2WMGA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in complex with the lewisy pentasaccharide blood group antigen.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
555
structure length
553
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIANYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLKGHHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 199
structure length 553
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmgA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmgA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmgA02
3SCUA 3HJEA 3K8KA 3WFLA 1OD8A 5A6BD 3PZOA 2W63A 4HZ8A 4MNKA 2X05A 2FDMA 2YKKA 2PWHA 2OSWA 5A95A 2FHCA 2HISA 3GNOA 3GH5A 4NZCA 3WD4A 3M7SA 4A4AA 3W0KA 3EBVA 3EMQA 5FD0A 3W28A 3KL3A 1E6NA 3ECQA 3MO4A 1OGGA 1H09A 1KXQA 1WZLA 3VX0A 1XYFA 1RW9A 1FP9A 2ZIDA 1SR0A 3WDPP 3CZEA 2C0HA 1W1VA 3OGSA 1GUVA 2BVDA 2Z1KA 4J3SA 2D20A 4MTVA 3T0BA 1CEOA 5I78A 1V6WA 1BVNP 2J25A 3BSHA 1W2VA 2E8ZA 2V38A 1EDGA 2WWDA 1M03A 3CHDA 2WCSA 2TAAA 1GPFA 2WANA 2GK1B 1E43A 3SCVA 2XHYA 3J7HA 2WC7A 3OGRA 1JGIA 1KWGA 5GNZA 3IAQA 2VL4A 1I1WA 1EO7A 2WWCA 1LXMA 4P8WA 3RMEA 2J8FA 3M6DA 1TA3A 2WLYA 1PIGA 3MUAA 4F9DA 3PZNA 2DSZA 4W7UA 4OUEA 3ZSSA 2ZUWA 8CGTA 3CBWA 1N7RA 2V3FA 2XM1A 2YDSA 4NRSA 1LOHA 4V28A 2JF6A 4W7VA 2QMKA 1E4NA 3AHTA 4UQCA 1EHAA 2EEXA 3DHUA 4CCCA 3VIGA 2G3MA 2Q8XA 3FHAA 4H8UA 4LX4A 2BNJA 3SCNA 1JZ4A 4MPKA 3AIWA 1V3IA 3WNKA 2J7CA 2J8GA 1X6NA 1V3LA 4UNIA 4AEFA 1MXGA 2W66A 5C71A 1GVYA 4AIUA 3GBEA 4M24A 2D24A 1H4PA 3BH4A 2D2OA 5A6BA 1CGXA 1JNDA 3AZRA 3AXHA 5A94A 3HN3A 4PMVA 4M1RA 2CXGA 1SYTA 4PCTA 1WNOA 1HMWA 2AOSA 1UWRA 1UOKA 4D72A 3MSGA 4QP0A 3VDAA 1PPIA 2ZOXA 3PBGA 2VR5A 2WCAA 4CN1A 4H41A 1H0IA 3D3AA 2ZX5A 1V0KA 5I0DA 1XHGA 3VGEA 1HM2A 1MFUA 3BLKA 4R5EA 5HBFA 5CJ5A 4XB3A 3NDYA 1EOMA 4S3JA 4XV0A 1W9PA 1BGAA 4PTXA 4CD7A 1GQIA 3RILA 5LYRA 2XVKA 1HP5A 4L4PA 4P7RA 4HOWA 5CSUA 3UETA 1UWTA 4HU0A 5CQ1A 4WKFA 3SIMA 2BVTA 1JFHA 2XIIA 3NIYA 1UD6A 1JYXA 1B3WA 3BAXA 4MJ2A 3BMWA 4JIEA 4AEEA 2D3NA 3AFBA 1KCKA 3IJ7A 5CPQA 4Z2IA 3TOPA 3WF1A 4ATWA 4W84A 2EPLX 1KWKA 1NWTA 2VZVA 4B15A 2DT2A 6TAAA 4GINA 4GZIA 1SMDA 2DH2A 2C7FA 4JL1A 2WC3A 1D7FA 1ZBKA 3WH9A 3PZ9A 3OGVA 1X6LA 2J7FA 1J18A 4BA0A 3T2PA 1UWQA 4Y7EA 1E6RA 1AMYA 1XC6A 1V08A 2YBTA 2CBIA 1Q4NX 2XIBA 1E4MM 2Y24A 1HKJA 3OZPA 1F4HA 1HNYA 5A69A 4AY1A 4QAWA 2QHAA 1EQPA 2XSBA 4HP5A 5M03A 4EAMA 2PBGA 4Q7NA 4AZGA 3LPPA 2FGZA 2X0YA 3WUEA 4LYQA 1QI2A 4QDMA 4DUXA 3K8LA 1UA7A 5E6YA 2ZICA 3CUGA 1US2A 2A3AA 4UQBA 2EBNA 3IK2A 1BLIA 1WCGA 3IJ9A 4V2XA 2WKLA 3WDIA 3SUVA 3NSNA 3QHNA 4J3XA 1ZBCA 4W88A 2F2HA 1MQRA 5FIPA 2BY1A 5IXEA 4IPNB 1S46A 1GOOA 2E4TA 1GNXA 1E6QM 2D23A 1JAEA 3W24A 5HOSA 1RWGA 4JZ5A 1RWFA 2Y2WA 1UH3A 3TP4A 3BLPX 4HZ6A 1CDGA 2WMKA 5JBDA 1QVBA 1TUXA 2WXDM 3W29A 3SCSA 1GZJA 3WENA 2J78A 5LA1A 2QLYA 2VNCA 1OT1A 1TVNA 3SCPA 5M5DA 3VIPA 1WZMA 1CWYA 1C8QA 2YLAA 1GJWA 5A6JA 4F79A 3NDZA 1C8XA 2EO7A 1PIFA 1PX8A 3F5JA 3EDFA 1V3JA 3GNPA 1E0VA 3E1F1 3GBDA 4HA4A 4B9YA 3ZT6A 1XCWA 2GDVA 1OJOA 3SUTA 4RE4A 5I5RA 4TVUA 3WD1A 1QNPA 2VRJA 3M07A 5FL1A 1NWUA 4AZCA 1JXJA 2WBKA 4GZEA 3T2OA 1TZ7A 4PUDA 4CCDA 1JXKA 1WZKA 5E09A 3ZMRA 2CKSA 2PBOA 1R85A 1F4AA 1DEDA 1MXDA 1DWIM 1CB8A 1FH9A 4H8HA 1UKOA 2D0HA 3EDJA 4UQ9A 1BSIA 3A4XA 2VZOA 4DM2A 4AD1A 2VR4A 2Y8VA 4HA3A 3UG5A 1C93A 1FOBA 1VEOA 3AYSA 5D9PA 4PMYA 5ECUA 1UD4A 2DT3A 4M56A 1TFVA 1JZ8A 3CPUA 1LQ0A 1OSEA 2RGMA 4GPNA 1I75A 1E6XM 1R7OA 4XX6A 1JL8A 3AQUA 1UQZA 3BXWA 1EHNA 1PX4A 3FY1A 1JDDA 1OBAA 2FHFA 1XH1A 2PI6A 4FK9A 2NSXA 4UFIA 3BSGA 4IPLA 3N18A 3WD3A 5I23A 4TX8A 4AIEA 1A3HA 1N7PA 3VM7A 1UH2A 4QLJA 3SCWA 3M46A 2GJXA 2UY3A 2XFRA 4GQQA 3FNDA 4J3TA 1QNRA 3TTYA 3PZMA 5A1AA 1DWHM 1HJWA 3CUJA 1H41A 4UZSA 3WKZA 1M7XA 1W1PA 2WZHA 4X9YA 4MB3A 1NWSA 3ZR5A 4Z2LA 4DWSC 3AMCA 1HJSA 2IUZA 1E6SM 3AIUA 5EFFA 3W4RA 9CGTA 3F4VA 4X0VA 4YN5A 1BYAA 4FLQA 3ARUA 2CBVA 3L4YA 2X09A 4WKHA 1HIZA 1UD5A 3W37A 3ARZA 1LWHA 3I3DA 1W9BM 5I3DA 2WHJA 5D9NA 4J3WA 1VEPA 1HJVA 4PMZA 5CLWA 4CN6A 4Z2KA 3WMCA 5E0FA 2G8ZA 1J0ZA 4XUYA 1XSKA 4Z2HA 2YA0A 3CHCA 2ZUNA 2AAAA 4C7GA 4JFWA 2VI0A 1W9VA 4QCEA 2OLHA 1UHVA 5DFAA 3BC9A 1GONA 4PBGA 4YPJA 1OCQA 2CHNA 2VQUA 1OWQA 4C7DA 1UR0A 1UA3A 3FW6A 3ARPA 2G3IA 4AYSA 1J0JA 2V3GA 5JUVA 2VRQA 4LYPA 4URIA 1E6ZA 3MKKA 3DYPA 2CIPA 3UG4A 3RDKA 3WL1A 5HPCA 2WMFA 1G94A 1QHOA 1N7QA 1W2PA 3WDQA 5KEZA 1UYQA 1PJ9A 2WDAA 3QR3A 4PUEA 3AIBA 3PZIA 2BRPA 3FXYA 4LGXA 4LQ1A 5CLTA 1OD0A 4AD4A 4B9ZA 3MUY1 1E71M 1V02E 4GO9A 1UUQA 1W9DM 2OYMA 1K9FA 4P8VA 1J9YA 3OG2A 1PX3A 5I79A 1HKKA 1H49A 1VENA 4HA1A 2DH3A 3LMYA 3WH5A 5D9MA 4F8XA 2O9OA 3OLDA 1HMUA 1CIUA 5HPOA 2WKGA 1J10A 2PF0A 1AVAA 1CLXA 2A3CA 1W91A 2E40A 3OLEA 2EQDA 4ZEPA 4JAWA 1Q6FA 2CPUA 2WHKA 3GM8A 1MQQA 2XGBA 3WEMA 3VMPA 2ZUUA 5A8OA 4D1JA 5JBFA 1LWJA 1AQHA 5DT7A 4ZXOA 1WKYA 3OLIA 4GXPA 1J0YA 1TVPA 2QV4A 1GOMA 3WQWA 3QOMA 1BF2A 2CESA 1UR4A 2G4FA 1PZ2A 2WVVA 1WAWA 3KWXA 3KL5A 1ZB5A 1RP8A 2Y5EA 3EYPA 5I2UA 2ZXDA 2JIWA 1UD3A 2UY2A 4QFUA 5A6KA 1RWHA 3BGAA 4OBSA 4BQ5A 5DO8A 2CBJA 4YHEA 3WMSA 4NI3A 1QI0A 3N11A 3VUPA 2J7DA 1J0IA 1GHRA 2E9MA 1ESWA 3CHEA 3CTTA 4WSKA 3AZSA 4HMDA 5AC5A 2HVMA 1NWRA 3POHA 4U2YA 5GNXA 5FL0A 4JHOA 3WQ8A 3MS8A 1VF8A 5CGTA 3WH6A 3VDCA 2VT0A 2WMJA 2CITA 4PEEA 1UR8A 5ABHA 3F5KA 4W8LA 3WDJA 2JIEA 4PMNA 3WF2A 1RWCA 4CD5A 4RE2A 4YHGA 4MAZA 3THDA 1O7AA 1WE5A 4KRUA 5CSYA 4TVCA 3DYOA 4D6JA 5AY7A 1HT6A 5A6LA 2CKRA 3SCRA 4W5UA 4JFSA 1UR2A 4W86A 2VVNA 1U2YA 4AZ7A 3CUHA 1K6AA 4FLRA 4KH2A 1KR0A 2GJPA 2PB1A 4RE3A 1CGUA 3ZJ6A 3AIRA 1EO5A 2W91A 1CENA 2BXYA 4B16A 3TTQA 4GI6A 4PTMA 1X1IA 4BQ3A 3AISA 4HZ7A 2WZEA 2ZUSA 1C91A 3W27A 1KBBA 3O2LA 4FMVA 5CPTA 2UY4A 3QGVA 5A2CA 1B90A 4B3KA 4H04A 3SUSA 5A2BA 4P7LA 1KGWA 5CG0A 2XPKA 3CMJA 1TCMA 2WNWA 2JF7A 4HPHA 4FLOA 1KXHA 4MAVA 4WIWA 1WDRA 1QHZA 1PBGA 4OJYA 4RL3A 1JZ2A 3WUGA 1CNVA 1IT0A 4KWUA 2YBUA 2X1IA 1E55A 1QBAA 4AZCB 3G6LA 4CVUA 2W61A 3ZM8A 4PTVA 3ZJ7A 3OA5A 3VDHA 1G5AA 1W3HA 2XWDA 2VZUA 2D0FA 3BAYA 3N15A 1KXTA 4PTWA 1J11A 1X1HA 1XYZA 2CNCA 4NSBA 3JUGA 4W8AA 1ISZA 4D6EA 3A47A 1RPKA 2BHZA 1J12A 4J3UA 2JFEX 2UY5A 4M80A 2DT1A 1ZJAA 2QPSA 3VIHA 1UR1A 3KZSA 1EGUA 3L2LA 3VGBA 2WW5A 1JNEA 4JL2A 1BHGA 3GH4A 4X0NA 2YA2A 2O9RA 4AD5A 3D5HA 1JFXA 3PHAA 5JBEA 3RIKA 1HKMA 1ODUA 4OKDA 1XSIA 2VX5A 4TVDA 4D6CA 1NOWA 3AZTA 1V3KA 1UZ1A 2YOCA 1E4IA 4W8BA 1Z32X 3ARQA 1F1SA 1J0KA 3ZT7A 3WH8A 5FCZA 5EB8A 3EDKA 2PWFA 2GJXB 1KFWA 4IUGA 2E9LA 1JZ6A 4U5KA 3NJ3A 3T08A 4E8DA 1W3YA 2W62A 1E6PA 4HMCA 1X1JA 1VFMA 1TR1A 1GORA 1R87A 4J3VA 5I77A 4WK9A 1QNQA 4U5IA 4CU8A 4DWSB 2WBGA 2GFTA 4L4OA 4XZBA 2BRWA 3AS1A 3VD5A 1B3YA 5ABEA 1NARA 1U33A 2ZX6A 5HNNA 3II1A 8A3HA 3I3BA 1JZ3A 3IAPA 5LA0A 3MU7A 4E8CA 1YQ2A 1QNOA 1HJUA 1V0LA 2DDXA 2VOTA 1QI3A 1DHKA 3KL0A 5E9AA 2EPOA 5A6SA 3VU2A 2VC9A 1CGYA 1B0IA 1LLOA 4DWSD 3N9KA 4W93A 3U5YA 1H11A 4CVWA 5A8MA 2MANA 4AD3A 4UOQA 3CZ8A 3GXFA 3ZSTA 1KGUA 1B3XA 1L0PA 1KXVA 5IDIA 4AZHA 2Q1FA 1E40A 1P6WA 3QOKA 2VRKA 2GDUA 3RPMA 3VD3A 3T2QA 1DWGM 3GXIA 3RJXA 2YDRA 1E3ZA 1VJSA 1H1NA 1C92A 2E0PA 2OWWA 2Y4SA 3VTRA 4D6HA 1VEMA 2VJXA 3MMDA 3SCOA 3UR8A 2WYSA 5IFTA 2VCBA 1NOUA 2X2YA 2XWEA 1OT2A 1E70M 2BY2A 4ACZA 1V3HA 3W81A 2XVLA 3K4DA 4EANA 3POCA 2VVSA 2E3ZA 3WF3A 3BAKA 4UOZA 3CMGA 1Q6GA 4N42A 1US3A 1G1YA 2WCGA 5CPSA 3WQ6A 3HMCA 3U7BA 2CETA 2UWFA 2VZSA 2DEPA 4AIOA 1H0GA 3G6MA 3VDBA 3N13A 1NH6A 1ISXA 3DYMA 5A6MA 1UZ4A 4PN2A 2QPUA 4MB5A 4A3YA 1FFQA 3PZGA 3CUIA 4ATLA 1DP0A 4MJ4A 4JFTA 4PMQA 2DGAA 3A6OA 3VPLA 2BHYA 4HU8A 3WH7A 1QBBA 4AC1X 4CU7A 3LPFA 3TTSA 1D3CA 1BG9A 1BAGA 2PWGA 3W38A 3FAWA 3NCOA 1W3LA 3BCDA 3VIOA 1H5VA 4OOUA 3VD7A 1W3JA 1GW1A 2V5DA 2WVTA 3IJ8A 1NOFA 1JZ7A 1ZU8A 3ZT5A 1FA2A 3O9NA 1BYDA 3VVGA 3L4VA 5ABGA 2J47A 2BY0A 3U5UA 4OZOA 1GHSA 5DEZA 3SUUA 1W1TA 1RP9A 3CIVA 1R7AA 3AIQA 3KEHA 3L4WA 2E9BA 4ML4A 5IHRA 3AXXA 2WVVB 3GZAA 3DC0A 1CGVA 4DWSA 1C82A 3NSXA 1KQYA 3WFZA 1DTUA 1EDQA 2E22A 3SURA 3ARYA 1XH2A 4TUFA 3MMWA 1K9TA 1LF1A 3WNNA 2NT0A 2CYGA 4J28A 4KGLA 1N7NA 3ZIZA 2VX6A 5E6ZA 5GPRA 3W26A 4M8UA 2BRVX 4JKLA 1HJXA 3GDBA 1EOKA 3ZR6A 3BCFA 4F9JA 3W6MA 1C7SA 4AW7A 5ABFA 1EDTA 2V5CA 1OGBA 2WZIA 4GIAA 2WM0A 3NSMA 3VM5A 5C70A 1QW8A 1ODZA 1XD0A 2DSWA 3AOFA 1VAHA 4WSJA 1VFOA 7A3HA 3AS0A 3CGTA 1HJQA 1J0MA 4Z2JA 5JIWA 1V6VA 4KMQA 4GI8A 2X0HA 2CHOA 2YIHA 1J0NA 1EQCA 2DPEA 1FH8A 4WLCA 4U3CA 3WUFA 4LXFA 1EA9C 2ZUTA 4MDOA 5A8NA 3CZGA 1CBGA 3N17A 4UFJA 2OYKA 1NP0A 4AMCA 2CEQA 4EK7A 1WDSA 4P7QA 2ZWYA 1DWJM 2YL6A 3N12A 1B1YA 2D1ZA 5FKYA 4TX6A 2WMHA 1QNSA 2WCOA 5D4YA 1MW3A 3WY1A 1C90A 1ZBWA 1DWFM 3SUWA 1QW9A 2QF8A 2GSJA 5FOOA 3PZUA 2J62A 1BQCA 3MUZ1 4MNLA 3DHPA 4GKLA 3ALGA 3B9DA 3AIEA 3WQ5A 2DIEA 4PYSA 4UZUA 2WMGA 4E2OA 1YHTA 4UQDA 3PTKA 2ZWZA 1E1EA 3CH9A 1UWUA 1G0CA 2D0GA 3ZOAA 3AXIA 3WQVA 1L8NA 2OWXA 4EE9A 3CHFA 5F7UA 3RM9A 1BG4A 4BZYA 4A3HA 2X03A 4D1IA 4GQRA 5CXPA 1ZJBA 1E1FA 1C8YA 1JIBA 3MV11 4DM1A 5JIPA 1GOQA 2YL5A 2EPNA 1CXEA 4DUVA 3OZOA 3K46A 3VINA 2WAGA 2F8QA 1MYRA 5KZ6A 1HM3A 4PMUA 3AHXA 2GUYA 1VB9A 4UFKA 1R8LA 1TG7A 4U31A 1GQKA 2E8YA 2Y8KA 2VCAA 1QOXA 3WL0A 3GH7A 1XH0A 4H2CA 5BRPA 3WQ4A 4TOQA 2XM2A 2WSKA 2VQTA 3U57A 1HP4A 1UKQA 4M82A 3ALFA 4PMOA 3UR7A 1JAKA 2XVPA 3VGGA 1V6XA 4BF7A 2ZXQA 4C7FA 1QI5A 2WMIB 3L2MA 3HU7A 1MVYA 4D6FA 2GJRA 1H2JA 3OB8A 1E56A 2ZX7A 7CGTA 3ZO9A 4HMEA 4P8XA 1CXHA 1VBUA 2V3EA 2RGLA 4PMRA 1W32A 5BXSA 1CXIA 3WEOA 4UQEA 4B3LA 3AROA 2BHUA 3SCQA 4JHZA 1UG6A 3VMOA 3A4WA 3WF0A 5BXPA 2J77A 2C8NA 1ITCA 2O9PA 2BFGA 1CECA 4MB4A 4BQ2A 2ZXBA 1I1XA 1XRVA 4HTYA 2OWCA 3T09A 4AZIA 2OSYA 2BS9A 1PEZA 4ATDA 3SCTA 1M53A 3K8MA 1QHPA 1CGTA 2DSVA 3QHOA 3AHYA 3AJ7A 2VO5A 3LPOA 1FHLA 3W25A 2VCCA 3VD9A 2XVNA 1J0HA 4LPCA 3ARTA 1CLVA 3WMBA 2FHBA 1Y7VA 4OBRA 2ZUMA 1E9LA 4ZFMA 4UFMA 1GOKA 1PAMA 3PTQA 4F66A 1CYGA 4J27A 2WVUA 1HN0A 1V03A 2ZE0A 1CTNA 3PZTA 3S2CA 4PMXA 2FH8A 1MFVA 3VIMA 1WDPA 3SEPA 4OOZA 2B31A 2VUYA 1HXJA 1UH4A 5IFPA 2XGIA 5A8PA 4V27A 5I24A 3QHMA 1LG2A 2XUCA 1NP2A 3VIJA 1LXKA 1LL4A 1JDAA 3VIFA 3AHZA 2XFYA 3GYCA 1LG1A 4QLKA 1JF6A 4MNMA 3VMNA 2WB5A 3WUBA 3FHQA 4CN4A 4H7VA 4DUWA 4U3AA 2VZTA 2OYLA 2VX4A 3VGFA 1B2YA 1OINA 1JYNA 3BAWA 4IISA 5D8ZA 5A2AA 5AYBA 1ITXA 4CD4A 1WO2A 1RH9A 3T0AA 4UOJA 1FFRA 2WLZA 1UWIA 4UR9A 2WC4A 4MADA 5EBAA 3EDEA 4Z2GA 2CBUA 3WEZA 3GXMA 4W87A 3ZQ9A 1QI4A 2DIJA 4ACZB 1KR1A 4CU6A 3U7VA 1VFFA 1R86A 4PMDA 2VURA 3I3EA 3NUKA 3S6TA 1MQPA 3RJYA 1FHDA 4D6GA 1HVQA 3WIJA 3VKKA 1OJPA 1JF5A 4E4PA 2DSUA 2A3BA 4W89A 1QPKA 2EPKX 3MMUA 4MNJA 2JEQA 1UD8A 3ARXA 2J7EA 1UQYA 3WNLA 3CZLA 4HPGA 2WMIA 4Q22A 4JFVA 3UCQA 1RD6A 1KBKA 2O9TA 4BCEA 4M81A 2GVYA 2J79A 1KQZA 1UR9A 3OLGA 4GO8A 1B3VA 5AC4A 4JCMA 2IXVA 3FN9A 4AXNA 1MWOA 4U33A 3CZJA 1V02A 3N04A 5BRQA 2A3HA 3NYDA 4AZ6A 3ZJ8A 2PWEA 4PSRA 3MUIA 2ZX9A 3WD2A 4H8VA 5CGMA 1HX0A 2ESCA 2Z1SA 3LPGA 3WBAA 3VGDA 3VIKA 3TTOA 2JEPA 1GJUA 1UKTA 2YLLA 1PZ3A 1W1YA 4KGJA 3L4ZA 3VGHA 1GCYA 2FH6A 1WP6A 2EPMX 3VD4A 4QCFA 2GK1A 4QLLA 2QMJA 1MW0A 1ZS2A 4PSPA 4K68A 2BV9A 1KGXA 2YJQA 4UTFA 1O6IA 4AZ5A 1E3XA 1E15A 1UWSA 1HKIA 1OM0A 3UESA 5A6AA 4HOXA 1E4LA 1M04A 2BXZA 4HOZA 4CD8A 5AYIA 1KB3A 2EJ1A 3THCA 3VOCA 3VNYA 5D9OA 1OIMA 1G9HA 1VFUA 3L4UA 5LA2A 1E0WA 1UD2A 1SFSA 2EXOA 1Q6EA 1UKPA 6A3HA 3FAXA 3PTMA 4CUCA 1E0XA 1KCLA 2BVYA 4ZENA 1J01A 2DQXA 3WBEA 1B9ZA 3PZVA 1LL7A 5ABFB 5DT5A 4CD6A 2IXUA 1JI1A 4ZE5A 3AS2A 1A47A 4TTGA 1XV8A 4P7NA 2W5FA 2AMGA 2NW0A 3RM4A 4U2ZA 2XSAA 1FH7A 1XGZA 1WZAA 2W4XA 4AD2A 1Q6DA 1X1NA 1IZKA 1E73M 1W3KA 2G41A 2VX7A 2XVGA 4WKAA 2V3DA 3ARWA 3WNPA 1IV8A 2W92A 2FGLA 3W82A 1OIFA 5BXRA 4NF7A 1VBRA 3AMDA 1BVZA 2G3NA 2YL9A 2ZX8A 3L4XA 4FLSA 1CZ1A 1RWAA 4PRWA 3K4AA 2WSPA 2WPGA 3AI0A 1JYVA 2PWDA 3AICA 3VIIA 4W5ZA 3W53A 1ISWA 5BXTA 1FP8A 6CGTA 1DWAM 1U30A 1GQLA 4W85A 2XTKA 1HL9A 1AQMA 4UCFA 1I8QA 2X8RA 1CGWA 1V6YA 1EGZA 3CLWA 5E70A 5BWFA 4AZBA 1CXKA 1HL8A 3EMZA 4BS0A 3VILA 3RO8A 1B30A 4EKJA 1BFNA 3B9EA 2J7GA 1B31A 3O6AA 2CERA 1VJZA 1TMQA 2J7HA 4GI9A 1BYBA 1ISVA 1JD9A 1EH9A 3AYRA 4JKKA 3CUFA 2J7BA 2XFFA 5C8BB 5GNYA 3GTNA 2YDQA 5GQBA 2J75A 4MB1A 2D3LA 4N0RA 1XD1A 4W7WA 3WNOA 4OIFA 4UFHA 2WHLA 3VNZA 3A3HA 2F61A 4P8UA 1MW1A 5I6SA 3APGA 4UQAA 4ACYA 1EXPA 3WF4A 2XYLA 7TAAA 1OGSA 4D71A 1ECEA 5DMYA 2VMFA 1JG9A 1E5NA 3K1DA 4NRRA 3GNRA 2YA1A 3MV01 3KE0A 3T0DA 3PZQA 1W9UA 1K9EA 4P7OA 4KRTA 4LYRA 1WDQA 3MANA 4JKMA 3WELA 1LL6A 4JFUA 5M3WA 2E24A 1XCXA 2DT0A 4FF5A 1V6UA 1JZ5A 4MDPA 3IANA 5D8WA 1HN1A 2D22A 1OJNA 5A3HA 4ZXLA 1NQ6A 1EIBA 1ISYA 4CCEA 2DSKA 2CCRA 2OSXA 2J4GA 1G01A 3BAJA 2NT1A 1JYWA 5A8QA 5BYWA 2WHMA 3ZJKA 1HVXA 2G3JA 2A3EA 4TTUA 2JE8A 1BYCA 4AWEA 3AMGA 3A4AA 3N1AA 1E5JA 1OB0A 5DF0A 1GOWA 5HDRA 4BQ4A 4IM4A 1JDCA 3OIHA 1IZJA 2XJ7A 1BGGA 3F5LA 3WSUA 3PN8A 1LJYA 3WNMA 4D6DA 4S3KA 5CZKA 3BAIA 4M29A 1WB0A 3B8SA 3AMLA 1HF6A 1SMAA 3MSDA 3CO4A 1TA3B 3WN6A 3VO0A 3UG3A 1GOIA 1MW2A 5EMYA 4J7RA 3TONA 1B3ZA 2WVSA 1ZBVA 4ZE4A 1Q6CA 4R27A 3W6LA 2PC8A 3AMKA 1H3GA 3WDRA 1W9XA 3EDDA 5BROA 4CKQA 4UFLA 1CXLA 5BCAA 3CZKA 4AISA 5IHSA 3WD0A 3L4TA 4AD0A 1V0NA 4WJXA 1CXFA 4TXEA 1WPCA 3TA9A 1E72M 3OBAA 4D6IA 3AIVA 3ARSA 3AS3A 2XG9A 1VRXA 3GXDA 1V0MA 5TD4A 2ZXAA 1F9GA 4JCLA 3WDHA 1GQJA 1BTCA 1VIWA 3UERA 1D2KA 3RCNA 3EMCA 2BY3A 1N82A 1N7OA 5E0CA 1OJMA 2WK2A 5HXMA 3UEQA 2W67A 2J74A 5EFDA 3RM8A 2JALA 1ZL1A 1C7TA 4WF7A 3DECA 1TE1A 1GVIA 3BMVA 4XZWA 1CPUA 1UKSA 2O92A 4PCSA 1XSJA 2VTFA 3ARRA 4CGTA 1AQ0A 1V3MA 3B9AA 2ZUVA 1JI2A 1NM9A 1M01A 5M17A 1BPLB 3ARVA 3AHVA 3VX1A 2YL8A 4GZJA 1JD7A 1C3FA 1K9DA
chains in the Genus database with same CATH superfamily
1XBVA 3N34A 2HVNA 4CQBA 3EAUA 2ANUA 3WFLA 3PNZA 3I6EA 5FEZA 1J93A 5A95A 4GGHA 2HISA 3NZRA 4GXWA 2BOFX 1JDFA 4MY9A 4DZHA 3RR1A 4JBRA 2QGHA 3W28A 1FWFC 3MO4A 5HJYA 3SRDA 1OGGA 1Q3NA 4IGSA 4DPPA 1B57A 4D8AA 3E0VA 1W1VA 4CEUC 4L1GA 5KETA 4J3SA 4MTVA 5I78A 1V6WA 3BSHA 3UJEA 2QXWA 1W2VA 2WWDA 2TAAA 5LIUX 1V4YA 2WANA 1EZWA 1XRSA 5XIMA 5DCDA 4KCVA 5CPOA 3ORWA 3W74A 2WC7A 3OGRA 3ABSA 3M0ZA 5GNZA 3V1HA 4EPEC 4Z08A 1S1RA 4NX0A 3M6DA 3N2MA 2WLYA 2DSZA 4W7UA 3TTEA 2ATMA 3W86A 1TV5A 4R33A 4RZBA 2XM1A 4NRSA 2X41A 4Q33A 3W2UA 5TQLA 1E4NA 1SZFA 4KCUA 4UQCA 3RFAA 4KFPA 4CQ8A 3DHUA 4CCCA 4L6OA 1H51A 3HG2A 4IP5A 1RSCA 1LQAA 3H22A 3TQPA 3FHAA 4H8UA 1F3XA 3PG8A 1JZ4A 3HGJA 1LWIA 1THFD 2ACUA 4QRNA 1V3LA 4UNIA 2WSRA 1TRDA 2R1MA 1MXGA 4M24A 3RX3A 1JUEA 3W7JA 1JRBA 2Z1BA 4MY8A 1CGXA 2XFWA 3AXHA 4F2TA 1SYTA 4M7SA 1ZNNA 2AOSA 2PDBA 2GGHA 4D72A 1UBPC 3HBLA 2ZOXA 3LV6A 1M68A 4M19A 4CN1A 3UZJA 1H0IA 4PUMA 3S46A 3TN5A 5I0DA 1MFUA 2XDFA 4GABA 4R5EA 2ZZ6A 4XB3A 3W1MA 4KWVA 1W9PA 3RHGA 3LSCA 1PHWA 4PTXA 2G4JA 2OT1A 4ZO8A 2XVKA 3SB0A 1LT7A 4ZO9A 2Z29A 4HOWA 2GSEA 1UWTA 4AYGA 4B3ZA 2EHHA 3ME3A 1JFHA 3NIYA 1TZZA 1FHVA 3C52A 3C2VA 2NV1A 1VRAB 1EC9A 3TYUA 5CPQA 2HE8A 4Z2IA 3LGDA 3WF1A 5FACA 4ATWA 1DE6A 1KWKA 3W2NA 3MA8A 4ADUA 4KS0A 6TAAA 4GINA 1YBQB 2NZLA 1D7FA 1H7WA 2V4IB 5JVLA 5CZJA 3IGUA 3T2PA 4Y7EA 1E6RA 4A6GA 2ZA2A 3CPRA 1Q4NX 2C0AA 1HNYA 4JS3A 2QJIA 3H4GA 4Y90A 2OJPA 2ZE3A 1EQPA 1HGYA 5HWNA 2XSBA 4LV9A 3R13A 4Y6GA 1QI2A 4QDMA 3AWNA 4DUXA 1UA7A 1XJBA 2Q3OA 2ZICA 1EP1A 2EBNA 4DZIA 4A3UA 2QJHA 3IJ9A 4V2XA 1QUMA 3SUVA 2XSXA 1ZBCA 3M5ZA 4W88A 4UBPC 3DI0A 4E2BA 1LTDA 4IPNB 3QC3A 1GOOA 2E4TA 5FJIA 1GNXA 1L2UA 2ZRZA 1E6QM 3GIYA 1JAEA 1H7NA 1P0EA 5HOSA 2XN1A 1SFLA 3ZYZA 4PZVA 1FVPA 3BGGA 1RWFA 1UH3A 3BLPX 4XO7A 4C5YA 5JBDA 4DNHA 3KCLA 1QVBA 3COTA 3ABRA 5LSMA 2WXDM 3W29A 4L7ZA 5LA1A 1W3IA 3IUDA 4EXQA 5M5DA 3V35A 3VIPA 4LS1A 1WZMA 1OADA 2FPTA 2ADAA 2A0NA 4GIRA 1GJWA 5A6JA 4JTTA 2EO7A 4IMAA 3UD6A 1PIFA 2WO5A 3EDFA 1E0VA 3E1F1 5I09A 4HA4A 4XIMA 1TQXA 2J6VA 3KOYA 3HTWA 4DJDD 2DVXA 1UMYA 4HU4A 1OJOA 5I5RA 3Q65A 4FF7A 4LNYA 2VRJA 1KV8A 4GRSA 1XWYA 2KAUC 3NXLA 2EG7A 4GJJA 2G3FA 3BURA 1S2TA 4AF0B 1XLDA 1TZ7A 4I5RA 4CCDA 1LOQA 2PBOA 1R85A 5G4WA 1I9CB 1MXDA 2GGIA 1OFOA 4H8HA 1FH9A 4DBSA 1EC7A 1V6TA 1RLCL 4UQ9A 1BSIA 1S39A 4G9PA 4RDVA 3A4XA 1UOZA 4I9JA 4DM2A 3L5AA 2VR4A 4HA3A 2GJLA 1N8WA 2ZBTA 3AYSA 2YCKX 4PMYA 5C2CA 3O6DA 4O4WA 2DW7A 4B5SA 3PAJA 4QDWA 2RGMA 1I75A 1E6XM 1SJBA 4GACA 3ICJA 3GTXA 3GFZA 4POCA 1EYEA 4FK9A 1XH1A 3TN3A 4JR5A 3NA8A 3D6NA 5I23A 1VFSA 2FTWA 4EPBC 3R25A 4QM1A 1J5TA 4HNVA 1KBLA 4DZAA 4UTUA 1BXCA 1XM3A 2D69A 4QAIA 1TPB1 1QNRA 3PUGA 1DJQA 3PZMA 5A1AA 1DWHM 1HJWA 2ISSA 3TC6A 1YKWA 3CUJA 1VCVA 1Z42A 1W1PA 3MPGA 4X9YA 2DP3A 1FRBA 3GDRA 3MP3A 4QJ1A 4K7VA 3OW1A 3ANUA 3KRUA 3M44A 2AGTA 3FDGA 3O0FA 2VGFA 3V0SA 4FX6M 3CEUA 4X0VA 4YN5A 3EWXA 3ARUA 4LBSA 3CIXA 2GL5A 4WSHA 1IHIA 2KZHA 3A9BA 1OCNA 3R4IA 1K8CA 3ARZA 3I3DA 1W9BM 1MUWA 4CQCA 4J3WA 3UG8A 1HJVA 5CLWA 3WMCA 1ME8A 4H4IA 2C14A 4LRTA 4XUYA 1XSKA 3QRHA 3W85A 4Z2HA 2Q8LA 2ZUNA 2AAAA 4C7GA 1KRAC 4JTGA 3SGUA 2V63A 3PSVA 3MSRA 1W9VA 4AC7C 1UHVA 3BC9A 2J66A 3LCLA 2CHNA 2VQUA 3LZ3A 1UA3A 2CZFA 2FZBA 2G3IA 1J0JA 1B9BA 1DV7A 1XUUA 4D9PA 4LYPA 4URIA 1E6ZA 4AUBA 2VXNA 1QXLA 4QNWA 3WYZA 2GQ8A 2CIPA 4F0SA 1VQTA 1D9EA 4RNIA 2V68A 4XKYA 1QHOA 4AF0A 1UROA 1EEXA 1M6JA 3UZ5A 1Q8AA 1KRMA 1W2PA 3GTFA 3LI0A 2NX9A 2IQTA 3DZ1A 5D2VA 1UYQA 1OC5A 2WDAA 3G1DA 3CTLA 5MKGA 2C1HA 2BRPA 3PZIA 2QCCA 4LQ1A 4E8GA 3IJIA 1OD0A 7REQA 2ZRWA 3QQWA 1CB7B 1ZFJA 2POTA 1L6SA 4GO9A 1AH0A 2I14A 2OYMA 3PR2A 4P8VA 5EY5A 3OG2A 2QCHA 1EF3A 3GZ3A 1VENA 4HA1A 2DH3A 4I9AA 6REQA 2X40A 4F8XA 1WDWA 2RUSA 5HPOA 1YTEA 4ECLA 2WNZA 1G69A 3OLEA 4GVFA 4JAWA 1Q6FA 4JDBA 3EOLA 4GA8A 3EX2A 4IPJA 4D1JA 2OKTA 3CQJA 4ZXOA 3TVAA 1WKYA 4GXPA 1A5KC 1J0YA 2QV4A 3WQWA 2QT3A 4FP1A 5H2ZA 3UY8A 1F3WA 3GKFA 1UR4A 3G3MA 1PZ2A 4KFOA 3KWXA 3E9AA 1Q6QA 2Y5EA 2ZXDA 1UD3A 3R8HA 4Q6JA 4FZIA 4KEZA 3L68A 1LOLA 1RWHA 3FGCA 1RQBA 3BGAA 3Q58A 5HMDA 1DKWA 4B5VA 2REQA 4A2RA 2KX9A 3DI1A 5I06A 4GLEA 1W31A 3LN3A 3PBUA 3C0JA 1G4TA 2ZFAA 3GXTA 3QXBA 1V79A 3PULA 2BZNA 3S83A 1WBJA 1I8JA 4EVZA 3CHEA 3CTTA 4HMDA 4E3TA 1L2QA 1JPMA 3QLDA 1F05A 1IE7C 2Z2BA 5FL0A 1XYLA 1VF8A 5CGTA 3WK1A 3F4WA 3VKCA 2PDGA 4IIEA 4LCRA 2HPMA 4H01A 5CJMA 1FDJA 4DXVA 4PUNA 4MAZA 5BOOA 3UWVA 2B81A 5CSYA 2VFFA 4TVCA 4G8TA 2YSWA 1AMKA 5A6LA 1JJKA 1J6PA 4LUYA 4AZ7A 3VZXA 2FB3A 4YVPA 3G22A 2J6XA 2FTPA 4RE3A 4PCPA 3C0LA 1EO5A 3IS4A 3QW3A 3C56A 4E2VA 5LIKX 4GI6A 3BW3A 4UNKA 2BB0A 2WZEA 2O4MA 3EOSA 3BLIA 3EWCA 5U4NA 1XIBA 3OP2A 2ZUSA 1M3UA 3W27A 1KBBA 2Y1HA 5A2CA 3W6YA 3SUSA 3U48A 2GOUA 1EJRC 1H61A 3N4FA 2XINA 2JF7A 5F4SA 4MAVA 4E2DA 1XLGA 1OFPA 1PBGA 4OJYA 4ZODA 1JZ2A 5HINA 5HMSA 3UXLA 5C2GA 3F4NA 4IJRA 2QUVA 1LBMA 3JR2A 4CVUA 3GG1A 1HTIA 3ZM8A 3ZJ7A 1R9ZA 3OA5A 2DZSA 3N15A 1KXTA 5LNRA 1M7OA 2X42A 1J2WA 3GWQA 2E6AA 3P2VA 4W8AA 5T9CE 2UY5A 3M7WA 1D3HA 1LLQA 1VH7A 2DT1A 1Z7AA 3TC3A 3BL3A 3PQIA 3TLLA 5LNUA 2Z7GA 3FV9A 3FJ4A 4JL2A 2O9RA 3QV7A 4MPQA 4UTWC 1ICQA 4UTWA 3IIVA 3MI3A 3Q2DA 2V0TA 3PK7A 4G1NA 3W7NA 1T8QA 4IMDA 1XSIA 2VX5A 4TVDA 3FFSA 1NOWA 3TA6A 1V3KA 2YOCA 1A3XA 1E4IA 3BDKA 4W8BA 3SBFA 1VPQA 1Z32X 2R91A 1XBZA 4RNHA 5F4XA 1IXNA 4NJHA 5DMMA 5EB8A 2AMXA 2E9LA 3S9YA 2W62A 3H7VA 1VFMA 1GORA 6TIMA 1IR2A 4J3VA 5I77A 1SSGA 3VOHA 2NLYA 1V77A 4DWSB 3NGJA 2QNEA 3HG3A 3R11A 2VD8A 1VFLA 3LENA 1R3RA 3NQ8A 3TV8A 3DENA 8A3HA 3I3BA 1GJPA 3MU7A 1YQ2A 1HJUA 1V0LA 1BVWA 2GJNA 3KL0A 2EPOA 4L5ZA 1XL9A 3C2RA 2QCLA 1CGYA 1LLOA 2X0SA 3ZVIA 5HATA 5M1TA 3URQA 3N6QA 2NQZA 3S2NA 3UF9A 1UIPA 1H11A 1OFQA 4CVWA 2MANA 3CZ8A 3GXFA 1KGUA 2J8TA 3P84A 3W23A 3V18A 2QEZA 3TXVA 3QOKA 2VRKA 1AQFA 3UNDA 5B7YA 2YDRA 1TMLA 1H1NA 4PRRA 1ICPA 3VTRA 4LALA 1A49A 4LAUA 3EA3A 4D6HA 3SO7A 4QROA 3LYEA 4C65A 3SCOA 1ML1A 3UR8A 5IFTA 4C6NA 3RF9A 2VCBA 2XWEA 2OX1A 1E70M 3F2CA 3GVWA 4ACZA 3WK3A 2X2GA 2GZXA 2Q8ZA 4YU1A 1H7PA 2XVLA 3VNIA 1O5QA 1DL3A 1ZHAA 3POCA 3WF3A 4UOZA 1JR1A 1Q6GA 4N42A 2PTZA 4L64A 3WQ6A 3HMCA 2DQWA 1GGOA 3VDBA 3N13A 3VCNA 1EX1A 2HXUA 1TWIA 4ORMA 1IGWA 3CV1A 2PS2A 3RNDA 1AA1B 1FFQA 3RCMA 3MWCA 4KWSA 4ATLA 4B2DA 4JFTA 4CNUA 3GR4A 5AHEA 3OJGA 3I6RA 4XVEA 2E28A 4HU8A 3HJZA 3LPFA 1IR1A 1K7XA 3VUSA 1EL3A 1GEQA 3CLMA 2PDXA 3U2ZA 3LHZA 3WLNA 3W38A 3BCDA 3P7YA 3QZ6A 3K1GA 4RCXA 4OOUA 4I8DA 3VD7A 4FHAA 5I02A 2V5DA 3ONCA 3ZT5A 1AZ2A 3GLCA 3O9NA 4FXJA 5HMEA 4I6VA 3VKBA 5KZDA 1GHSA 3T8LA 1P43A 4M6QA 1W1TA 1RP9A 4FOUA 4XD5A 3WLJA 3AIQA 5A6TC 3CNYA 1QAPA 3TN6A 3AXXA 4NYUA 4HIBA 4DWSA 2P50A 2WNNA 3IIXA 1A53A 1EDQA 3BE7A 4PCFA 2E22A 3SURA 3BW4A 3B04A 5LHFA 4HU3A 3NL3A 1N7NA 3DFPA 3W26A 2ZADA 2BRVX 3RITA 5B80A 3GDBA 1DJZA 4ICNA 1R3WA 1C8VA 1C7SA 4AW7A 3F2BA 4HD5A 3UA3A 4WX2A 4ERAA 4GIAA 5TF0A 2WM0A 3VM5A 1QW8A 2D2JA 2I16A 4C1KA 4GX9A 2ZTKA 2X7VA 3SRHA 2YIHA 1J0NA 2NQ5A 1OQFA 1RD5A 1T99A 4U3CA 2ZZ4A 1EA9C 3APYA 3BO9A 4MDOA 3CZGA 3N17A 1XQLA 2BSLA 4KEVA 2BBFA 3Q94A 2BMBA 4P7QA 2XIMA 4QIUA 2D1ZA 3QEZA 2WMHA 1QNSA 3QQ0A 2FB2A 1QU4A 4A3RA 3M6YA 4XUGA 1MNSA 4HTBA 3SUWA 1QW9A 1KNWA 3REQB 4GKLA 4ZB5A 4LANA 1Y65A 4PYSA 4UTJA 1YHTA 4UQDA 4DVOA 3RRAA 3KBUC 4OFCA 4B90A 1E51A 4Q4SA 1E1EA 2IKIA 3CH9A 4N6FA 1NJJA 3TAKA 1DJNA 3T6CA 1LLZA 3FCPA 3P8IA 1L8NA 4EE9A 4HPXA 3CHFA 5F7UA 5HMFA 4NX5A 1BG4A 5T26A 1S3TC 3GS6A 1C8YA 1J2BA 3K46A 3GU1A 5K2ZA 1F07A 4JIIX 2YCIX 1VZWA 4UFKA 3R10A 1TV3A 3GH7A 1XH0A 3UXIA 5BRPA 4HSOA 4TOQA 4UTIA 2XM2A 3C0SA 1X7IA 3GFXA 1AW1A 1ZJHA 4DF2A 2WQPA 4JTRA 3TYBA 2XVPA 1DJIA 1V6XA 4BF7A 1QI5A 2WMIB 1A5MC 2ZX7A 4H7CA 3A3XA 3M0JA 2CXEA 2V3EA 1S5MA 4AQLA 1DXFA 4M0XA 5I3JA 5BXSA 3M5VA 5FJJA 3WEOA 4CNSA 3LTPA 3SCQA 3U2CA 4Q8UA 2P3EA 3BSMA 5BXPA 1BRLB 3V4BA 2C8NA 1ITCA 1S1PA 5FEXA 4BQ2A 2JBMA 3LXBA 2HEJA 3UCCA 4HTYA 3T09A 4AZIA 5D2WA 2ALRA 3NVTA 1PEZA 4ATDA 3K8MA 4JX6A 3F4DA 2XZ9A 4XAZA 4JTEA 1Q7ZA 4LC6A 3DESA 3TDFA 3W25A 3WZ0E 4QJ5B 4IJBA 2XVNA 2HZGA 2I56A 3JS3A 3ARTA 3WMBA 2FHBA 1Y7VA 4OBRA 2ZUMA 4UFMA 1GOKA 3PTQA 1EWDA 4F66A 3PZTA 2AAMA 3NO1A 1MFVA 3MTWA 4FR6A 1YXCA 1HXJA 3L0NA 4M6VA 2BTMA 3NZQA 1D7KA 5I24A 5EMMA 3QHMA 2EF9A 2YEPB 1GW9A 3ZR4A 3I10A 2QV5A 2XUCA 3VIJA 2IMRA 3REQA 3VIFA 5HAOA 3AHZA 2E5DA 1JF6A 1ZALA 5C9XA 2BWGA 2ISDA 2RH9A 3W75A 3UP8A 1B2YA 3S6DA 5D8ZA 2CZ5A 3IRDA 5A2AA 4KQNA 2Y7GA 4K2SA 3T0AA 4UOJA 2WC4A 3HF3A 5EBAA 3EDEA 2CBUA 5A5WA 2P8CA 4XVDA 1QI4A 3EWUA 3LHWA 1FWEC 1KR1A 2D2GA 4D8ZA 3U7VA 4QXIA 2PDFA 1QW7A 4PMDA 2VURA 3KLKA 4EF9A 4O1FA 1FHDA 5CSRA 5AC7A 3B0YA 3UQNA 2W27A 4Y9PA 1HVQA 1ZAHA 2A3BA 1QPKA 1ZAIA 3CMFA 4MNJA 4FNPA 4WDTA 4Q8NA 4PUJA 1UD8A 3HQPA 1UQYA 1P48A 4HPGA 2WMIA 3EXSA 3NM3A 1O4UA 1TX0A 1OYAA 4M81A 1VHNA 4GO8A 5AC4A 1K8XA 3HQ1A 3A13A 3FN9A 1PL9A 1MWOA 5EU9A 3N04A 2CZDA 3NYDA 1QK2A 3ZJ8A 3HOJA 1N7KA 4G7EB 1HX0A 2OCZA 2Z1SA 4H7ZA 5LNVA 3VGDA 3WLPA 3HA1A 3VIKA 2Y0FA 1UKTA 3DFTA 4KGJA 3VGHA 2FH6A 3W1LA 2GVLA 2GK1A 2GWNA 4IIBA 4XZMX 2FTYA 1JCJA 4K68A 2BV9A 4JTIA 1LORA 1O6IA 4IWWA 1E3XA 1UWSA 3LERA 1Z48A 2BP1A 3SN1A 1OM0A 4MFEA 4HOXA 4ZGYA 4HOZA 2DY3A 3N3MA 1KB3A 4L4MA 1OIMA 5CKSA 3FDKA 1HKVA 2INFA 4MJZA 3W1RA 3GNNA 1UD2A 3ONBA 3SGGA 1UKPA 4LW7A 3Q45A 2HK0A 4GQGA 3O63A 3PZVA 3K30A 5DT5A 4CD6A 1NFPA 4FPSA 3CM4A 4ZE5A 4HNCA 4H6KA 1A47A 1Q65A 1KBIA 4P7NA 5EKYA 2GGJA 4B5TA 3W88A 3GIPA 1RY0A 1XGZA 1VGAA 1Q7MA 2WNQA 1Q6DA 1IZKA 2XVGA 1W3KA 1ZZMA 2DZUA 3KOWA 4INFA 4FNUA 5BXRA 3BLLA 3MYOA 1VBRA 4F0RA 3AMDA 4AU0A 4C1LA 4I7VA 4IGNA 4DHGA 1E1CB 4RXFA 4JTLA 4PRWA 1N8FA 2TODA 1RCOB 2WPGA 1TJ2A 3FJLA 1JCYA 4LSBA 3H2MA 1ISWA 2QCDA 3QMSA 4H9XA 6CGTA 1GQLA 3UNTA 1TO3A 3NPVA 4UCFA 2X8RA 1V6YA 4IXXA 1HL8A 3EMZA 3VILA 3MP5A 3DHDA 3KVMA 1BFNA 2ZA3A 2I9EA 3R89A 4FR1A 4Q4MA 2QUTA 1LP6A 1EH9A 3B4UA 2PLJA 4M5PA 2FJUB 3HPSA 4GUJA 3GTNA 2I7GA 4J2PA 2Y6ZA 3G1SA 4KETA 3SQSA 4N0RA 1DQUA 4PUWA 1YLVA 3WBXA 3B0UX 1W56A 2YB1A 2F61A 4G7EA 1OCBA 3TKFA 1MW1A 3QSTA 4L9YA 5EGRA 4ACYA 3BK0A 3E2SA 4D71A 4WXYA 4ZQPA 3TCSA 3PPCA 1P1XA 3WFAA 4NRRA 4Z1BA 3RLGA 4K7YA 3MV01 3RX2A 3TZNA 1HL2A 4PFMA 3T0DA 1XUZA 4IQEA 5B7ZA 1K9EA 3IRSA 4KRTA 1WDQA 3KS6A 2ZZ3A 1XLLA 3WELA 1LL6A 5M3WA 3M4HA 4O19A 1KCXA 1XCXA 2DT0A 3NQ2A 1EBHA 4DLQA 5D8WA 1NY1A 3FEQA 4GFSA 4ZQOA 1HN1A 2D22A 4QX4A 1I4NA 1V5XA 1Q45A 3R12A 1RBAA 4F48A 3T78A 2DSKA 2J4GA 1QWKA 2NT1A 4QISA 1JYWA 4JXCA 4O14A 4YWIA 2A3EA 4TTUA 4PEKA 3AMGA 2JKPA 2OELA 3A4AA 4CNOA 1IIHA 4H8NA 3SRFA 3C3UA 1BGGA 4LRSA 2PC4A 4I9MA 4GNJA 4Y2WA 4AIBA 2H9AB 2FZ9A 3WJXA 1IQ8A 4S3KA 1KM4A 1KTCA 1T6MA 4HJWA 3AMLA 2GDQA 3BW2A 4FNSA 1SMAA 2ZVRA 3GX9A 3CO4A 1TA3B 5IOBA 3NQFA 2YBVA 3TONA 1B3ZA 1XW8A 2WVSA 1ZBVA 4NZ3A 4ZE4A 2PC8A 4JTKA 3N29A 2A7RA 1H3GA 3EDDA 3EKGA 2PE4A 3CZKA 1TV7A 4WJXA 1CXFA 1RK6A 4TXEA 1WPCA 4H9MA 3DH7A 1E72M 2PZNA 3ARSA 4EWND 2ACSA 1V0MA 1XLMA 4Q8WA 1V8EA 1RA0A 2ZXAA 4JCLA 1K8YA 3OZMA 1BTCA 4FS9A 1R0MA 3CK5A 3RCNA 3KBMA 4DELA 3PUOA 4DNMA 4AB4A 1T7LA 3L67A 1OJMA 2ZTJA 4AWTA 4RNFA 2I5IA 2W67A 4EIVA 1AJZA 2JALA 3D47A 1CPUA 1TPDA 3ARRA 3S0CA 4GH1A 3IPWA 1JI2A 1VHCA 3QYQA 1BPLB 2PP3A 4FX7A 3HPXA 4D8LA 1ZRQA 3LCFA 2QAFA 1K9DA 1H7OA 3SJNA 2QCNA 1KFLA 3DG7A 1H7RA 1XYCA 5A6BD 3LU2A 4F0LA 4BFAA 2PWHA 2FHCA 1PKYA 1G4SA 4NZCA 4H1ZA 3WD4A 4UIOA 5AVHA 2VEMA 5BMWA 3EMQA 3DDMA 5FD0A 1CLKA 3KP1A 1L9WA 4CNTA 1VFTA 3VX0A 1YXYA 2OZ0A 1XYFA 1FP9A 3R8GA 3CZEA 4PA8A 1GUVA 1KCZA 3C4UA 3EXRA 3C5QA 1NTHA 4P61A 2Z1VA 3RLVA 2JGQA 1YDYA 3P80A 2H9AA 3R5EA 1F73A 3J7HA 3S47A 2FPYA 2XH4A 2Z6JA 1KWGA 4O50A 3IAQA 4UTMA 1I1WA 1A0EA 2J8FA 1A0CA 3RUBL 2PLCA 1TA3A 1S2AA 3MI6A 2OVLA 3MUAA 3PZNA 4F9DA 4LCSA 2POZA 4ZO7A 3ZSSA 4AX6A 2ZUWA 1NSJA 2JGYA 2YDSA 1W6TA 4W7VA 2QMKA 2MUCA 4JNZA 4I7WA 1IGSA 5AHNA 4BKNA 2OGJA 3B0VC 4GIEA 3I7RA 2G3MA 4J5NA 3VIGA 4PC8A 2Q8XA 4Q8MA 5AHLA 3ZFHA 4AVFA 3CAVA 4MPKA 4A8IA 1V3IA 4IIDA 1TE6A 1X6NA 2H6RA 3AUOA 1H50A 1XC4A 3GBEA 3S3GA 7ENLA 1A5UA 3W7MA 1PZ1A 5TAOA 3BH4A 4GVGA 2BVWA 2VEGA 3NPXA 1KTBA 3HN3A 2QDDA 1SM9A 2CXGA 4X2PA 3HO8A 3UPWA 3PFMA 3MSGA 3VDAA 2PDNA 3UZZA 1S5WA 4UNLA 4H41A 3D3AA 4Q3MA 5E0KA 1RVGA 3CQIA 3VGEA 4IT1A 5L9FA 3BLKA 4OVXA 4REQB 5CJ5A 2HRWA 4S3JA 4AY7A 4G7FA 4Q4QA 3AAMA 1BGAA 3TYDA 4CD7A 1GQIA 4WY0F 1GQNA 5LYRA 1YE6A 3PAOA 3ENLA 3QY8A 4Y8FA 2ZRXA 3UETA 4FOKA 4WOQA 4MUPA 1MUMA 3SIMA 3WQGA 1UD6A 1JYXA 3RLHA 3NQVA 3UBPC 4MJ2A 3BARA 4AEEA 5J5RA 3AFBA 1KCKA 4JTHA 4MWAC 4Z1DA 1RVKA 4KPLA 1BF6A 4EXBA 3BG3A 3M0IA 2VZVA 2ZDSA 2C15A 5KZMA 2PDJA 1SMDA 1BWKA 4EX4A 4JL1A 3S5SA 2ABBA 3STFA 4ERGA 1ZAJA 4DBDA 3WH9A 1CI1A 5PTDA 3I7SA 1X6LA 2J7FA 1ALDA 4FXRA 8XIMA 3VE7A 1UWQA 4DBEA 1AMYA 1V08A 1P4CA 3UWUA 3CUXA 2XIBA 3USBA 1XGEA 2Y24A 3E0FA 1GTEA 4WY0B 3BOFA 3KP0A 5A69A 1VFHA 2JK2A 4HP5A 3HMJG 2Z2AA 3DAQA 2XISA 3LPPA 2FGZA 3P5YA 3WUEA 9RUBA 3BLOA 4LYQA 4H2HA 5E6YA 3UJFA 3P74A 3ZVHB 1TTIA 1US2A 2A3AA 5CCZA 1ZQ5A 9XIMA 1UPPA 3GHRA 3H26A 4J3XA 2F2HA 1OFAA 2F9RA 5AHFA 3GW3A 1MQRA 3QM3A 2BY1A 4GYFA 1S46A 2X16A 2WM1A 4HCHA 5DMNA 1PVNA 4F0HA 4K1GA 1RWGA 1AK5A 1UCWA 2P5NA 5FSEC 4JZ5A 2IQ0A 1G4PA 1B5TA 1OY0A 3TP4A 2QAPA 4HZ6A 1CDGA 3GTHA 3UA4A 3QZEA 3WENA 4TMBA 1JULA 3N9RA 1CWYA 5I03A 3VNDA 2NXGA 1JVNA 3BICA 2R24A 2NUYA 3UYCA 4S2CA 3W2JA 3F5JA 3GNPA 1V3JA 2GSHA 2ZDRA 3BV4A 3IJDA 4B9YA 1GTHA 3N2XA 2NQ9A 1W54A 1A80A 4ZA0A 4GC4A 4OE7A 4REQA 4TVUA 5JH1A 3RRXA 1WXJA 5FL1A 1NWUA 2WBKA 3C0QA 1JXKA 1WZKA 5E09A 4N7QA 1D3GA 2RDTA 4DPQA 2IW0A 1DWIM 1UKOA 5AKQA 3VNKA 5CPMA 2GVJA 5C55A 2E6FA 3WBYA 1VPXA 3VOFA 3E2VA 3H2AA 1I2QA 4O11A 1O94A 3CH0A 4C1NB 4YTRA 4DN1A 3KFTA 4LU0A 4LVDA 1C93A 1YE4A 2P0OA 3WLTA 3VFLA 5ECUA 5JQ9A 4ROQA 3PF3A 4WUIA 4HSHA 1TFVA 1JZ8A 1LQ0A 4GPNA 5AYZA 3AQUA 1W17A 3HGOA 3BXWA 1EHNA 4IIGA 1G67A 2C3ZA 3IK4A 1OBAA 2FHFA 2PI6A 2NSXA 3IWPA 5C9ZA 1SFTA 3KS5A 3LNPA 4TX8A 1N8IA 1XDLA 3G1YA 4AIEA 4YTSA 1A3HA 1N7PA 4XD6A 1T40A 4ML9A 3XINA 1UJPA 4ZQRA 2GQ3A 4QLJA 2C19A 3SCWA 2GJXA 2UY3A 2XFRA 4DB7A 1WAUA 1O68A 3TTYA 5F2MA 3KHJA 1H41A 1M7XA 3GRIA 2WZHA 3GUGA 1NWSA 4Z2LA 4KT2A 4IFOA 4J35A 4X63A 3ZVHA 3AMCA 1JUBA 3N6HA 3OYZA 1MRAA 3AIUA 3HGSA 3F4VA 1JQXA 1BYAA 2IKHA 3LM7A 4FLQA 1TPVA 4C6JA 3W2MA 3L4YA 1VLIA 4WKHA 1Z6KA 1BTMA 1U1HA 1LWHA 4WJ8A 3PWGA 3WLQA 2PSNA 3EWYA 2OEKA 2WHJA 3B3DA 4Z2KA 1PCWA 4MJMA 1J0ZA 4ONVA 2GWGA 3KBVA 3TYEA 3RU6A 1Q2RA 3VKDA 2IPWA 2OLHA 5DFAA 1UP2A 4XK2A 1GONA 1U5VA 1OWQA 2VM8A 1YPFA 4C7DA 1X8FA 2HSAA 2VWTA 4AYSA 3CV6A 3A9IA 3LHYA 4GJ1A 3LZ5A 4A2SA 3W7IA 2X30A 3N3TA 3RDKA 2NSOA 1PSCA 1G94A 1N7QA 1PIIA 3KVKA 1RR2A 2Q6ZA 1MUCA 3R0DA 1J5SA 1YXDA 3WDQA 5KEZA 1YDNA 3WJSA 4MF4A 1XICA 4GQBA 4DJFA 5D2TA 3QR3A 3TQVA 5AECA 3I4EA 4IFRA 1MNZA 4B9ZA 3O1NA 3GR8A 2AQVA 3LLXA 5DY3A 3LXAA 3NZ1A 4WZHA 3OBKA 1J9YA 4ZVJA 3OEXA 1O0SA 1HKKA 4H6EA 1MSSA 5D9MA 3CB8A 4NVTA 3ITYA 4IG2B 3WQEA 1VD6A 1MEWA 5D30A 1IXQA 1HMUA 1YNPA 1QT1A 1WOAA 4XQ6A 4S3FA 1CLXA 2A3CA 2PCEA 2PFHA 2E40A 5IBXA 4O28A 3WEMA 5GJPA 3VMPA 4F0MA 2ZUUA 5A8OA 1PDYA 1AQHA 1CT5A 1FY6A 3C3NA 1X1ZA 3VNJA 3TFXA 1DJXA 1MXSA 3OLIA 2PRMA 3D0CA 1TVPA 2PZ0A 3TSDA 5CZSA 4BK9A 2IKJA 1A3WA 1XLAA 4U4MA 2CESA 2G4FA 3LLDA 1ZB5A 2JIWA 3BJSA 3LK6A 1I6NA 3MUCA 4BQ5A 5DO8A 3QR1A 1FWBC 1XLBA 1QI0A 2J7DA 4L6HA 1PS9A 3L66A 4XZIA 2YCJA 4GYJA 2XH2A 1Q63A 2HVMA 1TRIA 4DBUA 3W7CA 2AQOA 3POHA 3HG4A 1R6WA 4U2YA 4JHOA 3WQ8A 1AZ1A 1TQJA 4GY7A 2EGZA 3WH6A 3H6OA 1IXPA 3BANA 1GT8A 4MWAD 1PZ0A 3NQEA 2CITA 5ABHA 4PULA 3MC5A 4PMNA 1RWCA 4CD5A 1O7AA 3Q4DA 4KRUA 1ZGDA 5ENLA 3DYOA 5AY7A 1HT6A 3GVVA 3SW6A 3SCRA 4W86A 3LOTA 3LDVA 2ZCGA 1Y0EA 2A79A 4US5A 1NU5A 1FKWA 1US0A 3WJWA 2B7NA 3ZJ6A 4WDWA 2PWUA 2W91A 4GVIA 3TTQA 1FHUA 1G4EA 3AISA 4HZ7A 1Q2SA 2OKOA 1Q6LA 1Q6OA 2FLIA 5CC6A 1I2NA 4IP4A 4UTTC 1EJ7L 2E6DA 2WJZA 4KWOA 5CPTA 2AKZA 4IMGA 3QGVA 4CCZA 1PE1A 4H04A 3B40A 3TMQA 5A2BA 4P7LA 5CG0A 3CMJA 4NU7A 4XAPA 4HPHA 5AN7A 1EPXA 1F6PA 5FJTA 1CNVA 4KWUA 3CASA 3RLUA 2PU1A 2NV9A 4AZCB 4FNQA 4QE1A 5LIYX 2Z1XA 2XWDA 3VDHA 3URNA 2XIOA 1X1HA 1XYZA 3U2OA 4J3UA 4AMAA 1K6WA 3ITLA 2JFEX 2W9MA 3N4EA 1XG4A 3NQBA 5D2YA 4XISA 4H9YA 2FVMA 1RK5A 2YXXA 1WQ5A 1OHLA 3L2LA 1DQXA 2BOEX 2WW5A 5DQPA 1XQKA 4C6DA 1WBHA 2PDWA 3GH4A 3ITOA 2YA2A 4XTDA 1SW7A 4HSNA 3IVSA 3RIKA 3GXPA 1HKMA 3W71A 1ODUA 2YCLB 3M41A 2CLOA 2QJNA 1UZDA 4R3UA 3FEMA 3NTYA 4O8RA 2RDWA 1J0KA 1T41A 3WH8A 5FCZA 2EJAA 2PWFA 3O6CA 4N9BA 3VKAA 4IUGA 4MYAA 2HDJA 1DIDA 2VOMA 3S2LA 3NJ3A 1W3YA 1E6PA 4HMCA 4MM1A 3VOGA 1X1JA 3QGAC 1TR1A 1LYXA 3I7QA 4U5IA 1L6WA 4CNPA 4L4OA 4WJEA 4FIRA 1TR9A 1A5CA 1B3YA 5ABEA 1U33A 1VP5A 2YYTA 2ZX6A 5JU6A 4N6EA 3TSBA 5DN1A 3QV6A 4C60A 2QJGA 1WUFA 4EP8C 2PRLA 3E6EA 5FAGA 5E9AA 3M5YA 3OVGA 3SECA 3STEA 5A6SA 4DUOA 1KRBC 5HK4A 3ZXWA 2VC9A 2EPHA 4HHPA 5G1MA 5CBIA 1LRQA 3IT6B 1IEIA 3PJXA 3ZSTA 1L0PA 3R79A 1EZ2A 5IDIA 3NQDA 3AYVA 3EWZA 3UWWA 3VD3A 3T2QA 1DWGM 2UBPC 3GXIA 4JQ4A 3RJXA 4YIWA 2E0PA 2OWWA 3W70A 3GQYA 3TYCA 3FSTA 1I60A 3MMDA 3H21A 1NOUA 2X2YA 4FSAA 4CNNA 2BY2A 3CV2A 3W7RA 1VC4A 1V3HA 2R82A 3TLQA 4Q8TA 4EANA 3MVTA 1LOSA 3BAKA 4J40A 2WV8A 1G1YA 5U7SA 4LC8A 1W1ZA 1YPIA 3ISIX 1ONWA 1ZENA 4XBSA 3DFHA 2DEPA 2OO6A 3G6MA 5C7VA 2KXRA 1R3QA 4LFYA 1RZMA 1TPC1 2E1WA 2B7PA 3GFYA 3PTDA 3O3RA 2RKXA 4DX3A 3FVDA 2BXVA 4PMQA 1GWJA 3M0KA 2DGAA 3VXGA 3P93A 3THUA 2BHYA 3W84A 1QBBA 4CU7A 3I4KA 5CPNA 1BG9A 1BAGA 2YCLA 3W2KA 1VBHA 4QEEA 3FAWA 3NCOA 3VZZA 1Y8BA 1H5VA 2FFCA 1W3JA 2FPVA 1U1UA 3IJ8A 1NOFA 4O4VA 1ZU8A 1FA2A 2CWNA 4XIAA 5ABGA 3RXZA 2EKCA 3UWZA 2YB4A 3GO2A 3CIVA 5C2XA 3UYIA 4V33A 1MMFA 1CX9A 4DRSA 4ML4A 3EB2A 3CAWA 5IHRA 2WVVB 1NELA 3ABZA 2NVCA 3DC0A 4QE4A 1C82A 3NSXA 4I7UA 4B5WA 3H2NA 5D33A 3KTSA 3VYLA 1REQB 3WO8A 1ADSA 3ARYA 2QJMA 5CGQA 4BR1A 4IIHA 1A0DA 4TUFA 3NXFA 1LF1A 3OODA 4PB5A 1DTNA 4HYVA 4J28A 5E6ZA 5BU9A 1IT8A 2V2DA 5C6MA 4M8UA 2Z25A 3AYTA 4N9EA 4JKLA 5D05A 4F9JA 1EOKA 3BCFA 3W6MA 5ABFA 3A22A 3LCXA 4V1YA 1TIWA 1WX0A 3PS7A 3W7HA 5C70A 1ODZA 1T8XA 3AOFA 1VAHA 1VFOA 1XDJA 4OQVA 3IEBA 2HS8A 5L6UA 4MZ1A 1XYBA 4Z2JA 5JIWA 4Y9NA 1V6VA 4KMQA 4GI8A 2CHOA 4HB7A 2ISVA 3MCMA 4XBJA 1FH8A 4CLMA 1RCXB 2AL2B 4P2VA 4LXFA 4O1BA 4MZ8A 1OEPA 2E5BA 2I9UA 4DQWA 2ZWYA 2OLAA 5DX7A 1Q8JA 4JQ2A 4KKXA 3HPAA 3VCCA 1MW3A 1C29A 1UBSA 1C90A 4ZTYA 1ZBWA 4AWUA 6XIMA 1PHQA 4LUSB 3AU6A 3G8EA 1M9HA 2PDLA 5I3KA 3TYAA 1BQCA 3ALGA 4WGHA 2P76A 2BASA 3CV7A 3TNOA 2DIEA 4MWAE 4S3BA 1HO1A 2Q3RA 4N9CA 3HGRA 2ZWZA 4TO8A 1GKRA 3PJTA 2D0GA 4TQTA 4RLIA 3WK2A 2CLHA 4UMCA 2W3ZA 3GYEA 3DIPA 5I7GA 2ICSA 4BZYA 4QGCA 3B05A 1TV8A 3KW3A 4D1IA 3B0XA 3FSUA 5CXPA 1ZJBA 5JIPA 4DLMA 2YL5A 3LSBA 2CFFA 3S1GA 2WAGA 4JICA 2F8QA 3H4XA 1DOSA 2OFJA 3AHXA 3LGGA 1O5KA 1C9WA 1VB9A 4DI9A 4B5XA 3EKZA 4DO6A 3WL0A 1EYWA 3WQ4A 2J9ZA 3U57A 2VQTA 1HP4A 5G5IA 1UKQA 4M82A 3UR7A 1JAKA 2YW3A 3VGGA 1K7FA 2ZXQA 5K3VA 3OB8A 3PJWA 7CGTA 2ZZ1A 2WSYA 1VBUA 2HVOA 5HWJA 2NVDA 1CXIA 4HNUA 3U9IA 4B3LA 3AROA 1VBGA 3VMOA 3A4WA 3NL6A 2J77A 5BU6A 2BFGA 1CECA 2E77A 1I1XA 2X1RA 5ECVA 3MUXA 3OU8A 1WV2A 2BS9A 4DEFA 3DFNA 3KDOA 1FWAC 2VEKA 4YWSA 1JCLA 2DSVA 2FVLA 4JTFA 3AHYA 2AL2A 3R58A 4YL2A 5BOFA 1J0HA 4QQUA 4ZFMA 5I07A 3M0MA 4O0QA 3TJLA 4J27A 3TW9A 2WVUA 1CTNA 1SU5A 1WDPA 2G50A 2PURA 2VUYA 3SQLA 2ZRYA 3LBCA 3NAVA 2XGIA 2VEFA 4V27A 4LUSA 4WGXA 1LG2A 1I45A 1S2WA 4LY4A 2E68A 1JDAA 4O52A 1KKRA 3BLFA 4HBKA 3GYCA 3GHSA 4ZOEA 3W9ZA 3VMNA 3L21A 3GSMA 5HANA 3TQ0A 4DUWA 1R5YA 2O0TA 5C7HA 4IQJA 3S2JA 2OYLA 3DBNA 3ZLGA 5BMXA 1LBFA 3BAWA 1UWAA 2VFDA 1PO9A 5I3FA 1ITXA 2GGGA 4KW2A 4CD4A 2PWVA 2WLZA 2B7OA 4LAMA 4UR9A 4MADA 3KBWA 3MI2A 3WEZA 4MLJA 3ZQ9A 4H3DA 5HNRA 4RZ4A 2DIJA 1JCNA 4RKAA 4YMZA 1R86A 2Y5JA 3GB6A 3NUKA 4MOZA 3LCWA 4D6GA 1CB2A 5LNWA 5K9XA 1R9YA 4IMFA 2CZEA 3WJYA 1JF5A 1QOPA 3W3OA 1R3SA 2DSUA 1A50A 2Y63A 4W89A 2EPKX 3STPA 3VABA 1F3EA 1MRQA 3WNLA 3KTCA 4JPGA 3H12A 1RPXA 3MKCA 3XISA 1IWPA 2E1DA 3O16A 4JFVA 1RD6A 1TPEA 3GNXA 1KBKA 1XISA 2O9TA 3TC7A 4HNLA 5HULA 5FF7A 4LCQA 3V16A 5FEWA 2OLSA 3TW6A 3KAOA 2NXHA 1JPIA 3CZJA 4Q6XA 3UCDA 2VFEA 5D32A 4PSRA 3D3FA 3CC1A 1ZCOA 2QCFA 3LQGA 4MIMA 3BMXA 1GCYA 3FXGA 4A29A 2HK1A 3VD4A 4QCFA 4GNKB 3MCOA 1MW0A 3N6JA 2PDCA 4LUTB 2JKAA 2BOGX 2YJQA 4UTFA 3OO2A 5AYYA 4AZ5A 4KERA 3C6CA 5A6AA 1ZTVA 4J4KA 5AYIA 2EJ1A 2OXNA 4IFKB 1TZ9A 1G9HA 1VFUA 3L4UA 1EJTC 1VIZA 3FAXA 1R30A 5DRIA 2BVYA 4JTDA 3BOLA 4ZENA 4EF8A 4GJIA 3LCGA 2DQXA 3WBEA 1B9ZA 4I9TA 4PRTA 4U2ZA 4PE8A 1WZAA 1XIHA 2VX7A 2G41A 4WKAA 4BI5A 5CZ0A 3WNPA 1CW2A 2W92A 2FGLA 4US6A 1OIFA 1XFBA 2G3NA 4E6MA 2V67A 2YL9A 4FLSA 1CZ1A 5LZLA 2WSPA 3WQDA 1S3HA 2OQHA 1JYVA 3KRSA 3U3HA 2J13A 3VIIA 4W5ZA 3W53A 3IV3A 2QR6A 1FP8A 1K70A 1A5OC 3F2DA 1U30A 2XTKA 1HL9A 3TJ4A 5K4ZA 5BRBA 1EGZA 3CLWA 3E0LA 4R7OA 1LRTA 3PB0A 1Q5MA 1B30A 5AHIA 1F6YA 3ITVA 1B31A 2DVUA 2CERA 2FFIA 5IDZA 1VJZA 1TMQA 4FOJA 1BYBA 4LUJA 3AYRA 1RJPA 1BXNA 5C8BB 2AL1A 2YDQA 2YR1A 4PBFA 4MB1A 1XD1A 3RAOA 4QBXA 3VNZA 4BI6A 1P0NA 5K7JA 4P8UA 5REQB 2OEJA 3SM0A 1DYSA 1YBQA 2CLMA 3WF4A 3PBMA 2XYLA 3W7OA 3I6TA 4DJEA 2VMFA 5D2XA 1JG9A 3K1DA 1X97A 3KM8A 4IMEA 3KE0A 1I2RA 3UD1A 3PZQA 3FJNA 3OA3A 4LUTA 1H1YA 1FCUA 4LYRA 1BKSA 3MANA 4JKMA 5CPLA 2V82A 5H6HA 4BI7A 3NL5A 2RFGA 4E4FA 3LRLA 1GYNA 4IFKA 1V6UA 4Q4KA 1JZ5A 4MDPA 3TJXA 3IANA 3SSZA 4M7TA 3BJFA 1OJNA 3FKKA 3AU2A 4NZJA 4YXGA 1FKXA 1OABA 1NQ6A 1EIBA 2BGQA 2QJJA 4CCEA 2CCRA 4J3ZA 1YX1A 3ZJKA 1ONXA 3OPSA 1OC6A 2JE8A 3N73A 4AWEA 1UW9A 4ZQCA 1TWSA 3T8QA 3S2MA 3N2OA 4X2RA 3NL2A 1OB0A 3GVGA 4JQ1A 4AFYA 3B03A 4EOUA 3P14A 4BQ4A 4M6UA 1IIGA 2PDQA 1JDCA 3OIHA 4X3ZA 1XKJA 2GLKA 3WSUA 4OV4A 1RQEA 2ODOA 3WNMA 4D6DA 1CCWB 3ZS4A 5BWAA 1UR3M 2QDGA 4M29A 3B8SA 1GPWA 3MKVA 4XZHA 1X38A 1Y5XA 2GQAA 6PTDA 3Q37A 3VO0A 1QDSA 1VJIA 3RMJA 2QUUA 1YEYA 4FXSA 3QKZA 4PTNA 1Q6CA 4LWWA 2WSQA 3UR5A 4ZR8A 3WDRA 5BROA 2F84A 1CXLA 2F6UA 7XIMA 2CLFA 4BF9A 5IHSA 3VK5A 2PODA 2OGYA 2OU4A 2XN0A 3TA9A 1V7YA 1I0BA 3OBAA 2V6AA 3AIVA 3AS3A 3BGJA 2XG9A 3QBUA 4ICCX 1XPGA 3LTYA 3WDHA 1GQJA 5XINA 2J9YA 2ZYFA 2BY3A 5G2HA 2INZA 3GE7A 5JMUA 2GGEA 4A8NA 5E0CA 1P7TB 2GYIA 1OZMA 3GDKA 2CLIA 1GKQA 5D37A 3RM8A 3RPDA 3OIXA 1QCWA 1C7TA 4WF7A 5F4WA 4HJFA 3BMVA 4XZWA 1UKSA 2O92A 4PCSA 1TTQA 1XSJA 4AHPA 4CGTA 1AQ0A 5FEPA 3B9AA 3PSWA 4AH7A 1DPMA 2V30A 3BCJA 3AHVA 2YL8A 4GZJA 1JD7A 3WMLA 4B4FA 1DIEA 3SCUA 4O0KA 2IKGA 2HJPA 1TTPA 4BEUA 1DXIA 4NNBA 4HZ8A 4MNKA 2FDMA 1DJGA 3OYXA 2OSWA 1X1OA 3GG7A 3L5LA 1ICSA 3WLRA 3GNOA 3NYZA 5AC6A 4XZ9A 4A4AA 4A8LA 3EBVA 1SO3A 1MI3A 4I5UA 3W7QA 3KOZA 4X9SA 4LS2A 1XIMA 2R6OA 3ECQA 1H09A 1KXQA 1WZLA 4I3GA 1H1ZA 1R47A 1RW9A 3M64A 4F4RA 1SR0A 3WDPP 3M5XA 2C0HA 2PGEA 3DN5A 3OGSA 3GC5A 1IEVA 2TMDA 2D20A 4CEXC 3V1PA 3T0BA 1CEOA 5G1TA 5AZ0A 2DUZA 3W1TA 1EDGA 1EWEA 4RPPA 3LQLA 1M03A 2WCSA 1GPFA 1KFKA 1K1DA 4ICMA 1E43A 3SCVA 4UXDA 4GBDA 5LXXA 2XHYA 4GI4A 1XYMA 3UXKA 1AD4A 1JGIA 5I3GA 4JY8A 3QZAA 2VL4A 1EO7A 1F74A 3RMEA 5AC8A 1PIGA 4HNOA 1FXPA 3NZPA 1TCDA 4OUEA 5DLCA 1TWDA 3HZ3A 4N4PA 1N7RA 3EB3A 3MSYA 4V28A 3EEZA 2JF6A 4Q7BA 3AHTA 3LS9A 1F3TA 3KCJA 1S2VA 2RAGA 3PPFA 3P60A 1DXEA 4GE8A 5G4HC 4LX4A 2BNJA 1JCMP 2EKGA 3SCNA 3WJZA 2CZVA 4NAEB 3AIWA 2J8GA 3A3WA 1UIOA 1TVLA 3DHFA 3PWAA 1TJ0A 2D24A 5FAJA 3T4WA 1OCJA 1RJQA 4HYWA 4C91A 1JNDA 5A94A 3L2IA 4PMVA 4BJHA 4HPNA 4M1RA 3DFSA 4AXKA 4GFIA 1WNOA 3LCIA 2D2HA 2HCVA 1UOKA 4QP0A 4TR9A 1PPIA 1NFBA 2X1UA 2WCAA 4NUWA 3HURA 2ZX5A 4MVAA 4QS6A 2DV0A 1XHGA 3OG3A 3IJQA 1ME7A 2PAJA 5HBFA 4J9JA 3IVUA 3A4JA 4XV0A 1YYAA 1SO5A 3V5OA 3MHGA 5DXXA 4O13A 2PUZA 1XINA 4L4PA 4GUGA 4GC3A 4HU0A 3FOKA 2P8BA 4NXKA 2FZ8A 2R1LA 4O10A 2ZRVA 3PG9A 4JN6A 3BMWA 3M43A 4ZFCA 1HUVA 1TYGA 2D3NA 3IJ7A 2TRSA 2UV8G 3T42A 3TOPA 1FDYA 2EPLX 1L6FA 4B4HA 1NWTA 4HVXA 1KM1A 4B15A 3MJMA 1DJYA 2DH2A 2C7FA 4PH6A 4E4UA 2WC3A 2FGBA 4DY1A 3TMLA 1ZBKA 3UT0A 3PZ9A 3MCNA 1LBLA 4FNRA 3GKAA 4A22A 1J18A 4BA0A 2KXSA 1AG1O 5MF5A 2VYOA 3EXTA 1XC6A 3OTRA 2CBIA 1E4MM 2W6RA 5H8PA 5KZEA 1YRRA 1F4HA 3L7RA 4AY1A 2HMCA 3QY7A 4KFNA 4QAWA 4QS5A 4E5TA 5M03A 1H62A 4MKNA 4O8AA 1GEHA 3UGVA 1SO4A 3CUGA 5FJPA 1NDWA 5BZAA 3IK2A 1BLIA 5D09A 4S3EA 1P0KA 4MHBA 3CS2A 2C6QA 4ROPA 4DBWA 2QIIA 1A5AA 3E0WA 4OV9A 2Y2WA 4BEQA 1PYMA 3C2FA 3NPWA 3SCSA 1GZJA 1E9IA 3P82A 3MDUA 3UFYA 1OT1A 1TVNA 1P0DA 4JQAA 4HMNA 2YLAA 3OVPA 2PD5A 4F79A 3NDZA 1QWGA 4M3PA 4FA3A 3SFWA 2C18A 1KV5A 1NEYA 1W5OA 3W72A 5T8GA 1FWSA 1QPOA 3ZT6A 1XCWA 3E5PA 4OHQA 4NAFB 1LDCA 3SUTA 4Z1CA 2Q01A 1B54A 4JQ3A 4G1KA 3T2OA 2BGSA 3ZLHA 4HK5A 2VEIA 4RXGA 4DXKA 1JGMA 2PA6A 5DXYA 2CKSA 3SY8A 1E9ZB 1DEDA 3NWRA 1CB8A 4S3CA 3EDJA 3B8TA 2VKZG 3PPHA 1QTWA 1A5LC 3V3WA 4AD1A 2Y8VA 1FOBA 3IUHA 4H00A 2YW4A 3GNDA 1PDZA 4M56A 1OFDA 4JX5A 1R7OA 3IJLA 4XX6A 4KCWA 2HE5A 3EPOA 4WR3A 3EX3A 4BY3A 1PX4A 1YTDA 3W7DA 1DE5A 3UWEA 1L6GA 5DCEA 2PPGA 3BSGA 5GJMA 3QGKC 3WD3A 3U6WA 3VM7A 3W1XA 4Q4PA 3UPBA 3M46A 1NF7A 1IEXA 3BLEA 4I6KA 3FNDA 2L5HA 4J3TA 1YW1A 2DZTA 3FS2A 1QR7A 2H3BA 2Y85A 3WKZA 4K39A 1W5PA 4MB3A 1F76A 3ZR5A 2PDKA 1PXGA 2PTWA 4DWSC 1HJSA 2IUZA 1E6SM 3BWWA 2G96A 5EFFA 3B4YA 3W4RA 5H91A 2GUUA 1S2UA 3L12A 1ONRA 2CBVA 2Y8UA 2X09A 4ZMGA 5CAHA 2AQWA 3IGHX 4DJDC 3W37A 5KITA 4DJDA 2DZPA 5D9NA 1RUSA 1TWWA 4XD3A 3NZGA 3FIGA 4BF5A 4XZLX 5DELA 1VEPA 4ILSA 2PTYA 2Q71A 1GYMA 3NR0A 2G8ZA 3CQHA 3BZGA 1OJXA 2YA0A 1SJAA 3CHCA 2B7QA 4JFWA 2DZVA 2VI0A 4LNCA 4S1FA 3BVJA 1RQHA 2H8ZA 4L9ZA 4RDWA 1UC4A 1UMLA 4PBGA 4YPJA 1OCQA 4Y9MA 3O06A 2OPJA 3STGA 2YZRA 4B5NA 3OBEA 3NO3A 5JUVA 4NAFA 3P5ZA 3DYPA 3IGSA 1SR9A 2OOFA 4RDZA 3UG4A 4RW3A 5AZ1A 5HPCA 1SZEA 2MNRA 4GYPC 4GYPA 4Q8PA 4DZ5A 3ITCA 4Y8EA 1OZQA 2QCGA 3BOXA 1Q7QA 1HQTA 4PUEA 5HUOA 2OTDA 4LGXA 3T1GA 4C6OA 2VZKD 3IGXA 3B8UA 1WKDA 1KLZA 1UUQA 1K9FA 4AAJA 1PX3A 5I79A 3CQ0A 3CAQA 4JX4A 3TJIA 3LMYA 3WH5A 4QSHA 4OU1A 2O9OA 2ZA1A 2FVKA 3OLDA 2WJDA 3ITXA 2PF0A 1AVAA 4DWDA 4JYDA 4S23A 1WUEA 2R1PA 2EQDA 2JQXA 2WHKA 3GM8A 3W1PA 2XGBA 1AH4A 4NASA 4OUIA 1LWJA 1W37A 1QATA 2WJEA 2OEMA 3QYSA 3QV8A 1W8SA 4HKPA 2EG6A 1IEWA 3QOMA 2DZAA 1U5HA 3GC2A 1NQKA 3KL5A 3SY1A 4YCPA 1RP8A 3EYPA 4QFUA 1I2PA 1P1MA 2W0UA 5F2GA 2OZTA 3LM3A 4IH3A 4YHEA 3N11A 3VUPA 4PMJA 4GG9A 1M1BA 2VGBA 1XRFA 3P62A 2YEPF 1ESWA 4WSKA 2PLKA 3BLDA 5AC5A 5FI8A 3RR4A 4XSMA 1Z41A 1NWRA 4QEHA 1EUNA 4XAGA 3W1NA 2Z27A 1EEPA 3MS8A 1FDZA 2HBXA 2VC7A 3VDCA 3T05A 2GUBA 4RUBA 1UR8A 1G6CA 2IS7A 3F5KA 3AUJA 1JDEA 4W8LA 2JIEA 4QG6A 4AVOA 4DF1A 2A85A 4RE2A 4GY0A 3TQKA 1X7FA 1I2OA 3GVRA 1WE5A 4L4LA 4XD4A 2CKRA 1E0UA 4X22A 4JFSA 1UR2A 4EXAA 1U2YA 3CUHA 5HR6A 3A12A 1K6AA 3HV8A 2ZRUA 4W9TA 4FLRA 3CO8A 4KH2A 5BNKA 2FZMA 4ZOCA 2GJPA 1CGUA 3AIRA 2BXYA 2OZ8A 3IUIA 4B16A 3ERPA 4PTMA 4BQ3A 4QDPA 1PKNA 3GD6A 1GYLA 4KF1A 2VFIA 3NVDA 1W5QA 1C91A 4LH8A 4UB9A 3O2LA 2UY4A 4C6EA 4JOMA 1TPWA 1B90A 4B3KA 4Y9OA 3WLMA 2FIQA 4ERIA 1LUCB 2XPKA 1TCMA 2WNWA 2HTMA 1RBOB 3C2YA 4WIWA 3O05A 1WDRA 3N2CA 1QHZA 4RL3A 3LMZA 3VZYA 2LLEA 2YBUA 2X1IA 3HB9A 2VEPA 1E55A 1QBAA 4R7WA 4PUKA 1SJDA 1TIMA 4LF2A 3G6LA 3QC0A 3DG6A 2DUAA 3T44A 1W3HA 2PP0A 1SFJA 2D0FA 3BAYA 3CEPA 4OBTA 4PTWA 1EIXA 4Z17A 2CNCA 4NSBA 3LA4A 4XWUA 3B8DA 3OQ8A 1ISZA 4C6KA 1RPKA 1J12A 5EMKA 4M80A 1EUAA 1VLWA 3B8WA 2DJLA 4ORIA 1ITQA 3VIHA 3THAA 4YNGA 4QJ3B 3L5MA 3A23A 5EMUA 3KBSA 4JDYA 2PTDA 3D5HA 5CJNA 1JFXA 1RLDA 5JBEA 4NIRA 4OKDA 1TPH1 2O4QA 1GZGA 1BRLA 1AL8A 2RJHA 4C6PA 1XLHA 3ARQA 1F1SA 4NJIA 5LIXX 5H8UA 4KBXA 3ZT7A 3EDKA 3HPZA 4IP7A 4TIMA 1T5AA 3EWBX 3L65A 3T08A 2ZVIA 4GMEA 3S5YA 2PU0A 4B2DD 4JEJA 2BG5A 1R87A 1TV2A 4WK9A 4MGGA 2WBGA 4XZBA 2BRWA 2V5LA 4JN7A 4GH3A 3RYSA 3W1UA 3VD5A 1IXOA 4HZMA 4LB3A 1T0OA 5HWMA 4N2YA 5HNNA 3II1A 4EACA 2CLKA 4IX2A 1JZ3A 5LA0A 1EP3A 1OX4B 1QNOA 4IOTA 2G95A 4NNCA