPJA 3UJSA 5HUOA 3FDGA 4PMRA 1GJUA 4O17A 3H2MA 2WWDA 3TC3A 2QLYA 1VBUA 1YDNA 3AMKA 1JIBA 5H6HA 1H09A 2NT0A 1I1XA 4QLKA 3EX4A 3C8FA 4K7YA 1DP0A 1T99A 3NL5A 5A2CA 5EMLA 3VINA 2AGTA 4W5ZA 2E5BA 3TA6A 4FLRA 1DWJM 2Y85A 1ML1A 4IPLA 1YPIA 2VUYA 3BURA 1S5TA 4DAFA 3GR4A 3GYEA 3OVRA 3QR8A 3NM3A 3THQA 5IFTA 2QVNA 1VYPX 3E96A 2BRPA 3SBFA 3DFSA 3WL1A 4AG0A 4TIMA 1A0EA 1W0MA 1PTDA 1SFJA 1BF6A 4GGHA 3VIKA 2R9RA 3MANA 5I77A 3T0DA 4X61A 2X1TA 3M16A 2V2CA 2G96A 2I9EA 1D3GA 1K7EA 1PTAA 4YS1A 1EGUA 2C3ZA 3NQBA 3LHUA 1W56A 4P5UA 1XGEA 3VE9A 4R9XA 2VOMA 2Q6ZA 1H4PA 2YB4A 4TUFA 1NDWA 1LQ2A 1VCGA 4MWAD 3NZGA 1GZGA 4XZMX 1F6PA 4NNAA 4R7JA 4XAFA 1UH4A 2DIEA 1EDTA 3OIXA 5LA2A 3I4KA 2PC4A 3UR2A 4AYSA 4GVHA 3ALGA 2VURA 1RP9A 3QPYA 1IXQA 3GVGA 4A3UA 3IACA 3W87A 3OLDA 2X09A 2BY1A 3H2AA 5KEZA 4MY8A 3IIVA 4K39A 1PVNA 4JTEA 4U3CA 4DLFA 2PGWA 2GK1A 2Y5SA 1A53A 1VFUA 1QI3A 4JTAA 3KBSA 1G4SA 4HBKA 4LEFA 4NVTA 2H9AA 2CZVA 3NFUA 1LLQA 2IW0A 1E0VA 1UKSA 2J25A 3FVMA 3GXFA 5DY2A 4WLCA 3DAQA 4XKYA 1SO3A 6REQB 1VFSA 2FHBA 4H6EA 4KCUA 4GUGA 2PTWA 5DANA 5FF2A 2PDLA 1O94A 3U2EA 5CXPA 2V5CA 3E5BA 2PS2A 3LTPA 4YTSA 4DLQA 4RDYA 2F6KA 3PB0A 3OVPA 3NL2A 3QY7A 1CXEA 3S2MA 5GJPA 5TNVA 1EPXA 3WH5A 2VR4A 5I3IA 1UOKA 3EMQA 1RUSA 4MADA 3NSMA 4HTYA 3GTIA 5AN7A 1YRRA 1JYVA 2HNEA 4LU0A 1UH2A 4LVBA 4M19A 1SFTA 1SUXA 1IIHA 2WO5A 4J1OA 4UQEA 3BAYA 2P1FA 3WD1A 3TYUA 5CAKA 2J7EA 3EYPA 1KCLA 1DXIA 3V0UA 1G7UA 4JY8A 4DIAA 3A3XA 1OY0A 3URBA 1CENA 2PD9A 2OR2A 3AYSA 3U9IA 3A4JA 3BQ6A 1REQB 1ZFJA 3ARSA 3S5OA 3KOYA 3STFA 5FF4A 1ZCCA 2DIJA 2WZEA 3IRDA 3R4IA 3UPWA 3CZKA 3WLMA 1OIFA 4G9PA 1P7TB 3LI0A 3TR9A 4IIBA 5BOEA 3FA4A 4OKDA 3W1XA 3O0FA 2ZXQA 3EDDA 2ZA3A 2WSKA 3QMRA 1WDDA 3LZ3A 4PB3A 2E3ZA 2PSNA 3NG3A 4U10A 4XZIA 4W8AA 1HQTA 3OP2A 2FGLA 4GX8A 4Y9NA 3T81A 3RAOA 4EWND 1XYZA 4UTIA 1VC4A 3E0IA 1JD7A 3HG4A 1LTDA 2EAWA 2FZ8A 5EU9A 1SQ7A 4HA4A 2ONEA 5FEWA 3OODA 4Q8OA 1VFFA 1I6NA 2J77A 3PBVA 2QYGA 3UEQA 3AIUA 3EWDA 3ATZA 4L61A 3VABA 2DW6A 4UTFA 3NQAA 3WFAA 1J4EA 1GVRA 3S47A 4GZ7A 1UASA 2ZC1A 5DT5A 5F4XA 1QNSA 3SQLA 5BU6A 2QEZA 2VD8A 3P2VA 1FCBA 5A8MA 3M5VA 2OEMA 3H2OA 3OHIA 4W5UA 1G7VA 1DORA 2PZNA 3RF9A 3MZ2A 3UY7A 1JCMP 2GDQA 3XIMA 2PDYA 3ZLHA 4KF1A 4JNZA 2X7WA 4QSFA 1ICSA 3DOPA 3G1RA 1W1B1 1HXJA 4AC7C 3AROA 1C91A 2XFYA 2VZTA 1HKIA 4PE8A 1L2QA 3R25A 4NJIA 4UFLA 5LNVA 4L65A 4ENLA 5SWUA 1EFZA 5I23A 1B3XA 1RJRA 2NLIA 4BY3A 3N6HA 1G94A 4HCDA 5HMDA 1TQXA 3E2SA 3VIHA 1BWVA 1XCWA 4HA0A 3UT0A 1VR6A 4B5UA 3UFYA 3RK8A 4ZCWA 3KRUA 2ZYFA 1NTHA 3VDBA 2F61A 1O5QA 4TV6A 3W72A 4PRRA 1VJSA 4ML4A 5LNRA 4TOQA 4N4QA 5LIUX 1KGUA 4NL1A 2ZZ6A 3AI0A 2PBGA 5FAJA 1DIDA 2V5LA 4IX2A 2V38A 3G22A 3NDZA 2PE4A 2Y5JA 2OCZA 4AMAA 4D71A 1C8VA 1ZJAA 4MY9A 3KS5A 3EPMA 1A5MC 2V82A 3DHFA 2ICSA 4Q22A 5M3WA 1GVEA 4X2RA 4D1JA 2W27A 4ONVA 1W9BM 4QNEA 3DXIA 3PBWA 1TPWA 5CLTA 1OX4A 3AIWA 3WDPP 3VNYA 4LCRA 3UETA 3T9PA 4YVPA 1E70M 5JMUA 5F4WA 1WPCA 5CPNA 2NX9A 4GHRA 3MSGA 5AY7A 4AD4A 1ISYA 3UWZA 1VCFA 3MUCA 3M5YA 4DUXA 3UXLA 3S9ZA 2OT0A 3UESA 3OVGA 1TUXA 3G1FA 4CU6A 4U2YA 4JFWA 4C6EA 4QDPA 1VHNA 4UNIA 2RUSA 2ZDSA 4H04A 3REQA 4QIUA 1J2BA 2VWSA 2WK2A 2YLAA 3AIBA 1Q2RA 3N6QA 3U5UA 2D3LA 2IS7A 4ZQOA 3UZXA 3H4XA 1Q6CA 1R7OA 2Z26A 1DE6A 1HZYA 1N8WA 2XZ9A 1J96A 2GOUA 4JOMA 4N9CA 1UWIA 1XFCA 1N8FA 2VEFA 2HJPA 5D38A 4F4RA 3W1PA 4HOXA 3WK2A 2JE8A 1PKLA 3BAJA 1JPHA 2VEPA 1W3NA 4ZBCA 2FB2A 2P53A 2Y8VA 2OB3A 3I7SA 3C2EA 3L4XA 2PDUA 2ZUSA 2X1UA 3AMGA 1Q85A 2HWGA 1Q66A 3BG3A 4B5WA 2DVXA 2FYMA 1UMLA 3HU7A 4DNMA 2WVVA 4IIDA 1W9PA 2VYOA 3SRDA 1EX5A 3PG8A 3RGTA 2ZFAA 4S38A 1CW2A 1YPXA 3WQFA 1JR1A 3G8EA 1VRXA 2I5QA 4O1DA 3IJLA 3EKLA 1DJGA 3PHAA 3UYCA 3NQFA 1I60A 2PDHA 4HK7A 4PUUA 5FF3A 3S6DA 2A85A 2DT3A 1R2TA 4HKPA 2DJXA 2XZ7A 1PZ3A 5CKSA 4OOZA 3B0XA 1W5MA 4S3GA 3EDJA 3VNIA 4M7TA 3TK7A 2HK0A 4PCSA 3QJAA 3WH7A 1NQ6A 4RX0A 1P0KA 4QG8A 1FH8A 4M7SA 4KGLA 1TV5A 5HQEA 2VC5A 3QZAA 2E9LA 3TA9A 4IPNB 3L7RA 2PDMA 3SCOA 3T6CA 3DENA 1W9XA 4GVGA 3NZ1A 1VBRA 3Q45A 3OGVA 1SJDA 5K9DA 2OEJA 3NPWA 3KX6A 4DBSA 3VCNA 1H41A 3IVTA 1RD6A 4R88A 1WDPA 2YL5A 1JAKA 1Z41A 2V69A 3KM8A 5AHFA 4HNVA 5G1MA 1UQZA 3V75A 4S1FA 4Q7NA 5CPSA 1CLVA 4Q33A 3VGBA 5EPDA 4HCHA 4BHYA 1KCXA 4ERGA 1CYGA 4L7ZA 3IIPA 5E0CA 3UQNA 2YDRA 5EYWA 1FWCC 1XQLA 4AYGA 2Y24A 3DHPA 4KRZA 1DQUA 5GQBA 3NL3A 3PBGA 2E5CA 1BSLA 3VDAA 3CZJA 1DKWA 3BDKA 3CYJA 4E6MA 4QFUA 1FCUA 5I5RA 1QW9A 3ARVA 5D2TA 1NU5A 4EPBC 2PTXA 4IGSA 3DBNA 3UG4A 4P7OA 2X7VA 4DZAA 3GM8A 5F7UA 4XX6A 1XDLA 2FMNA 2VQUA 2POTA 3GFXA 1Y0EA 3KOWA 2WXDM 1HKKA 5C70A 3UW6A 3TYAA 2DJLA 1IEVA 2GSHA 4GJIA 2TPSA 1YEYA 3CU2A 2OZ0A 1WB0A 1YHTA 1GHSA 3ELFA 3OZYA 4GO9A 3GDTA 1JGIA 4NAFB 5C7HA 4JXCA 1MRAA 8CGTA 1IWAA 1UD6A 2XN0A 2PUZA 1QNOA 1FWGC 3AMLA 5T8GA 4PSPA 1HX0A 2VFFA 3GO2A 1SR9A 4MWAB 3NDYA 3CWHA 2RDXA 1IEIA 1UUMA 4UB9A 4LUSA 4F0SA 4DO7A 3H22A 3GZAA 2DZSA 1FDZA 3G18A 3IJ9A 3QKEA 4BQ5A 4RE2A 3VIGA 3GSMA 1DXEA 4C6MA 1GYLA 1QNPA 1W6TA 2Z1XA 3VK5A 4PL2A 1PL9A 5EY5A 1JQXA 1IT7A 1ZB5A 1KV5A 2QMKA 5IDIA 1FWIC 2DSVA 1C7SA 1EA9C 3GLCA 4UR8A 4WSHA 3HFTA 1RA5A 3GE7A 3GC4A 3ITYA 3ECQA 4WCJA 1V3IA 4UUIA 3W22A 1H3GA 2HPMA 3CIWA 2G41A 4IJCA 3TNBA 4B16A 1UP2A 3W75A 3KL3A 1TCMA 5G2IA 2B4GA 2V5JA 3KDOA 4TXEA 2WMGA 2XJ7A 2E40A 4BA0A 3KBUC 3W24A 5H8UA 1IE7C 3UP8A 2WHMA 1H7OA 1VFHA 1GG0A 1TTJA 1A50A 4WDTA 3MDUA 3TW6A 3I3DA 3H53A 3SRKA 4B5VA 1A5LC 3VCCA 3S9IA 4LUYA 4PUJA 3DN5A 1PWMA 3B9OA 4JTRA 1NWTA 2OKTA 3RDKA 4IPJA 3R8HA 5BZAA 3EDEA 3VILA 3BG9A 5I3KA 3VKKA 3W2KA 3VX0A 4LJ3A 2WMIA 3UXAA 3BSHA 1FWWA 4JL2A 4QG9A 4CN1A 3IEBA 3ZJ8A 2O9TA 3CL6A 4KCTA 4MNJA 3TW7A 3GDBA 2J27A 3GRIA 1YXDA 4ZEPA 4DWDA 3VXGA 2X1SA 5I3DA 3ARYA 4JX5A 1YPFA 3ZZ1A 4UZUA 1POJA 1SW7A 1FFRA 1UHVA 3QQWA 3URAA 3O1NA 3W7JA 4P2VA 3WD3A 3GG1A 2E6AA 1LL6A 1JFHA 2Z25A 3R79A 5CZSA 2PP3A 3R2GA 3TOYA 3U0HA 2VENA 4GMEA 2YDAA 4WK9A 4AU0A 4I3GA 4KCWA 1LCOA 1OQFA 2PDWA 2NLYA 1LLWA 2C1HA 1W3IA 3V0TA 3TJLA 2QGYA 3GYCA 3FA3A 2XPKA 4BI6A 3FHAA 2D0GA 1NP0A 3T1GA 5FACA 3TW9A 4AZCA 4F48A 3DG6A 1K03A 2VI0A 1RD5A 4Q8TA 4ICCX 2WSPA 2FH6A 1P0DA 3AMCA 3NTYA 5K9CA 2FPVA 2NWRA 1US3A 3V3WA 3EWUA 3KZSA 3TWAA 4LVGA 2IMRA 1Q63A 4IT1A 3E0VA 4AZ7A 2FVKA 1N7OA 3C2OA 2VC9A 1LXMA 1XUZA 2RDWA 2WPGA 1IF2A 2Y7DA 5CZ0A 4PCPA 3ZQ9A 3FJNA 3DYOA 1RK6A 1X96A 2IPGA 2DUXA 3ME3A 1YTKA 4IFRA 1CXLA 5BOOA 3VM5A 3DG3A 1PSCA 4GINA 4E8GA 2YBUA 2BVDA 4WOZA 2QAFA 3CAKA 1US2A 3CPRA 4K36A 5K2ZA 3S2JA 1AJ2A 1NFGA 2Z2UA 4WEVX 1W3KA 2VX7A 3W6YA 1BEUA 4J3VA 1TJ1A 4K7VA 1E5JA 1JF6A 3CUIA 3UCDA 4FF5A 3LM3A 1XCFA 1TVPA 3ZS4A 4IOTA 3W7EA 4V15A 1FKXA 1X39A 2WNZA 2BG5A 4N9DA 2ZIDA 5D02A 2UBPC 4DBDA 3B8IA 3WNOA 1V7AA 2EG8A 3THAA 1QK0A 1FXQA 1RBOB 3AJ7A 4NNBA 4LY8A 2ACUA 3GIPA 4Z1AA 3MPGA 1FDJA 3OLEA 4RKAA 2GQ8A 3KEHA 2BHUA 5EGRA 2XTKA 2VD9A 3WLTA 2FTWA 3FIGA 4KQNA 2OGJA 4EX4A 2VR2A 1HGYA 1FOBA 3ABXA 1M7PA 1C3FA 2YA2A 2CBIA 2WWCA 4RLIA 4IIHA 1BGGA 1KFEA 3FAWA 3DFQA 1TB3A 5PTDA 4G2DA 3O6YX 3FVDA 3L68A 1B90A 4M0XA 2WANA 2ZUNA 3NVDA 2ZZ2A 2Y0FA 1GQJA 3IPWA 5H1WA 3S2LA 3SIZA 1QOPA 1UH3A 3I6TA 5C9XA 1HG3A 3QW4B 2TAAA 3ARWA 3WLIA 1KKOA 2NZLA 3OBEA 4GIRA 1V51A 4FB7A 1EA0A 4UOJA 2DVUA 3N34A 1YLVA 1ZY9A 1UD2A 2IUZA 1S1RA 2WCOA 3TYDA 3WMCA 3F03K 4H2HA 3O9NA 5HNUA 4I5RA 4N6EA 3LLDA 2QCHA 2V5KA 4XSLA 3V5OA 5DMMA 1T7LA 3SGZA 1B57A 1KB3A 5DEZA 3RR1A 1JCLA 1CXHA 2FZBA 4AC1X 3DECA 3AZSA 3UYIA 3GK0A 2AL2B 1UKPA 1GWJA 1H7PA 3TTEA 3SIMA 1U2YA 4WDWA 1PIFA 2PDPA 3N15A 4LH8A 3SUSA 1LDCA 1OJMA 3PSWA 4P7LA 4G6CA 2QF7A 2Y7EA 1ZBWA 2VJXA 1YDOA 3H6OA 3NPVA 3IRSA 1JDDA 2PLMA 1NQKA 2CLLA 1U30A 4JIRA 3BJSA 4X22A 4BEUA 3E2QA 3LY0A 3ZXWA 2YCLA 2VEMA 2Q01A 2J4GA 1ICPA 2VP8A 1XC4A 1ZALA 5DY3A 3ONCA 4LAOA 5FF0A 3E38A 1OB0A 3TP4A 3HFYA 3R5EA 4HPGA 2XIBA 2CITA 1ITCA 4MNKA 4US5D 4LTSA 5D9PA 3CXOA 3ANUA 3NEVA 7REQA 2EXOA 1CCWB 1XSJA 3M5XA 3PUEA 2IPWA 4JYEA 1F4HA 3ONBA 4E0CA 3EBVA 4CD7A 3R11A 1XBZA 5C71A 3SN4A 4C6CA 5C9UA 4JD4A 3H54A 3IV3A 1Y5VA 4JR5A 2ZUMA 4KMQA 1LQAA 3L67A 1JI2A 5GNZA 3L4YA 3UPBA 3VD3A 2BSLA 2EKCA 4CLMA 1CI1A 3S4TA 4UNKA 1LLOA 1RBAA 1TE1A 2P0OA 3ZR5A 1W8SA 3SCSA 2QHAA 2VZSA 3VD5A 4OBRA 1XKYA 2X05A 1EF2A 2WVTA 1GG1A 1HW6A 2UY2A 4IPIA 5T9BG 3W73A 4F79A 1J12A 2J13A 4NXKA 5AHEA 1XI3A 2QXWA 5CZJA 3ARTA 4AZ6A 3D6NA 3THUA 2QCDA 1H1NA 4TTGA 5LHFA 3A4AA 2VEGA 1TIWA 3ZSSA 4S39A 2ACSA 2WKGA 3VKCA 3UR7A 3N9SA 3BSGA 3NQ2A 2Z29A 3N9KA 3N17A 4RDWA 4XTIA 1K8XA 2ZX8A 2PRMA 3TQ0A 3WLQA 1FQ0A 2Q8LA 4C6FA 1QBBA 4IIEA 2I7GA 5ABEA 1M03A 4QE5A 1E4NA 1DQXA 1MW2A 2R1PA 5M17A 3SEPA 3EEGA 3WBAA 1ZNNA 1QHZA 4O1CA 3NQEA 2ALDA 3UY8A 5I07A 1Q6LA 1VRDA 3M0YA 1IEQA 5C8BB 4KIEA 5I3HA 1ADOA 4E4UA 1LXKA 2I1OA 3G5EA 3RNDA 4DJDA 2RJGA 3VU2A 1TWZA 3QGVA 2WAGA 2OWCA 4I8DA 1S1PA 2YW3A 7TIMA 1Q8AA 2C8NA 3KHJA 1VPYA 2E1WA 4M80A 3RHGA 5FEXA 5HQMA 4QQ3A 3HO8A 2J88A 4AY1A 3EMCA 1KRMA 4QEEA 5EMMA 1FXPA 1SO5A 4XAPA 3PTMA 1GKPA 4C6KA 3HG5A 1HT6A 2JBMA 4MWAE 1C8YA 2DQWA 1P1XA 5HOSA 3GKAA 3WQ8A 1BRLB 1E6NA 4HHLA 1XV8A 5FCZA 1H7NA 1SYTA 1W32A 5KETA 3UJ2A 1BD0A 4IFOA 4QLJA 2A21A 1WV2A 4FK9A 2JGYA 3KVMA 3H8AA 2WCSA 4UFKA 1DOSA 3LCWA 4AVOA 2OZ8A 2DT1A 4L80A 2ADAA 3M0VA 4F3HA 3SJ3A 1RWGA 4LC8A 3TJIA 2WNQA 3GIYA 4W88A 3FS2A 1EYEA 4NKCA 4Q4RA 4MLRA 1H0IA 4PTNA 1KM0A 3A47A 2ZDRA 1V4YA 4GIAA 1NY1A 4BR1A 3FA5A 1GUVA 2BHYA 1OX5A 1CX9A 3FV9A 4OUEA 1XFBA 1NM9A 3RU8X 3WJXA 3STCA 4JTGA 2RGMA 4JHMA 5A1AA 4CNUA 3R94A 2J74A 5AC4A 3H12A 2XGBA 4AXNA 3KCLA 4XVDA 1V0MA 4DEFA 3WQVA 2DZXA 1ICQA 3WDRA 2GYIA 5KTLA 4YWSA 2PWGA 1XYCA 2VL4A 5TQLA 3CH0A 2W66A 4UMAA 4EIVA 4MAVA 1SM9A 4NZJA 6REQA 1X1HA 2WJEA 1E0XA 1TX2A 3ZR6A 4DXXA 5BMWA 2GDUA 4UTUA 1X6NA 3W7DA 4J4KA 4EAYA 4EWJA 2PWDA 2IKIA 2WQDA 1CLKA 4O12A 3VZZA 1QAPA 2FQIA 3CASA 4KS0A 2QGHA 4F9DA 4A3YA 1HIZA 3ARPA 2GUYA 4B3LA 3OYZA 4PTXA 3F4DA 1QATA 1HF6A 4AEOA 2IKGA 4TVCA 1HVXA 1J0HA 3W7LA 4BF5A 2G0WA 2XH4A 3BCDA 3VKAA 4CQDA 4FX7A 3GG0A 3WD0A 4IQJA