2WMGA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in complex with the lewisy pentasaccharide blood group antigen.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
555
structure length
553
Chain Sequence
b'VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIANYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLKGHHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 199
structure length 553
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmgA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmgA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmgA02
3WQWA 2WVTA 3PTQA 1DWGM 2WZIA 2XSBA 3BMWA 4L4PA 1AMYA 2VRJA 1Q6GA 4AD2A 1BGAA 1HM3A 1KXQA 1FOBA 3W25A 1TVPA 2CHNA 4GI6A 5FL0A 3VGGA 3W37A 1QW9A 2DT1A 1C92A 3TTQA 2DT0A 4ACYA 1GOWA 1UWSA 1RPKA 1YHTA 2QPUA 1E6PA 3KL0A 1E71M 3LPPA 1V08A 2D1ZA 5ABHA 2IXVA 1UQYA 3BCDA 1JZ2A 4YHGA 2XVLA 4HPHA 3EDEA 1OJMA 1GQJA 3ZJKA 3LMYA 4W8LA 4HU0A 1F4HA 4PSRA 5I3DA 2HISA 3VIMA 1UH3A 3GXMA 5CJ5A 1XCXA 2UY5A 1DWJM 2QF8A 2E8YA 5M03A 1B31A 2ZX9A 1RD6A 1UZ1A 3SUTA 2YA1A 4Z2HA 3L4UA 4M8UA 1KCKA 4H8UA 4MDOA 3A6OA 5A6MA 3HJEA 2XIBA 4CN6A 3BLPX 1V03A 4CD6A 4PMNA 4AZIA 4Z2IA 1NOWA 4DUXA 1BSIA 3UESA 4PMDA 4JFSA 1ITXA 2PWGA 4PMXA 1GJUA 4ZE5A 1A3HA 3TOPA 1JYXA 2J62A 1R85A 2E24A 2OSWA 5BYWA 4U2YA 2QMJA 3RIKA 2FHBA 1A47A 3GXFA 3N17A 3DECA 4Z2KA 4LYPA 3NSXA 1BFNA 3BLKA 2A3AA 4MPKA 1UWIA 1PJ9A 3BAIA 5A1AA 4KH2A 4TTUA 4UZUA 4JFWA 2Y4SA 3OLEA 4TVUA 3QGVA 4MAZA 2J7DA 3CIVA 1J0YA 3CPUA 5CXPA 2X05A 2J79A 1XHGA 3N13A 3UEQA 2J7FA 3WD0A 3QHOA 1XCWA 1EDTA 2W61A 4URIA 1ZJAA 3OGSA 3AHYA 3DYOA 3ZR5A 1JYNA 2VZVA 1BYDA 1J18A 2CHOA 3W0KA 2CXGA 3POHA 4MB3A 2X0YA 2WVVA 3MV11 3VMPA 2Q1FA 5ECUA 3NYDA 1ISVA 4J3XA 3W6LA 1V6XA 2ZUSA 4QCFA 3ZSSA 2J25A 2DIJA 3MUIA 4J3SA 4U31A 3SUWA 3GBDA 4AYSA 5AYBA 1FH7A 3POCA 1E5NA 4CUCA 4XB3A 1KB3A 2VRKA 1OGGA 1W9DM 1XD1A 1E55A 2FHFA 1J0ZA 4EAMA 4B15A 2X8RA 4WLCA 3WDJA 4J27A 3PZMA 5TD4A 1JZ5A 2WDAA 3WNKA 4W8AA 3T2OA 1G1YA 3AHTA 3GNRA 3WEOA 4AY1A 4D72A 1M03A 1HF6A 3WBAA 3WH6A 1UKTA 1CXLA 3K8KA 1NWRA 2GUYA 1QPKA 3AICA 4JFUA 1X1IA 4BQ2A 5E9AA 1KGUA 1PX4A 1VJZA 2DSZA 3AIUA 1H09A 1RWGA 1G9HA 1R86A 5JIPA 3U7VA 3AZSA 4UFJA 1J9YA 5EFFA 3CGTA 1VAHA 3AYRA 2JEPA 1UH4A 4W8BA 1R7AA 3CZLA 3CUHA 1E1EA 3TTYA 1UHVA 2G4FA 1K6AA 1HJVA 1C90A 1GQLA 1WZLA 4GO8A 4CGTA 3MO4A 3RJXA 2PI6A 1QI4A 2PWEA 4JHOA 3WF1A 3VIKA 2WW5A 4BQ5A 1H1NA 2XIIA 4UFMA 1GOQA 3T0BA 3VDCA 2X03A 1CZ1A 1W1YA 2WXDM 3BAKA 5BWFA 5IXEA 1V3MA 3BAXA 1OINA 3AMGA 1HP5A 1XYZA 3L4ZA 3T08A 5BXTA 1V3IA 1OSEA 3TTSA 3ARYA 2GK1A 1C91A 1JGIA 2PWDA 1MW3A 5HBFA 4W93A 1WB0A 3OG2A 4WF7A 4OBSA 1VRXA 4PN2A 4GKLA 5CPQA 2PWHA 3VD9A 4A3HA 4AEFA 1H49A 3ZT6A 3WDPP 2EPNA 1WDPA 2VC9A 4UOQA 4ACZB 1EH9A 1MVYA 3QOKA 3VMNA 3WF3A 2JE8A 4P8XA 3ZT5A 4HA3A 2J7CA 3KEHA 1OCQA 1E3XA 2VZSA 4PTMA 1K9FA 1LL6A 3M6DA 3VX0A 1E4LA 2PWFA 5HPOA 1RW9A 1VFOA 2G3JA 4UQCA 3IJ9A 4ML4A 1KBBA 4ZXOA 1E6RA 1B3VA 5GNYA 4FMVA 3BXWA 3PZ9A 4W7VA 3AQUA 5I5RA 2NSXA 1E56A 2BV9A 5BXSA 2B31A 3U57A 3WD1A 2XWDA 4JCLA 4YPJA 1C7SA 4GIAA 4W89A 2WLYA 4DWSD 2FHCA 1ZU8A 2TAAA 1Q6DA 1UQZA 2WBGA 3DYMA 3WMSA 2ZUUA 4DUVA 4OIFA 1LXKA 3VDHA 3FN9A 4Q7NA 4M80A 4KMQA 3LPFA 3BGAA 3CUIA 1E5JA 3BAJA 3HU7A 2GJRA 4W7WA 3VU2A 1N7NA 4W87A 2WVUA 3K8LA 1IZKA 5E70A 3N15A 4P7NA 2XPKA 1HL9A 3L2LA 4AZGA 1B3WA 4WKFA 1GHRA 2X0HA 3M46A 1CGYA 3GH5A 1XSIA 1N7PA 1Y7VA 3BAWA 4IISA 1X6NA 1UWTA 4MJ4A 2CNCA 1KQYA 3II1A 1EO7A 3MU7A 4P8UA 5HNNA 3QR3A 4RE3A 4Z2GA 2CKRA 1KFWA 4JCMA 2WMKA 1MQQA 1W9UA 4CD4A 3GYCA 2XGBA 3MV01 5A6JA 3BSGA 1ODUA 2VRQA 2CBJA 5BRQA 2CBVA 3A4AA 4D1IA 3ZM8A 4KRTA 1BHGA 1CGVA 1QNSA 2ZXQA 4C7FA 2O92A 1E0VA 2VZTA 1WO2A 2VQTA 3VIGA 3VVGA 2XM2A 3AOFA 3KWXA 2WMJA 3L4YA 1VBRA 2C0HA 4D6DA 3RCNA 3PZVA 3PZTA 4D6IA 2E9LA 1DWAM 3BSHA 4S3KA 5CPSA 1V6UA 2Y2WA 3FHQA 4OOZA 1VB9A 2WANA 1CNVA 4H7VA 2OYMA 4AD4A 3VD5A 1GCYA 1LWHA 1QNQA 4QLLA 4U3CA 3SURA 4OBRA 2CKSA 3AMDA 3WQ4A 1GPFA 1HJQA 1E3ZA 1XSKA 2UWFA 4K68A 1US3A 4FLSA 3IJ7A 4HZ6A 1X1NA 3WQ5A 4E8CA 4PUEA 2E22A 4UFHA 3WIJA 2NT1A 3AHXA 1G5AA 2X1IA 2QPSA 1CGXA 4EKJA 5GQBA 4GI8A 1JD9A 3PN8A 1Q6CA 3RPMA 1CECA 4WSKA 1TMQA 1ISZA 1NP2A 1ESWA 6CGTA 1D7FA 1CGUA 1DWHM 5A8MA 5D8ZA 3WELA 2JEQA 4HMCA 2DH2A 3LPOA 4H04A 2FH6A 5CPTA 2WVVB 4PMZA 3VPLA 1CBGA 1OWQA 5CQ1A 3L4VA 1JDCA 3A4WA 2CEQA 3EMZA 3F5JA 2YDRA 2WHLA 3CZJA 1WZMA 4X0VA 3WF4A 5LA2A 5EB8A 4AD1A 3WFZA 1XC6A 1KR1A 2WCOA 1CPUA 1JYVA 5AYIA 2EQDA 4WIWA 2CITA 2ZXAA 3EDFA 4AW7A 1J10A 2DQXA 3VX1A 4GZJA 5IFPA 4YN5A 1GORA 1XH2A 4UOJA 4XX6A 1HN0A 2BHYA 5C71A 3SUSA 2DT3A 3AISA 4AWEA 3VKKA 1QI0A 2QHAA 4NZCA 4ATWA 1Q6EA 3CUFA 1MW0A 4RE4A 5A2AA 3WUGA 4PSPA 1YQ2A 1RH9A 1JDDA 1C8QA 3ZSTA 1AQ0A 2OWCA 4PRWA 2VI0A 5E0CA 5AC5A 3VNYA 4WKHA 1LL4A 1JNDA 1B9ZA 1BYCA 2EPOA 2CBUA 1D2KA 1V3KA 2BY0A 4U5IA 3PZUA 3WN6A 1V3JA 4JKKA 5CZKA 3GNPA 2DSWA 2BY1A 1E40A 4W7UA 3VMOA 4DWSC 2CETA 1TR1A 1BTCA 1H4PA 2ZOXA 4CU8A 2D24A 4PTXA 3L4TA 1PAMA 4PMQA 3B9AA 4M24A 2EXOA 1K9EA 3LPGA 4P8VA 3GH7A 4F9JA 4X9YA 1RP9A 2BY2A 2EO7A 2GK1B 1NARA 5D4YA 1PIFA 1PZ3A 3WKZA 1RWFA 2ZWYA 1E72M 3AROA 2D3NA 3AIBA 2ZIDA 1O7AA 5DO8A 2WVSA 3VDBA 2WC4A 1OGSA 5A6BD 3CHEA 2EPKX 3CH9A 1V6YA 3CHDA 1W3KA 3W4RA 4Z2JA 1FP9A 1CXFA 1CYGA 2BVDA 4R27A 1ITCA 3D3AA 1QI3A 2J8FA 3O2LA 1CXEA 1W91A 3CO4A 4XZBA 2J78A 3VD3A 1W9PA 2WB5A 4AIEA 1JZ6A 2YL8A 1PX8A 4DWSA 1ZB5A 4HOXA 1XH1A 3SCQA 4B9ZA 1V6WA 1V3LA 1QHZA 3L4XA 3B9DA 2WCAA 1J12A 4C7DA 4NRRA 4WKAA 2EPLX 2O9RA 5BXPA 2J8GA 1FFRA 4MJ2A 1E4NA 5E09A 1TA3B 3MMUA 4P7QA 5D9MA 1GHSA 3W27A 4PCTA 4JFTA 1TCMA 1GOOA 3W26A 3HMCA 4UFIA 1CXKA 3WH9A 5BXRA 5A8OA 5FOOA 4LYQA 4B3KA 3ZJ7A 4TXEA 1H3GA 3N12A 1UA3A 4XV0A 4D6FA 3DHUA 4GZIA 1HJXA 1HKMA 3G6MA 1LJYA 3K4DA 2VX4A 3VGEA 4ATLA 1EHAA 4M56A 1OM0A 4W5ZA 1EOKA 2GDUA 4AD3A 3SUUA 4UNIA 4GXPA 4F8XA 1X1HA 1OJOA 1VEOA 2BXYA 1UR1A 2CERA 2WWCA 1TG7A 1ZBWA 3WBEA 1UKQA 2XVNA 1PZ2A 3PTKA 2VZOA 1QNPA 1W3HA 1MWOA 1ODZA 1RWAA 4CCCA 1GONA 1E6SM 1HT6A 7CGTA 4HOWA 2O9OA 1WP6A 5E6YA 1H0GA 4QP0A 3RDKA 1C8XA 5I78A 2WKGA 3GH4A 3U5YA 2FGZA 4CD8A 4JFVA 1JZ8A 4QDMA 5DF0A 2DSKA 1JI1A 1JF6A 2WHMA 2EJ1A 4V28A 1JXKA 4BZYA 5I0DA 4E4PA 2NT0A 4GQQA 3AS3A 4ZE4A 4RL3A 1B90A 2O9PA 2DH3A 3WNPA 4MAVA 2WZHA 1HMWA 2GJXA 2A3BA 3AIWA 2VCCA 3WEMA 3CZ8A 4IUGA 3AHVA 4B9YA 2UY2A 4ZEPA 1HXJA 1V0LA 1UD4A 1HNYA 1VIWA 4EANA 3N04A 1WAWA 4QLJA 4W85A 1TUXA 3GNOA 1E70M 2V5DA 2VNCA 2DEPA 1SMDA 4DUWA 1E6NA 9CGTA 1UKPA 5I24A 1UR4A 1WCGA 1ZL1A 2W92A 1KGXA 3N18A 2XFFA 4AISA 1JDAA 1SFSA 2BHZA 3WH8A 3WL0A 1W32A 2XM1A 4ZXLA 2GJPA 1G01A 4MNMA 4UTFA 1WNOA 2GVYA 4XUYA 3BCFA 3SCRA 1I8QA 1C93A 5BROA 3KZSA 1FH9A 1S46A 3NUKA 3NJ3A 5D9OA 2OYLA 3RMEA 1KWGA 3AJ7A 3AXIA 1XH0A 2DSVA 2VURA 3APGA 4IPLA 4MADA 4H8VA 2MANA 3CUJA 3L4WA 1KCLA 1J0MA 1J0JA 1E0XA 5CLWA 4MNKA 4XZWA 1OD0A 2VX7A 5EBAA 3SUVA 1F9GA 1HM2A 2G3NA 1DTUA 1P6WA 1EA9C 4GZEA 4PTWA 3UG3A 2DT2A 2WM0A 1HVXA 1JAEA 1RWHA 2WMIA 1GNXA 1HKKA 1J0HA 1CGTA 1W2PA 4R5EA 2Y8KA 3OGVA 4J3VA 3M07A 4CCEA 1XD0A 4CD5A 5JIWA 4TTGA 3ZOAA 1E6QM 2D22A 4HP5A 3I3EA 5A8PA 3VO0A 1CLXA 1V0KA 3TP4A 5JBFA 4LGXA 4ZFMA 2XSAA 5A94A 3VILA 4BQ4A 4E8DA 4AZCA 3ARXA 1DP0A 1J01A 3HN3A 3WNLA 3GTNA 3VM5A 2V5CA 1UWUA 1E6XM 1GVYA 3B9EA 4M29A 5GNZA 1BYBA 3W53A 3ZMRA 5CLTA 1DEDA 2UY4A 1HP4A 1PIGA 4HPGA 4JIEA 2OLHA 4D1JA 5D9PA 1UH2A 3VNZA 6TAAA 4J7RA 3AXHA 1CTNA 2XFRA 4UQBA 1KR0A 3ARQA 1WDQA 2ZX8A 3OZOA 1WDRA 2J4GA 1QI5A 1TVNA 3CHCA 4GI9A 4Q22A 4AZ5A 4IM4A 3UETA 4KGLA 4HA4A 3FAXA 3ZJ8A 2V3DA 4D6HA 1TFVA 1XYFA 3S2CA 3PTMA 5HPCA 3F5LA 1C7TA 3WD3A 1B2YA 2WZEA 1E4MM 1J0KA 4L4OA 2WBKA 3SCOA 1JI2A 5A6BA 2E4TA 4NI3A 4JL1A 1R87A 1QHPA 1B1YA 1UD2A 2YL6A 5ABFA 2PC8A 3CZKA 1LQ0A 1HKIA 1NWSA 4OJYA 1PEZA 4W86A 4CCDA 1CLVA 3VD4A 2WK2A 1W3YA 3N11A 3WDIA 3NIYA 1UR8A 4NF7A 3DHPA 5F7UA 3MSDA 4UQ9A 2VQUA 3NDYA 5I79A 3AZRA 1BAGA 3T0AA 1I1WA 2Z1KA 1V02A 5FCZA 3DYPA 5BCAA 1W9VA 4QAWA 4RE2A 5KZ6A 4AD0A 1LL7A 4OOUA 4U3AA 1KQZA 1QBAA 2YKKA 5M17A 4DWSB 1QHOA 4UFKA 3WH5A 2EPMX 1CGWA 3UR8A 3ZJ6A 4C7GA 2XJ7A 3ZR6A 2F8QA 4TVDA 1CDGA 2J7EA 4GINA 2RGMA 3BH4A 4B3LA 3UG4A 4J3UA 3RM9A 3WDHA 2JFEX 4HMDA 1G94A 3AS0A 2WMHA 3AIQA 2BRVX 1EGUA 5LA1A 3VDAA 1B30A 2J74A 1OB0A 2QLYA 2OSYA 2CCRA 2CESA 2YA2A 4JAWA 2D3LA 2FGLA 2BXZA 1OD8A 1OIMA 2FH8A 1HVQA 3BC9A 4BS0A 4HZ8A 4J3TA 4PMRA 1CEOA 2ZUNA 3F4VA 1UA7A 3A47A 3EDDA 5I6SA 1CXIA 4BA0A 3EMQA 2W5FA 2DDXA 3AMLA 1JFHA 2DGAA 2IUZA 2XHYA 1N82A 1NP0A 4HTYA 2ZE0A 1C3FA 2J47A 3BAYA 3IJ8A 1FHLA 1WE5A 1UKSA 3VGDA 1EIBA 2ZUWA 2J77A 1NWUA 3CLWA 2Z1SA 3WQ8A 4X0NA 1ZBCA 1JZ4A 5FKYA 2ZX6A 1VENA 3WNNA 1E4IA 3CTTA 1FFQA 3U5UA 3OA5A 3AIEA 2BFGA 5DEZA 3VIOA 5M5DA 3KL3A 3WUEA 3O9NA 2OYKA 3MUY1 2JIEA 1B3YA 5GPRA 1BPLB 1R8LA 3KL5A 4PBGA 3OIHA 1SR0A 4MB1A 2ZUMA 1QW8A 1UUQA 5M3WA 1QOXA 5CG0A 3AS1A 3OBAA 4GO9A 4Z2LA 2PF0A 2PBOA 1LOHA 3WH7A 3MKKA 5D9NA 3CZGA 2VCBA 2PBGA 3WNOA 5IHSA 3VIIA 2D0FA 3FW6A 2GJXB 1UWRA 5E6ZA 2JALA 2BVYA 2YA0A 2ZUVA 1UD6A 4BQ3A 1VFUA 1UZ4A 3TTOA 2AAAA 4LQ1A 1UYQA 4GQRA 1N7RA 1RWCA 3WF0A 2CPUA 3ARRA 4FLRA 4U2ZA 4CD7A 4FLOA 3WMBA 2D23A 1WKYA 3OLDA 5FIPA 2XGIA 4WSJA 2WC7A 1M04A 3D5HA 4V27A 4AZ6A 3MMDA 4HMEA 8A3HA 1GJWA 5A6LA 1Z32X 2D20A 1SMAA 3NSNA 3QHNA 4CU7A 2E40A 1UD5A 1W2VA 2J7BA 4AZBA 3PZOA 4TX6A 2C7FA 4E2OA 3I3DA 4PMOA 3VTRA 1J0NA 5CGMA 1EOMA 1FH8A 8CGTA 4F9DA 2ZUTA 4PEEA 1US2A 4D71A 2AMGA 2E9MA 2XYLA 3ZO9A 3IAPA 2WCSA 3VD7A 1OT1A 2X2YA 4P7RA 5DT5A 3TA9A 4A3YA 1ZBKA 1O6IA 3GM8A 2WPGA 1BLIA 5AY7A 3FAWA 3RJYA 1BG4A 2D0HA 1XSJA 4JHZA 1E6ZA 3SCPA 1FHDA 1LG1A 3VGBA 1HMUA 2O9TA 4PTVA 4U5KA 3JUGA 2WMIB 4ATDA 5CSYA 1HKJA 1SYTA 2YBTA 4IPNB 3AMCA 4JKMA 2ZX7A 5BRPA 4UFLA 1FP8A 4S3JA 4UZSA 1ECEA 1X6LA 1GQIA 2V3GA 3WEZA 3SEPA 1DWIM 3BMVA 3EMCA 2YBUA 2OWXA 3N9KA 4UQAA 4AZCB 1ISYA 3S6TA 2NW0A 3EBVA 3IANA 4JKLA 1H5VA 1KXVA 4CN1A 2G3IA 4TOQA 1NOFA 5JBEA 1WZKA 3ARZA 1IT0A 2QV4A 1F1SA 3OZPA 1QNOA 5E0FA 3I3BA 1JL8A 1BVNP 4FLQA 2X09A 4N42A 3VIPA 1B3ZA 1L8NA 1D3CA 5DT7A 1I75A 3W6MA 1MW1A 1UR2A 1JXJA 4HZ7A 4QLKA 1MQRA 3WDRA 2ZXBA 1U30A 1EO5A 4LYRA 4W88A 1L0PA 2AOSA 2BVTA 1VEMA 1CB8A 3QOMA 3EDJA 2CBIA 2W91A 2YJQA 2VR5A 4UCFA 3VIHA 3WL1A 4AC1X 4CVUA 4AZ7A 5HXMA 3K1DA 1IZJA 2UY3A 5EFDA 3ARVA 2WSPA 3NDZA 1NOUA 5IDIA 4TUFA 3WF2A 1E9LA 3OB8A 1K9TA 1B0IA 1CIUA 4W5UA 3WD4A 5A3HA 5ABFB 4MNJA 1EQCA 2WYSA 1CXHA 1XRVA 3CBWA 1W9BM 2VL4A 4OKDA 1HJSA 2GDVA 2V3EA 5AC4A 1G0CA 3ARWA 3SIMA 3VGFA 1BF2A 3THCA 2GFTA 3KE0A 1UOKA 2J75A 2VCAA 3MUAA 3VINA 2W63A 4KRUA 1E15A 3AS2A 1ISWA 1FA2A 2E0PA 3T2QA 2D0GA 1W3JA 3WMCA 1EDGA 5GNXA 2XTKA 3WNMA 2JIWA 3SCNA 1LWJA 3W24A 2WHJA 1NM9A 1KXHA 4PCSA 3SCSA 2W67A 1VFMA 3THDA 2OSXA 2VVSA 2C8NA 4F79A 3IK2A 4BF7A 1GVIA 2J7GA 3ZT7A 4UQDA 2YL9A 2DPEA 2JF7A 3WD2A 3WFLA 5FL1A 4LX4A 5CGTA 5A2CA 1UWQA 3AIVA 1PPIA 3AZTA 1V0MA 5DMYA 2DIEA 2VUYA 4B16A 5A6KA 5JUVA 1F4AA 2WNWA 3O6AA 4H8HA 3RILA 2YDSA 5FD0A 1R7OA 4H2CA 1DWFM 1AVAA 1HN1A 1DHKA 4KWUA 5ABGA 1JFXA 1GOIA 3GDBA 1UG6A 5DFAA 2E8ZA 4UOZA 2ZXDA 2G41A 3OLIA 2EBNA 3PZQA 1XV8A 5A8QA 3FHAA 3W38A 3MSGA 3VGHA 4AD5A 1JYWA 2ZICA 2VT0A 2W4XA 2Y24A 1NQ6A 4NSBA 5JBDA 3CZEA 1JAKA 1JZ3A 3ZQ9A 2VOTA 2WMFA 2XUCA 1VJSA 1TZ7A 2VVNA 4OUEA 3CMJA 2XFYA 4J28A 2BNJA 2QMKA 3G6LA 1HJWA 2BY3A 4FK9A 3UERA 4J3WA 4DM2A 4UR9A 3L2MA 3VM7A 5A6AA 4M1RA 1B3XA 5I2UA 4WJXA 1UR9A 4P8WA 2FDMA 2HVMA 4M82A 1BG9A 3WSUA 3WQ6A 1LLOA 4QCEA 4HU8A 5LA0A 2A3EA 1QVBA 1LF1A 2VJXA 5D8WA 1IV8A 1EGZA 4D6CA 3J7HA 2XWEA 3UG5A 4ZENA 4AZHA 1WPCA 3ARTA 5KEZA 7TAAA 1EXPA 4FF5A 1JZ7A 2BRWA 1V02E 1ISXA 4PMYA 1U33A 1HX0A 2YIHA 1BGGA 4CN4A 4AIOA 3PZNA 5LYRA 4AEEA 1GUVA 1JNEA 2VX6A 1MFVA 4A4AA 3AHZA 3A3HA 1K9DA 3NCOA 1PX3A 1MXDA 1VBUA 2WMGA 2YOCA 1M53A 3DC0A 1TA3A 4V2XA 2G3MA 3SCUA 3K8MA 4KGJA 5A95A 4CU6A 3FY1A 2XVPA 3RM8A 2CIPA 2WHKA 3QHMA 3WY1A 3W82A 2XVGA 3AIRA 1EDQA 4PYSA 2Y5EA 3AI0A 1LXMA 3WUBA 1W9XA 1ZJBA 1CENA 1WZAA 2RGLA 2BS9A 3A4XA 5C8BB 4WK9A 4JZ5A 2YDQA 5EMYA 1UR0A 1H41A 2EEXA 4W84A 2YL5A 2G8ZA 1UKOA 2DSUA 1EHNA 1VEPA 3PBGA 1KXTA 4JL2A 3PZGA 2PB1A 1W1VA 2YLLA 4M81A 4P7OA 3W81A 3VOCA 4EE9A 4D6EA 4CVWA 1VF8A 4BCEA 1NWTA 4MDPA 3PHAA 1OGBA 1E73M 1XGZA 4N0RA 3GXDA 4HA1A 5I77A 3FXYA 4GPNA 1JIBA 1MQPA 2VR4A 2A3CA 2Q8XA 1OBAA 4QFUA 1HJUA 3ARSA 4AXNA 1OIFA 1RP8A 4EK7A 2VTFA 3WDQA 3SCVA 4D6JA 3OGRA 1GOKA 4H41A 4NRSA 4U33A 3CMGA 2BRPA 3ALGA 3FNDA 4TVCA 3ARUA 3W28A 1MFUA 1AQMA 5HDRA 3F5KA 5IFTA 3VUPA 4PMUA 1H0IA 1ZBVA 1M7XA 1JF5A 3PZIA 4DM1A 3EYPA 5A2BA 1GOMA 2YLAA 3NSMA 1HL8A 3EDKA 2WSKA 2Y8VA 4F66A 1QNRA 3TONA 1U2YA 7A3HA 3RO8A 4PUDA 2WKLA 2V3FA 1J0IA 3IAQA 2J7HA 4UQEA 4MTVA 2IXUA 4MB5A 1N7QA 4MNLA 4OZOA 3SCTA 3AFBA 3OLGA 1I1XA 1LG2A 1OJNA 3M7SA 1GW1A 2WCGA 1W1PA 1EQPA 1MW2A 1E43A 1TE1A 3ECQA 1H2JA 1JG9A 3T2PA 3ZIZA 3GBEA 2WAGA 3U7BA 6A3HA 4LPCA 1OT2A 1Q4NX 4P7LA 1Q6FA 4Y7EA 2ZWZA 3AXXA 2VO5A 2ESCA 3WUFA 3AMKA 2GSJA 5CSUA 1BQCA 2VZUA 2VX5A 3GXIA 3T09A 2BHUA 5A69A 1WDSA 1OJPA 1X1JA 1GZJA 3AYSA 2V38A 1AQHA 1KGWA 1C82A 1J11A 2W62A 1CWYA 2F61A 4YHEA 4D6GA 1BYAA 3ARPA 1V3HA 3ALFA 4AIUA 3B8SA 4HOZA 2D2OA 3UCQA 1V0NA 3MANA 1UD8A 1JD7A 3CUGA 1UD3A 4PMVA 4TX8A 4ACZA 2E9BA 3MMWA 1C8YA 3GZAA 1BVZA 5ABEA 5I23A 2XG9A 3MS8A 3UR7A 5A8NA 2ZX5A 4AMCA 1GQKA 2WC3A 2E3ZA 5HOSA 3K4AA 1M01A 1W1TA 5IHRA 3MUZ1 1E0WA 1PBGA 5A6SA 1E1FA 1KWKA 2JF6A 4LXFA 3E1F1 2A3HA 3SCWA 1MXGA 2WLZA 1V6VA 2XVKA 3K46A 2OWWA 2CYGA 2W66A 1QI2A 3WQVA 4MB4A 3CHFA 1H11A 2F2HA 2WWDA 2VMFA 3RM4A 1QBBA 5C70A 3T0DA 3N1AA 1KBKA 1ZS2A 1W3LA 4CKQA 1MYRA 1VFFA 3WENA 3VIFA 1N7OA 3W29A 1HIZA 3VIJA 1NH6A
chains in the Genus database with same CATH superfamily
2QCMA 3QYQA 2WVTA 2PDWA 5ECVA 4MSSA 2FVLA 2VRJA 1Q6GA 4AD2A 3VE7A 4AF0B 3MYPA 1TVPA 3W37A 3M41A 4DO6A 3TTQA 1GOWA 1ME9A 3BG9A 2XGZA 2YW3A 1V08A 2GGJA 2IXVA 3W71A 3HPAA 4YHGA 4HNVA 1OJMA 2HQAA 4HU0A 4LB3A 2HISA 3T8LA 1U83A 4L9YA 1ZLPA 4US5A 1QR7A 2X0SA 4WY0A 1P1MA 1TUFA 4MY8A 1OFPA 3GIPA 1EWEA 1UZ1A 2Y7GA 4CQAA 3LLFA 3R5EA 3E2SA 5A6MA 4JIHA 1V03A 3T8QA 1O0SA 1P0NA 4LS1A 3S5NA 2CC0A 4KWSA 3MW7A 4Z2IA 3B97A 2PMQA 1NOWA 4DUXA 4XD4A 1R38A 4MZ8A 1XLIA 3S42A 3CT2A 1ML1A 3H8AA 3E02A 4ZE5A 1A3HA 3FLUA 1OFOA 1XICA 3HGJA 1JYXA 1JPKA 3HFTA 1A5UA 4U4MA 3N17A 5HNRA 3BLKA 8TIMA 1UWIA 3H2MA 5CBJA 1W1A1 3C2EA 5G1MA 4ZVJA 2Y4SA 1F9CA 3REQB 4QROA 4AY7A 3Q67A 2C16A 5FF0A 5MHBA 5DY3A 2J7DA 3LDVA 2OGYA 3E6EA 3JRKA 3CPUA 5CXPA 2J79A 2XSXA 3UEQA 4XAGA 3TFCA 1O68A 2Y89A 3QHOA 4E38A 1XCWA 3A9BA 1EDTA 1EB3A 1ZJAA 3AHYA 5CEWA 3F7JA 3M4HA 2D69A 1JYNA 2VZVA 3SN0A 4NASA 2CHOA 3BLDA 3KOFA 2GQ9A 2ALDA 4C6NA 3ZLHA 5FF2A 1SO4A 3LCGA 1C9WA 3T78A 3N14A 3W86A 3HPXA 2WVVA 3NYDA 4J3XA 3W6LA 3ID7A 1ICSA 2DIJA 4J3SA 3GBDA 2Z1WA 1FWWA 3QYSA 1FWHC 1FH7A 1E5NA 3UR2A 4JQ3A 4UXDA 3UU0A 1YPXA 3LSBA 1OGGA 2B7QA 4LFYA 1W9DM 2NUWA 1OFEA 1ZP4A 3EKGA 4LUTA 4B15A 4C91A 4E3VA 2ZCGA 4ZQNA 3AWOA 1X38A 2WDAA 3V35A 1UJPA 2OZ3A 3AHTA 3GNRA 5TQLA 3ITYA 4MUZA 1FWBC 2PC4A 1DJZA 1HF6A 3T6CA 4RNFA 1XJBA 1QPKA 3AICA 1FWNA 4IL0A 1NU5A 4LAOA 6XIMA 1KGUA 4S3BA 5CAKA 3QBUA 2DSZA 1G67A 1O5RA 4PUJA 1RWGA 1G9HA 2PDGA 4XD6A 2QVHA 3CPGA 4UFJA 1YMYA 2CLOA 1J9YA 3I6RA 2QEZA 1UH4A 4QE1A 1R7AA 2ATSA 3TTYA 2G4FA 3M0ZA 4PB3A 2NVDA 2BOFX 1DORA 2Y5JA 1FUYA 1H51A 1GVEA 3KDOA 4GO8A 3DCPA 2O4QA 1CX9A 1QI4A 4HPNA 2WW5A 1H1NA 2WJDA 3T0BA 3VDCA 2VXNA 1W1YA 2V2CA 1OINA 2A79A 3W1RA 4NXSA 1OSEA 4D8AA 2GK1A 2NWRA 3I7RA 1TWZA 2ZTJA 3WQEA 1JGIA 1GZGA 3P7YA 3OP2A 1MW3A 2XFWA 1WB0A 1IXNA 4LC8A 5CPQA 3C0JA 4A3RA 3GVGA 1H49A 2NLYA 3WDPP 2EPNA 1XLFA 1JPMA 1WQ5A 4N6EA 1T41A 1EH9A 3A4JA 3WF3A 3A12A 1FDZA 2J7CA 3H24A 3D3FA 1OCQA 2VEMA 4O13A 3CUZA 4WX2A 4ZQOA 4GX9A 1K8XA 2PWFA 3TUUA 1VFOA 3S4TA 2G3JA 4LS0A 1LUCB 3C2VA 2Y1HA 5A6TC 4ML4A 3FJ6A 1B3VA 5LNUA 3URAA 2E77A 1FWAC 2DP3A 2H6RA 4W7VA 3AQUA 3DG6A 2GQ3A 3P74A 2YCLA 2XWDA 3U2EA 4YPJA 4JTAA 3TSMA 4C90A 5J5DA 2WBGA 3WMSA 3E5PA 4XQ6A 4A22A 1FWRA 3RF9A 1EZ2A 3BGAA 2HNEA 3RYSA 2WVUA 1IZKA 4ROPA 3CLMA 3C3NA 3TAKA 4AZGA 2X0HA 4YTUA 4GVIA 2OCZA 3BAWA 1UWTA 1QOQA 3MSYA 1O60A 3QR3A 4YYFA 2NUXA 1UW9A 6PTDA 1N8WA 1Q7QA 3GYCA 2XGBA 2QGHA 2Z2AA 4ERGA 3BPWA 4WY0B 4O1DA 2V9DA 3SRFA 4D1IA 4QEHA 3ZXWA 1OYBA 3GWQA 3AAMA 4K1GA 1CGVA 4KERA 1ZUAX 3DI0A 4H9MA 4QNWA 1TVLA 4L1WA 3GFYA 4KF1A 4Q8WA 1AD1A 4OVXA 3NL6A 1RUSA 3MUXA 1O1ZA 2C0HA 3WK3A 3GLCA 2BOGX 3RCNA 4S3KA 3AXKA 3F4DA 3CQIA 1XUZA 2DZXA 2Y2WA 4O0QA 1CNVA 4H7VA 3NGFA 3VD5A 3APYA 4LNYA 1UC4A 3MUCA 1ITUA 4OBRA 2CKSA 1W5NA 3WQ4A 5DMNA 1LRTA 2EF9A 4S3FA 2WM1A 1AW1A 2ZZ4A 3M16A 1H1YA 3T4WA 3WQ5A 3TNOA 4UFHA 3QRHA 5LIYX 3AHXA 3KZPA 3RX2A 3SJ3A 4EKJA 4E8GA 2G4JA 4BI5A 5CC6A 4GI8A 4H4IA 4M1BA 3UZ5A 1JD9A 4JEQA 1VYSX 4WSKA 1TMQA 4DPPA 1EL3A 2KX9A 4OT7A 6CGTA 5A8MA 4MWAC 4AH7A 1O66A 1Q8JA 2WVVB 1SM9A 1VYRA 4PMZA 3LQLA 2HSAA 4HKPA 1WKEA 1AW2A 5CQ1A 3WJSA 2BTMA 4CNTA 3S47A 1LQAA 5FSDC 1S1RA 1GKPA 3RLHA 2YDRA 3FDKA 4R7JA 3WF4A 5LA2A 4S1FA 3PG8A 5EB8A 4JNYA 3H26A 2WCOA 2O55A 5AYIA 1ITQA 4WIWA 4Y6GA 3H2EA 3C5QA 3O6CA 2QDHA 4AW7A 2W3ZA 1J10A 1H60A 1RQBA 1FWFC 4GZJA 4JQ1A 4LUTB 5IFPA 3OBEA 3WLMA 3CMFA 1I9CB 1XH2A 3I68A 1NY1A 4XX6A 1HN0A 3NURA 7XIMA 2BHYA 2GGGA 4IQEA 2NQZA 5HJXA 4AWEA 1P1XA 3QPYA 2QHAA 2VC6A 3GD6A 2Z28A 4GZ7A 4ATWA 4L6HA 2GWGA 4JIQA 3IUDA 5A2AA 4PSPA 4IPJA 1RH9A 3P84A 4JIPA 2VFFA 4HA0A 1AQ0A 3N2TA 3BUVA 2VI0A 3MO7A 2C0AA 3VNYA 4WKHA 4KETA 1LL4A 3QQWA 2Q6ZA 1REQA 4M7SA 1GG0A 1XIDA 1V3KA 2QYGA 3TE9A 2BY0A 4U5IA 1V3JA 1LTDA 5CZKA 2DSWA 3LM7A 4F2TA 3RCMA 3OO2A 1JUKA 1BTCA 1FQ0A 4CU8A 4LVGA 4O52A 3KVJA 4PMQA 3L68A 3B8DA 3QW4B 3OU8A 3WLRA 1K9EA 3UZZA 4X9YA 3CV6A 4L4MA 1QO2A 4N4PA 3CAQA 2GK1B 4KEZA 1PIFA 3FJNA 3T1GA 1JCJA 2WVSA 4YTTA 1EC9A 4OFCA 3HMJG 3I6TA 3LD5A 3LGDA 4GJJA 3LXAA 2YFOA 4O17A 1YTEA 3AYTA 4R27A 2RFGA 4X60A 3QMTA 4IX2A 1W91A 3CO4A 3VD3A 4B4FA 4AIEA 2OX4A 2YL8A 1PX8A 5G2IA 1SJAA 1XH1A 3FJ4A 3SCQA 4GVHA 1QHZA 3CS2A 2H8XA 4DJFD 2Y6ZA 2TYSA 4WKAA 2JKPA 1H61A 2DVTA 4IICA 1YX1A 2YCLB 4J40A 4M0XA 4JFTA 1TCMA 2HPMA 3TC3A 3FA4A 1DXIA 2O7SA 5JMUA 4AQLA 2XIMA 9RUBA 4N6FA 3N12A 5HMSA 3S3GA 1NTHA 4XV0A 1BXCA 1T8QA 2XH4A 4MG4A 5KZEA 1F5ZA 1R30A 1EHAA 3IGSA 1AODA 3UXKA 3BW2A 1RBLA 3K13A 4FF7A 4W5ZA 1F3EA 1HUVA 1EOKA 2GDUA 2FPVA 3TN5A 4GI4A 1FCBA 4Q4MA 4GXPA 2RHGA 3ABZA 1X1HA 4A8LA 1UR1A 5I3JA 1YDOA 1TG7A 1VFLA 3DERA 1UKQA 3PTKA 5HAOA 3N2MA 3GHUA 4V1XA 1ODZA 2ZYFA 4CCCA 1GONA 2BG5A 4Q8TA 1HT6A 4GJIA 4NNCA 2H3BA 4LVBA 1ZENA 5I78A 2WKGA 3GH4A 2FGZA 4JFVA 1YE6A 1W8SA 1JF6A 3ZWTA 1DTNA 3HPZA 2IPGA 3HQPA 4S3DA 4G1NA 3GIYA 1Z48A 1XLGA 3WQFA 5FACA 4E4PA 4GQQA 3AU2A 4DJED 2PA6A 3U2ZA 4MAVA 2A3BA 3WEMA 2VCCA 4IUGA 1SO3A 4BJHA 3LYEA 1TR9A 3TR9A 4MHBA 3VYLA 4ZEPA 3OVGA 1AJ0A 4EANA 3H2OA 3GYEA 1ZJIA 3NFUA 4S38A 2DEPA 3UYCA 3W7KA 9CGTA 4RDZA 1UKPA 1WCGA 3R4IA 2GQ8A 1TQXA 3STPA 4Q4RA 3DX5A 1SFSA 2BHZA 4WXZA 1Z44A 4ZXLA 2GJPA 4XG1A 4PUUA 5BNKA 2GVYA 2VWTA 1LRNA 3BCFA 4DBUA 3LV5A 1C93A 1FWTA 3KZSA 1FH9A 3NUKA 3RRAA 3AXIA 2C18A 2VURA 3MHFA 3FX4A 4RDVA 3CWOX 2GVJA 2DJLA 1KM5A 2XN1A 4GIEA 3R79A 3VKCA 5C54A 2XN0A 1OY0A 3BZGA 1S5MA 4MNKA 4GYFA 4XZWA 4G7EA 3MCNA 1HM2A 2G3NA 1P6WA 1EA9C 4H8NA 3H4GA 3R6IA 2DT2A 5GJPA 1TTIA 2ISWA 2XZ7A 1TJ2A 1XPGA 3CQKA 4R5EA 1A5KC 1VP5A 4J3VA 3M07A 4JR5A 3EOOA 1XD0A 4Y90A 5F1VA 4B4HA 4ZFMA 3F4CA 5A94A 1CCWB 4BQ4A 4UB9A 2JGYA 4AZCA 1H7WA 4Y8EA 3WNLA 1LBFA 2GVGA 3GTNA 3IJLA 4DB7A 1GVYA 1QXLA 5SWUA 1NFPA 1TPVA 3W53A 3ZMRA 5CLTA 4JTIA 1DEDA 1W37A 2UY4A 4DF0A 1PIGA 4JIEA 1XYMA 1REQB 1UH2A 1KR0A 4JQ4A 1WDQA 4X63A 4S23A 3UNDA 1QI5A 3BCJA 4AZ5A 4LUJA 3QFWA 4KGLA 5AZ1A 4L9ZA 3SN4A 3RMJA 3NZGA 4DIAA 4H6RA 5HJLA 5AC6A 1C7TA 5EGRA 3IVUA 1B2YA 3TDFA 1EJTC 1YRRA 3M0MA 1JI2A 3H54A 1R87A 5C5YA 1B1YA 2PC8A 2E28A 3CZKA 1LQ0A 3VD4A 2WK2A 1XG4A 4I7UA 4QG9A 4IZGA 3WDIA 5FJOA 2YXGA 4NJKA 3PS7A 5F7UA 1XRSA 2YXXA 4DJFA 1W0MA 2DIKA 3DFPA 1V02A 1I2PA 3I6EA 5FCZA 5C9XA 1K02A 1IGSA 3DN5A 5C2XA 4GNVA 5AC8A 2HV5A 3G1AA 1JPHA 1QBAA 5M17A 1LBMA 1PYMA 1CGWA 1ME7A 4FAMA 3R0UA 2XJ7A 3BTNA 2J7EA 3C86A 2JFEX 1EZWA 1G94A 2QUMA 3AS0A 3GAYA 4XD5A 4LEQA 2OQYA 3L9CA 1EGUA 3WBYA 1XDLA 4L61A 3PPFA 1OC7A 4NVTA 3NL5A 2QLYA 3DFTA 2D3LA 3QH2A 1XM3A 2J24A 2FGLA 3LHYA 2BXZA 1X98A 2OTDA 2XH2A 3QPEA 3NO3A 1X8FA 1R2TA 5KINA 2QIWA 2P53A 3AWNA 4UTTC 4PMRA 1CEOA 1UA7A 3A47A 1EBGA 3UWWA 1UIPA 4BA0A 4H83A 1HO4A 2AKZA 2DDXA 3AMLA 4JDYA 2WOQA 1XLLA 2IUZA 2XHYA 3G2GA 5D09A 1ZALA 2ZE0A 2J47A 4FIRA 3TYEA 1XXXA 3DBPA 1B4KA 1UP2A 1UKSA 2R94A 2BSLA 3NZ1A 4GY1A 1PUDA 4U28A 2J77A 3CLWA 3I4EA 1JUEA 4I7VA 1R6WA 1FFQA 2X16A 3STEA 3OA5A 4O4WA 3VIOA 4WOQA 3RRXA 5M5DA 3N9SA 3W76A 3BGGA 5GPRA 1BPLB 1R8LA 4F4RA 2PDKA 3S9IA 3LBOA 3W7CA 1LRQA 1NAL1 3OIHA 2ZUMA 5M3WA 3VDGA 1P6CA 2Y61A 3OBAA 2WNQA 4Z2LA 2F7FA 2PF0A 4GRSA 2PBOA 5EMMA 4IP5A 1PV8A 4N9EA 4O10A 1V51A 3THAA 2PBGA 5DCBA 5C7HA 3WNOA 1O4UA 4ZSUA 3VIIA 3FW6A 2W27A 5DN1A 1IWBA 1Z89A 5E6ZA 2QCFA 2BVYA 3BE7A 2ZRUA 3C6CA 1VFUA 3DUGA 2AAAA 4GQRA 1N7RA 4K38A 1RWCA 5C2GA 3O0KA 2CPUA 2GSEA 4RNJA 4U2ZA 3UXIA 2D23A 3OLDA 2XGIA 1EX5A 2WC7A 4NZ5A 4UTHA 3T81A 1M04A 3D5HA 1R9YA 4NXKA 3S1UA 1KM0A 4HJFA 3BJTA 4BR1A 5A6LA 5DXXA 3W72A 1XC4A 1SMAA 3QHNA 4CU7A 2BLEA 5BU6A 1JUBA 2CZFA 3I3DA 1F76A 1PDYA 4RPPA 1KD0A 5F1UA 1FWEC 1FXPA 2ZUTA 4PEEA 1US2A 1TPUA 3PNZA 4GUFA 2XYLA 3PUEA 4UCGA 2IQDA 3IAPA 3JZUA 3TA9A 4A3YA 5U7SA 1L6FA 1YE4A 3E9AA 4G7EB 1BG4A 3G1FA 4D2JA 3FOKA 1LG1A 2O9TA 4F0HA 3JUGA 4ATDA 3C8FA 4IPNB 4JKMA 3ORWA 1PXGA 7ENLA 3NQBA 1IT7A 3QZAA 3BMVA 3UT0A 3WQGA 1TWDA 3UR5A 1ZP3A 2YBUA 4XAPA 2GSHA 2OWXA 3ABSA 4AZCB 3QF0A 3S6TA 4CN1A 4RNHA 4TOQA 5GVJA 1ZHAA 5E0FA 2PTXA 3VIPA 1B3ZA 4LNCA 4DZIA 1OFRA 1TPB1 3EWZA 3W6YA 3FJLA 1EO5A 2QCDA 4LWWA 2VM8A 3S5OA 4LOCA 5FAGA 3GR7A 4KEVA 1VBHA 2W91A 2YJQA 1GTEA 4MYXA 4JICA 3UWZA 2FVKA 3K1DA 3ARVA 5EYWA 3B4UA 1I6NA 3OYZA 3BQ5A 4S3EA 3BJFA 1E9LA 1HO1A 4IIBA 1K9TA 3LZ5A 4L80A 1B0IA 4ERIA 1T40A 4CQ8A 3SAZA 1EQCA 4L5ZA 1ZTVA 2WYSA 4A3QA 5HR7A 2B0MA 2VFHA 2RAGA 3HFYA 1W9BM 2QCGA 3VOGA 5I3KA 3BLEA 1ADOA 3CWNA 3VGFA 3VNIA 1KRMA 4KRUA 5BOEA 3T2QA 3CL7A 3W3OA 2PLJA 1EDGA 2OKOA 3N29A 3O63A 3MZNA 2JIWA 3GG7A 3W24A 4GUIA 1KTBA 4FIQA 3R12A 4PCSA 4CNNA 2OSXA 2VVSA 3CAVA 1SO5A 4F79A 3IK2A 4BF7A 1TV5A 4C6DA 4UQDA 2NQLA 2XZ9A 5FJUA 3EKZA 1AL7A 1G7UA 3BW3A 5A8GA 3O6AA 5AECA 4H2CA 1AVAA 4N7QA 5ABGA 1KRBC 2OOGA 1GOIA 3GDBA 4G6CA 2OFJA 5DFAA 5LZLA 1N55A 3G0UA 1V79A 1XV8A 5A8QA 3MSGA 1DIDA 2O4MA 4M6UA 2OR2A 3M0YA 2EJAA 2ZICA 3A21A 1FDJA 4PR4A 1NQ6A 4NSBA 4JTFA 3CZEA 1S5WA 5BOFA 2V5KA 1JAKA 1JZ3A 3ZQ9A 1QPOA 2V0TA 1F07A 1VJSA 4NYYA 1TZ7A 1S2UA 3CMJA 3V18A 4J28A 2G97A 4UTMA 5G2HA 1TPDA 1S2CA 4NIRA 4FK9A 4UR9A 3GU1A 5REQA 5F2LA 5FF7A 5E93A 2C14A 2P50A 4P8WA 2INFA 2P3ZA 2Q3RA 1KBLA 1WBJA 3SQMA 4HMNA 2V8ZA 2ZKMX 4Q32A 3M0IA 4NZ1A 1OVDA 3V5FA 3RU6A 3SGGA 2E6YA 5LA0A 3BGJA 1MMFA 2GUBA 4D6CA 3G1XA 3PAOA 1BKHA 4RDWA 1P48A 3A13A 3W7PA 2H9AB 1KTCA 7TAAA 4L1GA 2BRWA 1V02E 5T9BG 3GDLA 2YIHA 1QWKA 3W1PA 1QASA 2VX6A 5DELA 2FTWA 2PTZA 3FS2A 4A4AA 3K1GA 1OABA 1UBSA 2GJNA 1MXDA 1DJWA 4Z1DA 3W7DA 4XTDA 3CEPA 2G3MA 3SCUA 1MEHA 3EOSA 3RM8A 4E3TA 3W82A 4IH3A 1EDQA 4PYSA 3MCOA 2OT0A 1ZJBA 3GR8A 5TBOA 5J5RA 4C1LA 3VE9A 3NQMA 2FQIA 3U9IA 4IMAA 2EEXA 2OZTA 1P0BA 2DSUA 1RLDA 2KZHA 1MRQA 4CNUA 4M81A 4EE9A 3NQEA 4G5DA 1MDLA 1VF8A 1NWTA 5FSEC 1SSGA 4I6KA 3VZXA 2P5NA 3TMLA 3CU2A 2XIOA 3W7NA 1RY0A 4TR9A 1QNVA 5IBXC 5I77A 3U2CA 2I7GA 4NNBA 3ZS4A 4QAIA 4IOTA 2A3CA 3JR2A 4GHRA 4M6VA 4ZOAA 3ARSA 1OIFA 5I07A 3WDQA 4D6JA 3BOFA 2OU4A 4U33A 3V7PA 3K4WA 3CMGA 3IJIA 1RQHA 3ARUA 3KOXA 4AX6A 4Q33A 5HDRA 3F5KA 3M44A 3KRUA 3IIPA 1UC5A 2AKMA 4ZQCA 4I9MA 3PZIA 3BANA 4FHAA 1W6TA 2ZRWA 1LQ2A 2ATMA 3OEXA 3VKBA 1QNRA 7A3HA 1KLZA 3PB2A 4F2BA 4R9XA 3QKZA 4IMGA 2V3FA 4RV8A 1E51A 2QJMA 1N7QA 4ORIA 3AFBA 1ZAIA 2E09A 1LG2A 1OJNA 2RDTA 1F8IA 3M7SA 4RZ6A 3LXBA 1E43A 2QCDB 3ECQA 2D2HA 2AQOA 1AMKA 1XLBA 3TWBA 4LPCA 2F2KA 1Q4NX 3MBFA 4Y7EA 1TIWA 3C56A 3VOIA 2PU1A 3CQJA 1RLCL 2VR2A 3AMKA 1XWYA 1PCWA 4BEUA 1BQCA 2PP0A 2VZUA 3LTPA 5A69A 1WDSA 5CAHA 1OJPA 4PTNA 1V6TA 1OCBA 3NQDA 1X7FA 4FOUA 2F61A 4Y9AA 3T55A 1BYAA 5I7GA 4PC8A 3EB3A 2G0WA 3OQEA 3MDWA 2D2OA 3LHUA 2HNHA 5D04C 5HMEA 4LCQA 4HNOA 3CUGA 1UD3A 4TX8A 3G18A 3PBYA 4CNSA 3MMWA 1XBVA 1C8YA 3NO5A 1SZNA 2BGSA 4MYAA 3DOPA 3W88A 4ADTA 3PQIA 5CJNA 1Y5XA 5A8NA 1TJ1A 2JK2A 1FKWA 1GQKA 4K8HA 5HOSA 4M7TA 4HK5A 5JH2A 2PE4A 4FX8A 2V82A 1KWKA 2EG7A 5CCZA 3UWUA 2AL2A 4JTJA 2WLZA 2XVKA 3AO0A 2VFGA 1BRLA 2W66A 2WWDA 3RM4A 5C70A 3N1AA 1W3LA 2AQVA 1Z8AA 2Z24A 4CKQA 1MYRA 1M68A 4PUWA 3M0VA 4KFOA 3VIFA 3W29A 1NH6A 1XIEA 3H21A 3WJXA 1US0A 3NVTA 3CHVA 4FNQA 4MZ1A 2XSBA 3BMWA 4IJBA 4EX4A 4HB7A 1BGAA 3T7VA 1FOBA 1J5SA 1PZ1A 3GU9A 1ZJHA 3VGGA 3E0FA 2ZZ7A 1NELA 1QW9A 2VFEA 3E0IA 1OYAA 4DHGA 2AMXA 3UWEA 2P76A 4G1KA 3WK0A 5DY2A 1RPKA 4O16A 1E6PA 3KL0A 1AJ2A 4DZ5A 2D1ZA 2F6UA 4CLMA 1JZ2A 2UV8G 4HPHA 3ZJKA 3UJ2A 3WQDA 1YTKA 3OOQA 3VIMA 1UH3A 2PTYA 5CJ5A 5REQB 1XCXA 1DWJM 2QF8A 3DFOA 4DAFA 4Z2HA 1WKFA 4JIIX 4GQ0A 4MDOA 3OTRA 1R47A 3VKAA 4AZIA 1U1HA 1BSIA 1LLZA 3OVQA 1J93A 4LBRA 1RBAA 2GGIA 4DI8A 1XIHA 2J62A 1R85A 2E24A 2OSWA 3W2NA 1SJDA 3WX7A 4DI9A 3RIKA 3GXFA 3ITTA 3RHGA 3PJXA 3NSXA 5D2VA 3FEMA 2A3AA 3TQKA 1TTQA 1PZ0A 1PJ9A 3G0XA 4QRNA 2R24A 4Q6JA 4E4UA 3OLEA 4TVUA 3ES7A 3QGVA 4C6PA 3O3RA 5LXXA 1PS9A 1K77A 4GJ1A 3GDTA 3HM7A 1TTJA 2X05A 4K1WA 2J7FA 3ATZA 3W7IA 3DYOA 3NVDA 1LT7A 4JOMA 4A3UA 2OGJA 4RZ5A 5D03A 3POHA 5J04A 4DBEA 5LHFA 3UFYA 3R0KA 3VMPA 1G4PA 4FPSA 1P6BA 5JVLA 4OV9A 4WDXA 5FA5A 2ZUSA 3ZSSA 2A6LA 3NM3A 1RJRA 5BRBA 4JTGA 3BMXA 4AYSA 1XL9A 5AYBA 1IWAA 3UWVA 3POCA 1SVDA 4CUCA 3DKLA 1H7OA 2VRKA 3K5XA 1E55A 1VLWA 3TYCA 1W1IE 2FHFA 3EX4A 1SQ7A 1XUUA 1MNSA 2VFIA 3KOYA 1PTAA 5HNTA 1J0ZA 4JTSA 1XKJA 2X8RA 2OG9A 3PZMA 1JZ5A 3URBA 3WNKA 1H63A 1P0DA 4L7ZA 2OO6A 3M1ZA 3T2OA 2AQWA 3VAVA 3WEOA 2HS6A 4D72A 1Q5MA 2Q01A 3GTFA 1LT8A 3WBAA 1CXLA 3GFXA 3PUGA 2V81A 4YTRA 2NX1A 3E0VA 4ZO7A 2OLSA 1R86A 4RLIA 5JIPA 3NQCA 3TYBA 5DLCA 1GOXA 1GG1A 3CGTA 2WQDA 1OEPA 3AYRA 3IJDA 3O15A 3EWWA 1C90A 1XG3A 4IG2B 3LXCA 4A8RA 1TIMA 3SFWA 3G1YA 4TMCA 1WZLA 4CGTA 1ICPA 2YGYA 4R88A 2PI6A 2VZKD 4TV6A 2BP1A 3P14A 4JHOA 3WF1A 1MDRA 3VIKA 2PRHA 1YIXA 3CV7A 1UZDA 4QJ1A 3SBFA 3OIXA 1D8WA 2X03A 3S5SA 1JRCA 2OQLA 3BAXA 3QV7A 2JKAA 4WZHA 2KXRA 1XYZA 3T08A 3VOJA 1V3IA 1Q85A 3NQ2A 1G6CA 3CB8A 3CH0A 5HBFA 2ZRYA 1EJUC 4W93A 3OG2A 1B9BA 4XUGA 4WF7A 2FGBA 4OBSA 4YWSA 1VRXA 3BZJA 4PN2A 2PWHA 5XIAA 4A3HA 4GE8A 1F6YA 1ZZMA 1M41A 4EACA 4UOQA 2QAPA 3SADA 4IGSA 4S3CA 3VMNA 3CO8A 5AHFA 1A4MA 3UPMA 1FX6A 1WBHA 1VD6A 3IVTA 1DIOA 1E3XA 1EPVA 2F6KA 2VZSA 4LW7A 1KM6A 3VX0A 2DFAA 2CLMA 5HPOA 4UQCA 4GNJA 1E6RA 5GNYA 1UUOA 4FMVA 4GCXA 3BXWA 4LC6A 3PZ9A 2AL2B 1DXFA 2BV9A 1BRLB 1C7SA 3MVIA 4GIAA 3TXZA 4Q8OA 4DWSD 2CW6A 1UQZA 2ZUUA 4DUVA 4OIFA 1NSJA 3VDHA 1JCXA 2YCKX 2ADAA 2P8CA 3GVVA 1E5JA 4O50A 3DBNA 3HU7A 1T5AA 3ZLGA 4NYUA 4PCPA 2GJRA 4W7WA 1N7NA 4W87A 3NPXA 3K8LA 2PGRA 3KXQA 3WLIA 3KCLA 3L2LA 4O1FA 1B3WA 2PAJA 1VQTA 1OG6A 2E1WA 4G7FA 1CGYA 2Z25A 1X6NA 1HKWA 1Z3NA 3OZYA 3TX9A 3E2RA 3QR1A 4RE3A 2WMKA 2E5CA 1FKXA 1RCOB 2H90A 3BSGA 2VRQA 5BRQA 3A4AA 4YIWA 4ZQPA 4KRTA 3V75A 3B0VC 4KT2A 3PWGA 1QNSA 1VCGA 2QDGA 2O92A 2Z2BA 3ISIX 2VZTA 4WGXA 3HQOA 3VIGA 3AOFA 4LANA 2WMJA 1CLKA 4D6DA 3PZVA 4FOJA 2E9LA 3BSHA 5HWMA 4TO8A 4OOZA 5CZTA 3LBCA 4AD4A 1O5KA 1OADA 2ACUA 4EPDC 1A4LA 1HJQA 1E3ZA 1JGMA 3TZFA 1MEWA 3ITLA 2UWFA 4KEMA 1L6SA 1US3A 4FLSA 4P5UA 3IJ7A 4HZ6A 3LM3A 3BLFA 2E22A 4O8RA 2PP3A 1SUXA 3EXTA 5GQBA 4JTKA 3PBUA 4DXVA 1U5HA 1UCWA 4IQDA 4HSNA 1CECA 3U4FA 1TRDA 3DHFA 1ESWA 1D7FA 1CGUA 1S2WA 3WELA 3CC1A 4YXGA 1BWVA 2JEQA 1TV4A 2DH2A 4HNUA 2FH6A 3AUOA 1M1BA 3E0LA 1K3UA 1CBGA 1OFBA 2BDQA 3BW4A 1KM3A 2P10A 3NDOA 4LAUA 3TZNA 3R8GA 3F5JA 2WHLA 3W74A 2FZ8A 1WZMA 5LNSA 4AD1A 1E9ZB 1P7TA 4L1XA 4E2DA 2A85A 1LDCA 2QIIA 3VX1A 1QDSA 2VKZG 3LNMA 2OEMA 4M6PA 2GGEA 2PLCA 1GORA 3MMTA 4UOJA 3AUJA 5C71A 3PBMA 2DT3A 4A35A 1VCFA 3VKKA 1EX1A 1S5TA 1CW2A 4AC7C 4RE4A 1YQ2A 1JDDA 3R58A 3QFEA 3ZSTA 4NT0A 2OWCA 5DQPA 3P82A 1VBGA 2X42A 2XIJA 3V0TA 2ZRZA 4E2BA 4DBDA 1A5CA 4NILA 4JX4A 2CBUA 1D2KA 3WN6A 2X1RA 3W1TA 4I9AA 1E40A 4OBTA 3NL3A 3NXFA 3VMOA 2Z2UA 4TU1A 2HPIA 4QNEA 2FKPA 3MC5A 1IIGA 2E68A 1TR1A 1H4PA 2ZOXA 2WSQA 4XVEA 4AEOA 3KBMA 3LCFA 5EMUA 3KTSA 3V16A 4C1NB 4K7YA 3B9AA 4M24A 2HROA 4HU3A 4UR7A 5AVNA 3LPGA 1PTGA 1Z9AA 2OVLA 3S2JA 4F9JA 4GH1A 1TX2A 1EUNA 4ML9A 4QQUA 1HGYA 1E0UA 1NARA 1PZ3A 3WKZA 3S5YA 2D3NA 4XIMA 4OE7A 1O7AA 3TWAA 3H6OA 4GOAA 1OGSA 1S5VA 5A6BD 3QGKC 3CHEA 3CH9A 2PTDA 3TC6A 1V6YA 3CHDA 3CPRA 3LUTA 2PP1A 3UJFA 2J8FA 1YXYA 4O12A 4XZBA 1JZ6A 1KTNA 1A5OC 4DWSA 3UVAA 1ZB5A 2W6RA 2P0OA 1SJBA 4AB4A 1V6WA 1YXDA 3QEZA 3B9DA 1MEIA 1J12A 4C7DA 1YYAA 3MA8A 4NRRA 2J8GA 1FFRA 3N9RA 4MJ2A 1E4NA 1TA3B 3MMUA 2F6XA 1GHSA 1RQEA 3W27A 4W4QA 3OA3A 3W26A 2WO5A 3V5CA 5BXRA 2J88A 4EP8C 4TXEA 3E74A 2VEKA 4GZIA 3L0KA 3BDKA 1HJXA 1HKMA 1LJYA 4WRHA 4ZBCA 3VGEA 3JS3A 4ATLA 1Y5WA 2PLMA 1OM0A 4R33A 4KQNA 3GVWA 3C2RA 3O06A 3TAOA 4CQBA 3GQYA 3V0UA 2X1SA 4AD3A 5JU6A 3HGSA 4DLMA 2ODOA 1NDZA 1XPYA 2BXYA 3B0UX 5HMFA 3WBEA 4FX7A 3GUWA 3QSTA 2VZOA 1QNPA 5B7YA 1L6WA 1TJ0A 3FA3A 2E6AA 1E6SM 4PGLA 5LGZA 4FSAA 5FJTA 5E6YA 4L65A 1C8XA 4AHOA 3FVDA 4PBEA 2DV0A 3RLGA 1JI1A 2WHMA 3UD6A 3VNJA 2ON3A 1EP1A 4B5SA 1DV7A 1JXKA 4BZYA 2B81A 4ECLA 3L2IA 1I45A 3AS3A 4MPQA 5C9RA 2O9PA 1TV3A 1P4CA 1TV8A 1RVGA 5LGXA 1SFLA 2QUVA 5HR6A 1VIWA 5B80A 3N04A 4QLJA 1TUXA 3GNOA 1E70M 2FZMA 2P1FA 3EOLA 5AVHA 5I24A 1A5AA 4L9XA 3EB2A 3N18A 3CIXA 4AISA 4U10A 4FA3A 2NXGA 3C52A 1W32A 1SZRA 1G01A 2C1GA 2FLIA 3XISA 1WNOA 1F3WA 1PYFA 1I8QA 2VC5A 3NPWA 4QDWA 3GUGA 3Q65A 2NQHA 1D3HA 5D9OA 3RMEA 3RXZA 1XH0A 5DX7A 2DSVA 3APGA 5AHNA 1F6KA 2GWNA 2YEPB 1EJ7L 1XLEA 1RCXB 1VKFA 4H8VA 2I9UA 3TK7A 1JQVA 3TN4A 1L9WA 4DPQA 1R2SA 3L4WA 1E0XA 5K7JA 1OD0A 2VX7A 4RUBA 4GLEA 3SUVA 4OU1A 1P7TB 1DTUA 4GZEA 2OEJA 1PKYA 3XINA 4UNKA 3VXGA 3W00A 2PDPA 1SZGA 1JAEA 3WQPA 3LCHA 2WMIA 4A05A 1W2PA 4JTDA 1VIZA 5TF0A 3OGVA 1DVJA 3H53A 4CD5A 3TKFA 3DZ1A 2GVEA 3MYOA 3ZOAA 1E6QM 3GK0A 3LG3A 1CLXA 1V0KA 4US5D 2NV9A 3UF9A 2NVCA 4HK6A 4IMCA 4PZVA 3R25A 2A5HA 5EBUA 4JYFA 3DESA 3CASA 2PWUA 3A9IA 4PEKA 2DUAA 3FEQA 1Z41A 4M29A 4DJFC 2BGNE 5GNZA 4CQDA 4XAZA 1HP4A 4YYCA 4IFRA 5AYXA 3G77A 1S39A 3ARQA 4HGXA 4GI9A 1VCVA 4HA4A 4S2CA 2CLFA 2HK1A 2V3DA 4D6HA 1WXZA 4JTRA 1J6OA 3S2CA 2ZADA 5FJPA 3F5LA 3WD3A 2FZDA 3KLKA 2WZEA 3QR8A 4L4OA 3ZLFA 5A6BA 1X1OA 2E4TA 4JL1A 2OLAA 2ACQA 1WXYA 3ANUA 3P67A 3EA3A 1W17A 3GTHA 4W86A 1O5QA 1I0DA 3U3HA 2HDJA 4K39A 4NY2A 3N11A 5CBBA 3NIYA 3DIPA 4H3DA 2C79A 3ZR4A 4DO4A 1TWWA 3NDYA 3T0AA 1GKQA 4QIUA 2Z1KA 3DYPA 2JBMA 2VFDA 1W9VA 4JHMA 8XIMA 1MXSA 3BLIA 4U3AA 3WLLA 4MKSA 4DWSB 3LCWA 3NPUA 4G56A 2EPMX 1TPWA 2FZNA 1YPIA 3R0DA 1F6PA 2IKHA 4GINA 2RGMA 4XSMA 1K70A 3UG4A 4DYEA 1LOSA 2HEJA 2FB3A 1JPDX 3G1RA 3RM9A 1A3XA 3WDHA 5AHLA 3C8NA 2WMHA 4DJEC 1JJKA 3AIQA 4XWUA 2VDHA 2OSYA 4ZODA 3KBWA 3D6NA 3HG4A 2O7QA 3LLXA 1XLAA 3HTWA 3B0XA 1OD8A 1D9EA 2YXOA 4FR1A 1HVQA 5LNWA 4HZ8A 4Q8NA 2OB3A 1Q6RA 5EKYA 5I6SA 3CAWA 2NV2A 3GU2A 1AA1B 1JFHA 3PPCA 4MLJA 3QXBA 3VC6A 1C3FA 3IJ8A 1FHLA 4BY3A 4GYPA 5IOBA 1NWUA 4X0NA 5FKYA 3LENA 5AYYA 3WNNA 3IWPA 3MCMA 4QS5A 3KRSA 3AIEA 2BFGA 1XLDA 3C61A 4LBUA 4QDPA 3CYJA 1MUWA 3O9NA 2OYKA 1IEVA 3MUY1 4PB5A 2PTWA 1JEZA 1J2BA 3L5AA 4GVGA 4JX6A 3E12A 4PBGA 4MB1A 3DG3A 4D8OA 1QOXA 3UD1A 5CG0A 3TCSA 3LB0A 3VC5A 2VP8A 4Y9PA 2F38A 1LOHA 1OK6A 4KIEA 5D9NA 3BK0A 3CZGA 3BLOA 5IHSA 3NWRA 1L2UA 2PCEA 2ZZ3A 2Z7GA 4HCLA 3L23A 1UWRA 2I9EA 3PG9A 2ZUVA 1AG1O 2QPXA 1HW6A 1IEXA 2C3ZA 3N2OA 3GDMA 4JEJA 4CQ9A 4FLOA 1OX4A 5DXYA 3WMBA 4DO7A 3NXLA 3RLVA 2J6XA 4WSJA 5CC5A 1YW1A 3PUOA 2D2GA 2H8ZA 4AZ6A 4KFNA 4HMEA 4JTTA 4YU1A 1GJWA 2ZVRA 3NSNA 5D30A 2Y8UA 3SI9A 2E6DA 4Q6XA 4RR4A 3P0XA 4AAJA 4I9JA 3THQA 3VTRA 5CGMA 1FH8A 1QO5A 4FI4A 1HKVA 4B5VA 8CGTA 3SM0A 3MKVA 1EEPA 1XGEA 2X2YA 3WLKX 4P7RA 5DT5A 4NZJA 4I6VA 4NHVA 3A5VA 1BLIA 1VJIA 3DHDA 3RJYA 2JGQA 4JHZA 1E6ZA 2B4GA 3SCPA 1FHDA 1OZQA 1A0DA 4U5KA 2WMIB 3SY8A 1SYTA 3AMCA 4Q8VA 2ZX7A 5BRPA 3SN1A 1WA3A 4UFLA 4UZSA 1X6LA 1XFBA 1QWGA 2XINA 5EMKA 1FHVA 1DJQA 3KUMA 1DWIM 1YPFA 1IE7C 1OZMA 1UR3M 4JKLA 3O16A 4KIRA 1KXVA 1TKKA 1NOFA 1IT0A 2J6VA 2QV4A 4PRRA 5H8MA 3B40A 4LRTA 1KCXA 3I3BA 3VABA 1DJXA 4CQCA 4N42A 1X8CA 1HG3A 2YB1A 1I75A 4X2PA 1UR2A 4H2HA 3Q4DA 3WDRA 4W88A 3EX1A 4JX5A 2ISVA 3STFA 1CB8A 3FSUA 4JS3A 3QOMA 3RAOA 3Q94A 2DZWA 2VR5A 4UCFA 2WZMA 1J6PA 3Q2DA 2IPJA 3EPNA 1NOUA 1R46A 3L0GA 4GACA 3RN6A 4AWSA 2FMOA 4TUFA 2DUXA 4ADUA 4WCJA 3G1VA 2IKGA 4W5UA 1JRBA 1L6YA 4Q8QA 1CXHA 1RAKA 3KLLA 5I09A 5MKGA 1HJSA 4LF2A 3MB9A 2V3EA 1VRDA 2PD5A 3ARWA 1XDJA 1KW1A 3THCA 1M7PA 4M6QA 2GFTA 1TTPA 2CU0A 1GJPA 3KE0A 3NQ8A 4Y9NA 1RJQA 1LROA 2NUYA 1W3JA 3WMCA 2XTKA 3CQ0A 1KM2A 4B2DD 4JQAA 4C6CA 2WHJA 1MZRA 3DC8A 1PDZA 1NM9A 3SCSA 1VFMA 4WY0F 4YTQA 2WZTA 3MDUA 1YLVA 3WYZA 4LSBA 1RALA 3GR4A 3ZT7A 5E9XA 3SSZA 3H4WA 3TYUA 3WD2A 3WFLA 3IGXA 4P61A 3W75A 3I7SA 2QGYA 1UWQA 4I5RA 4ZO6A 1PPIA 5DMYA 4PMJA 2VUYA 3TJIA 4MF4A 4WVXA 1OX6A 1TPC1 1KFKA 3RILA 2IQTA 3S1WA 4KPLA 1EJXC 4QJ5B 1DWFM 3BICA 1DHKA 4KWUA 3O07A 3MTWA 3W7RA 1EPXA 1FXQA 2E8ZA 1D3GA 2EBNA 3QY7A 3V3WA 3CT7A 3B04A 3AALA 3VNMA 3B9OA 4KCWA 1S5NA 1MNZA 4Z1CA 4MZYA 2I5GA 1JYWA 3W7OA 2ZE3A 2VT0A 2W4XA 3AC0A 2PPGA 4JDBA 2EPHA 2TODA 2XUCA 4Q8UA 3SY1A 3MZ2A 4ILSA 2A0NA 2QKFA 2BNJA 3TEVA 3W2UA 2VC7A 3EOUA 1HJWA 3KRBA 4LALA 2BY3A 4J3WA 1XBZA 4DM2A 3L2MA 5FEXA 5A6AA 4GNKB 2CLIA 3RPDA 3LZ3A 4ZCWA 3EOEA 3NZPA 4M82A 1VZWA 3F59A 1BG9A 3ZZ1A 3WSUA 4GX8A 1GTHA 3UXDA 4UTKA 3HBLA 3C2YA 2Y88A 1KBIA 5D38A 3WQ6A 5HNUA 3G1SA 5H91A 3UCDA 4E0CA 2A3EA 4QJ4B 1IV8A 1XQKA 2W79A 2Q02A 1TWSA 3R13A 2ZVIA 4AZHA 5KEZA 4YVPA 1U33A 1HX0A 1BGGA 3BG3A 2DZAA 1OYCA 1Q6LA 3T0TA 4AEEA 1XLCA 4GK8A 2CXEA 1W3NA 3B8UA 3NCOA 2YCIX 2XISA 2WMGA 3UPWA 1DJGA 4JNMA 1KO0A 3GKAA 3DC0A 3SGUA 4YCOA 2PODA 5KITA 1KFEA 3TA6A 1QW7A 3K8MA 4PA8A 5KMYA 4NNAA 3FY1A 5FAJA 2FFIA 4UMBA 3U4AA 3WY1A 4QE5A 2I5IA 3AIRA 1OX4B 2GUUA 1LXMA 3WUBA 3L5MA 5C8BB 2YDQA 2C6QA 5EMYA 3PSVA 3W22A 3FV9A 2YL5A 2PZ0A 1I2QA 1EHNA 1VEPA 1BEUA 4D9PA 2LLEA 2BZNA 4LUSA 2JQXA 4ZO8A 3R89A 3KP1A 4WDUA 3W81A 4IIGA 3QMRA 4LVAA 4CVWA 2PDQA 4BCEA 4PRTA 4ZOEA 3B4YA 4ONVA 4IFKA 1M65A 1H7RA 5HULA 3F4NA 4EK7A 2VTFA 3SCVA 4JTCA 4UMCA 3PR2A 5AYZA 1A5MC 4PODA 2E25A 1KLYA 3ZVHA 2CWXA 2VOMA 3UWYA 5H2ZA 3W28A 3H2CA 4KCTA 1GVQA 5F4SA 4HCDA 2C1IA 3U6WA 4C6QA 3SRHA 4N4QA 4I9TA 1ZBVA 2F9RA 3UA3A 6TIMA 3E96A 1DOSA 4DEFA 3NSMA 2Y0FA 5DBUA 2YFNA 3KRZA 3PAJA 2Y8VA 4F66A 3TONA 1FRBA 4HNLA 3DGBA 1Y5VA 4UQEA 4H9YA 4Y2WA 4MTVA 1BXNA 4FXFA 4EXQA 3W1UA 4OZOA 3LTSA 3SCTA 4IQLA 4MOZA 1S38A 3M0LA 3OLGA 2WCGA 1EQPA 1YKWA 3ITVA 2REQA 1MW2A 4OUIA 2C19A 1TE1A 3WLQA 3V36A 2PGWA 4QG8A 4IQJA 1YADA 1FWDC 1Q7MA 3EXSA 1GEQA 4BWLA 1OT2A 1MRAA 2VO5A 4ZSTA 3W1AA 3NQGA 2POZA 4TIMA 5J8LA 3GXIA 4XZIA 5CPLA 3T09A 2BHUA 1W5OA 1X1JA 1Q3NA 1GZJA 4B2DA 4O8AA 3USZA 2W62A 2DORA 1CWYA 4GY0A 3ARPA 1LP6A 5MKGB 3UWQA 4A29A 3GVRA 4I3GA 4KEUA 1UPMB 2PD9A 4GABA 1V93A 3UCQA 1EJWC 3GDRA 1V0NA 2EGZA 1RV8A 4QQ3A 4PMVA 4ACZA 2E9BA 2YSWA 2FJKA 4LAMA 3GZAA 4Z0JA 1BVZA 1I60A 2XG9A 1JULA 2HVNA 2XIQA 2WC3A 3WO8A 3N19B 1HGWA 1AJZA 5IHRA 1PBGA 1H62A 3COTA 1HL2A 4JD4A 2JF6A 1VPXA 4DRSA 2ONEA 4JIRA 1MXGA 1V6VA 1A3WA 4KKXA 1XQLA 2OWWA 2CYGA 1B5TA 3WQVA 3QQ1A 3E3HA 2Z7KA 1QBBA 2Y70A 3SO7A 4Q8PA 2GQAA 1KA9F 2OOFA 1VFFA 4Q4OA 3H7VA 4N9BA 3WMLA 3WQWA 3FA5A 4WR3A 3GHSA 3UZYA 2VGIA 4L4PA 1F3XA 3KVMA 4LRSA 1R3VA 1HM3A 3W25A 4GI6A 5FL0A 1NFBA 4MKNA 1CT5A 4GYJA 3ENLA 1YDNA 1ZFJA 1WUEA 1YBQA 4GC3A 3OHMB 2DT0A 4NUWA 3L5LA 3JVAA 3UJRA 2OZ8A 2QPUA 3G1HA 3FDGA 3EX6A 3LPPA 3PFRA 2W9MA 5ABHA 5AN7A 1UQYA 3BCDA 3RX3A 3GTIA 3EDEA 2YYUA 2V30A 3E38A 3LMYA 1ONXA 3ES8A 4PSRA 4DY1A 3MJMA 2C1HA 4RNIA 9XIAA 4AG0A 5M03A 1Y65A 3DENA 1RD6A 3NGJA 3CV2A 2E5BA 4F3HA 4H8UA 1DQXA 4CN6A 2XIBA 2EG6A 3TW9A 1L2QA 4CD6A 3MVTA 4PMNA 3LSCA 1NQKA 3P3BA 3LS9A 4YWIA 3FYPA 2FJUB 5RUBA 3W02A 4PMXA 1GJUA 3TOPA 5TNVA 3N3MA 3S5ZA 2V5BA 1EXBA 5LNRA 5BYWA 2QMJA 1EUAA 1Y8BA 5HMDA 3NM1A 1EF3A 4S39A 2FHBA 3DECA 4Z2KA 4B5UA 4MPKA 5A1AA 4UZUA 4JFWA 2EAWA 4Q4KA 3SZ8A 5T26A 4HN8A 2HXUA 3CIVA 1M5WA 2NQJA 3TROA 4LVDA 1XHGA 3M0XA 4LH8A 2PEVA 3WD0A 1P43A 3GNDA 2W61A 4L6DA 3OGSA 1DQWA 3ZR5A 3VNDA 4GUGA 4XZ9A 2D2JA 3W0KA 2CXGA 3P2VA 4LUSB 3R43A 1I8JA 4MB3A 2EKGA 2X0YA 2WQPA 3F2CA 3MV11 4L64A 2Q1FA 1K8CA 1W3TA 2DZTA 1X96A 5ECUA 5C9UA 4QCFA 5AZ0A 2J25A 3I7QA 1TWIA 4HPXA 4NQ1A 4IFKB 3PBVA 5KZDA 3SUWA 2R1NA 5KSWA 1JQXA 2V5LA 3VK5A 4NAFA 2QQ6A 1NF0A 3HPSA 3SFKA 5EMLA 1KB3A 1VHNA 4BF9A 5H1WA 4WLCA 3WDJA 1E9YB 3ZVHB 4DLFA 2NSOA 3B03A 3LRKA 1G1YA 5TIMA 4KESA 4AY1A 4JTHA 1M03A 3IPWA 4GIRA 4Q4QA 2I57A 3MHUA 1A80A 1FCVA 1UKTA 4HBKA 3AJXA 2ISDA 2J13A 3K8KA 1SU5A 4EXBA 4JFUA 1X1IA 5E9AA 1R3RA 1VJZA 3AIUA 1H09A 2OJPA 3KBVA 4PTDA 3ITCA 3R1ZA 3U7VA 3TQ0A 5C0QA 1KFCA 5EFFA 1VYPX 1PWLA 3CZLA 3CUHA 4DLQA 1W5MA 2REQB 1K6AA 1HJVA 4AXKA 2PSNA 4NZFA 4LCSA 1UPPA 3W1XA 1GQLA 4WJ8A 3RGTA 3WLHA 2ZZ5A 3P60A 3MI3A 3MO4A 3W2MA 3RJXA 2PWEA 2OX1A 4BQ5A 4UFMA 1CZ1A 2WXDM 5IXEA 5C9ZA 3IUIA 3L4ZA 3P61A 4C6OA 1N2VA 2QNEA 1TQJA 2PWDA 3S9ZA 2CWNA 2FZ9A 3CB3A 3TR2A 4AEFA 4ZTYA 1PKMA 3ZT6A 4HYRA 3W9ZA 1WDPA 3TNBA 2WJEA 3S8HA 1HZYA 3HG3A 4ACZB 4C6LA 1Q4WA 3QOKA 4FZIA 1TPFA 4P8XA 3DGRA 3MI2A 4EAYA 4OTKA 4P2VA 3NZQA 1XW8A 1K9FA 3M6DA 3WZ0E 2ASHA 2A7NA 1EEXA 3IJ9A 1KBBA 8XIAA 3O6YX 3EA1A 3DU0A 1EJRC 3R2GA 3U57A 2WLYA 2FHCA 3TV8A 4LU0A 2TAAA 2G37A 1Q6DA 1X1ZA 4ALDA 3DYMA 2PGFA 3IJQA 2HS8A 3UYIA 2INZA 3FN9A 4Q7NA 4CNPA 3QLLA 3XIMA 4M80A 1XIBA 3W07A 3LPFA 1K4HA 1LWIA 3NQVA 3OVPA 5EY5A 5E70A 4D8ZA 2XPKA 3EWDA 5K9CA 2Y63A 3GDKA 1YBQB 4WKFA 1GHRA 1GVFA 4NI8A 3F03K 1QFEA 2GGHA 3NQFA 1Y7VA 3I10A 4H9ZA 1J79A 2C15A 3RO6A 4MJ4A 2POTA 2ZDRA 2CNCA 2DZUA 1KQYA 1EO7A 5I3GA 3MU7A 1VHCA 4P8UA 4Z2GA 2CKRA 3OJGA 1W9UA 4CD4A 3MV01 3VNLA 2CBJA 5K9XA 4Q7BA 1C9DA 3ZM8A 4C6IA 1EKOA 4I5XA 1H5YA 1BHGA 1C8VA 4J2MA 4C7FA 4ZMGA 5G1YA 1ZCOA 2VQTA 3VVGA 4FOKA 3KWXA 5ABTA 1VBRA 3GVQA 1DWAM 1EYWA 5CPSA 2VELA 1VB9A 3PWAA 1XIIA 1YEYA 2WANA 3HQ1A 1FWCC 1GCYA 1QNQA 4U3CA 3EAUA 2IS7A 2FDSA 2DU2A 1TSIA 1I2RA 1GPFA 4EVZA 4QSFA 4MM1A 4Q8MA 4FNRA 3NEHA 2ZZ1A 1Q65A 1FBAA 4JY8A 1RD5A 3NA8A 3ABXA 1X1NA 3CM4A 1XYLA 1UMLA 4PUEA 3WIJA 2NT1A 2IKJA 1U22A 4HN4A 4KS0A 1G5AA 2RH9A 1CGXA 1TJRA 5JH1A 2NX3A 3S1VA 4DUOA 3PN8A 1Q6CA 5JQ9A 3RPMA 1PB0A 1ISZA 1GVRA 3P8IA 2I1OA 3IARA 5D8ZA 4HMCA 3LLDA 4H04A 3CL6A 4AMAA 1OWQA 4FR6A 3L4VA 3CNYA 3ZYZA 4EF9A 4UTUA 1U5JA 4GIYA 5IDZA 4Y9MA 2CEQA 3EMZA 1KFBA 3CZJA 1J8VA 4YLWA 3ITGA 4UMAA 4X0VA 1EGVA 2X30A 4NAFB 4NL1A 1CPUA 1JYVA 3BJSA 1K7XA 5C7VA 3EDFA 2QUNA 2Z4GA 3IVSA 4YN5A 3BV4A 1V4YA 4HHLA 1BXBA 4FP1A 4WQ6A 1JPIA 4PL1A 7PTDA 3AISA 3VI2A 3A24A 2OKTA 1JCTA 1QI0A 1R5YA 4NZCA 1QAPA 1OF6A 2GVLA 3CXOA 1Q6EA 2H9AA 2BX7A 1MW0A 4JNZA 2INEA 3WUGA 2Y62A 2Z6JA 5DRCA 5LIUX 5F2IA 2GZXA 5CC3A 2L5HA 4PRWA 3H12A 5CH9A 5AC5A 3PSWA 1A0CA 5F4XA 4AWTA 1SGJA 3QZ6A 4W7UA 5FF3A 4DWSC 1PO9A 3E0WA 1NDWA 2D24A 4PTXA 4YVVA 3WQOA 1AH3A 1ZQ5A 4LYKA 1DL3A 4MKVA 2XN2A 2QAFA 3UGVA 2EXOA 1FHUA 3EA2A 5KTLA 4P8VA 1NVMA 4LJ3A 3S9YA 1G4TA 3GH7A 3R8RA 1RP9A 4Q3MA 3W70A 1RWFA 2AAMA 2ZWYA 1E72M 2QT3A 3AROA 4DNMA 2I16A 2QJHA 2WNNA 2MUCA 3PY2A 2WC4A 3WJZA 2EPKX 5CGQA 4IFOA 2HCVA 1IT8A 4ZZ9A 3LRMA 2QJIA 4Z2JA 1FP9A 1CXFA 1CYGA 3D3AA 3W2JA 1QI3A 4MMWA 3O2LA 3IIXA 1CXEA 1W9PA 2WB5A 3URQA 1AD4A 2BMBA 1M9HA 1V3LA 5CKSA 3W73A 1F7BA 3KTXA 4UTWA 3U48A 3AXMA 3UD2A 5I03A 3SGZA 3A64A 2QZRA 3IGHX 3HQNA 3OODA 3ELFA 3W7JA 3LI1A 5HUPA 3NAVA 3IEBA 4Z17A 1XI3A 1KFJA 3T40A 3N4AA 1CXKA 3UPBA 3WH9A 4LYQA 2QV5A 4WJEA 7ODCA 3W7HA 1UA3A 4D6FA 1G4EA 1ENUA 4LF1A 2A4AA 3G6MA 1N8IA 1JDFA 2PDFA 2VX4A 1Z69A 2OODA 3RLUA 1QT1A 3KBSA 3SECA 3W23A 1JVNA 4I8DA 3GKFA 3PPHA 4H9UA 3Q37A 3F2BA 1SFJA 2UZ9A 4XAYA 4S3AA 4ZFCA 5EPDA 1Z42A 1ZBWA 1GK8A 2XVNA 1PZ2A 1KM4A 5AHEA 1W3HA 3WLJA 3TLQA 1RWAA 1HQTA 3CUXA 3JZEA 2EHHA 7CGTA 3EEZA 1K7FA 2O9OA 1WP6A 1YNYA 1H0GA 4QP0A 2A7RA 4R85A 4DF2A 1JZ8A 4QDMA 2DZBA 5DF0A 3KTCA 3B8TA 4DLOA 3VFCA 2EJ1A 2CHRA 4V28A 4WUIA 5I0DA 2VDIA 1XYAA 4HCHA 1XIMA 1OFQA 2NT0A 3O8AA 4ZE4A 3HGOA 4RL3A 4K2SA 1B90A 1AW5A 4ICCX 3WNPA 3JW7A 2WZHA 4E4FA 4GVFA 2GJXA 4N9DA 2AGKA 3AIWA 3CZ8A 4M19A 2UY2A 1QCWA 2A1YA 1OX5A 4O4VA 4XVDA 1UD4A 1HNYA 2A2IA 1WAWA 2VEGA 3CQHA 4LV4A 2VNCA 5LIWX 4DUWA 4MJZA 5AKQA 3W01A 4DJDD 4HK7A 1UR4A 2CLPA 2W92A 1KGXA 4WHBA 2EKCA 2XFFA 3DEQA 1OF8A 3P8JA 2E67A 1UMYA 3WL0A 3L66A 2XM1A 3T07A 2ANUA 3BLLA 4UTFA 2IW0A 1DPMA 3SCRA 2HJPA 1LCOA 4JBRA 5LSMA 4GKTA 3B9NA 4IT1A 3EZ4A 4J4KA 1RJPA 4HSHA 2PDMA 1Q2SA 5DCEA 1RSCA 1VGAA 5DCDA 3CUJA 1J0MA 3FGCA 4X2RA 1P5BA 2WM0A 5M1TA 1HVXA 1RWHA 1RR2A 1GNXA 1CGTA 2P3EA 2Y8KA 2FIQA 2VEPA 3W7LA 2QCHA 4EIVA 3FK4A 3E49A 2IKIA 2XSAA 1VS1A 3E2VA 1DXEA 4E8DA 5BWAA 4NU7A 2CZVA 1QK2A 3M9YA 4US6A 1E6XM 1TX0A 1XIFA 3B9EA 4HSOA 3P62A 3QQ0A 4HJWA 5D9PA 4HHHA 3VNZA 6TAAA 4HNTA 4LAKA 1NEYA 4J7RA 5AHMA 2XFRA 4UQBA 1ELSA 5HWNA 3OZOA 1QK0A 4Q22A 1TVNA 4IM4A 3UETA 3T05A 4QJ3B 3LU2A 3ZJ8A 3ATYA 4QITA 3EXRA 1TFVA 4NG3A 5XIMA 4R34A 1EYEA 3LHZA 1NDYA 1J0KA