2WMGA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in complex with the lewisy pentasaccharide blood group antigen.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
555
structure length
553
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIANYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLKGHHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 199
structure length 553
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmgA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmgA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmgA02
3CUGA 5EBAA 5KZ6A 3EDFA 2BRVX 1LL4A 3FAWA 1TG7A 3WMCA 1W3JA 4LPCA 3DHUA 2O9PA 4J28A 4RE4A 1QW8A 5LYRA 3VIGA 4NF7A 4TVCA 2WCGA 4D6DA 2J7BA 1A47A 1KXVA 3PZQA 4JCLA 2ZXBA 3AYSA 3GH5A 1P6WA 3UR8A 4PMXA 3CZGA 1C91A 1NP2A 2BFGA 2NT0A 1LF1A 3UR7A 5A6BD 3ZJKA 2YL5A 1CGWA 2ZIDA 3WH9A 2CITA 1H1NA 2DH2A 4ATWA 4AZ6A 5I77A 1HM3A 1QI2A 1MXGA 4W86A 1CIUA 4CVUA 3BGAA 1J12A 1QI4A 4WSJA 3GXMA 3MKKA 1RH9A 2WHKA 2JEPA 3MMDA 4OJYA 4WK9A 4M82A 3WD0A 1UKSA 2DT0A 2G3IA 4GI6A 3AZRA 2UWFA 3EMZA 3QGVA 1HJXA 1MXDA 3ARRA 4KGLA 1V3MA 1B30A 4DUVA 1G94A 2Z1KA 3ARSA 4B3LA 1PIFA 3BCFA 1C90A 2VT0A 1MYRA 1TR1A 2Q8XA 3W6LA 2XWDA 5E6ZA 2E9BA 1GOMA 1TCMA 2YIHA 3WFLA 2XVKA 7A3HA 2O9TA 4N0RA 4DUWA 1NOWA 1E73M 4FLOA 3A4AA 2FGZA 5A6AA 1VFOA 1JZ2A 5AY7A 3BMWA 3VO0A 1E9LA 3VIJA 4Z2HA 2D0HA 1OGBA 4UQ9A 1GOOA 5BROA 5A8QA 2XFFA 1WZMA 2CXGA 4CVWA 3TA9A 1YHTA 3ALFA 3SCNA 4Z2GA 3K4AA 1UOKA 2VZUA 1MQQA 3MUZ1 4DWSA 4OBSA 1KWGA 2PWEA 1EDTA 2W62A 3O9NA 3QOMA 1IT0A 2YBTA 1GQKA 3AROA 2F61A 4U31A 4V2XA 4W88A 3O2LA 5GQBA 4UNIA 3NDYA 2IUZA 3MV11 1HJWA 4M80A 1W1YA 3MSDA 3DYMA 1W9XA 1BYDA 1V3HA 1GQIA 3ARYA 2X05A 1H3GA 1HXJA 5ABGA 4FK9A 5GPRA 2Y8VA 1U30A 1EDGA 2G3MA 2PWFA 3BLPX 1Y7VA 2YKKA 3OIHA 3PZMA 1UD4A 3FN9A 4TOQA 1JAEA 5CJ5A 5ABFB 4UFHA 5M03A 3F5LA 2GDUA 4JFSA 1QNPA 1OJOA 3AXIA 7CGTA 1EGZA 1Q6FA 4CU6A 3PZ9A 5ABFA 2W4XA 3WNOA 3VD3A 2F2HA 2XPKA 2W63A 2PWDA 1N7NA 1UR2A 1OJMA 3QR3A 1V6UA 2JIEA 3L4WA 1PJ9A 5GNYA 1Q4NX 4PMZA 4PMNA 4JFTA 3WY1A 4BZYA 5A8NA 2YA2A 1C8QA 1JGIA 1DWIM 1RW9A 4M56A 4UOQA 1LL7A 4M29A 3WDIA 2WW5A 1M01A 3VD5A 1AQMA 3TOPA 5IFTA 1CXFA 1UHVA 5EMYA 2WC3A 1LG2A 2AOSA 1F4AA 2GJXA 1X6LA 1Q6DA 3K46A 2YL6A 1M03A 1DWJM 2CETA 4WLCA 4ZENA 3WUGA 2UY2A 4H04A 1XSIA 4UTFA 1FOBA 1E56A 3CH9A 3NIYA 3WQ5A 4UQEA 2TAAA 1ZB5A 4AC1X 3E1F1 1WP6A 4JL1A 3AIEA 1JZ8A 5ECUA 1KBBA 1Z32X 4D6JA 3ZMRA 3PBGA 3SCTA 4E4PA 1FH7A 3IAPA 4ATDA 1BG9A 1B3YA 2DT2A 4AIEA 3AHXA 1IZJA 3VNZA 1XD0A 3PZVA 5BXTA 3CZLA 4D6IA 1GZJA 2VR4A 3AFBA 2Y8KA 4HMEA 3EDEA 2A3AA 3AIQA 1H41A 3VPLA 4W5UA 4WKHA 1JF6A 5E9AA 3VX1A 3DC0A 2A3CA 4L4OA 6CGTA 1KQZA 3CHFA 3TONA 3L4TA 3A4WA 1TUXA 2DQXA 1KXQA 4AYSA 5CGMA 3AZSA 3PTMA 3WD4A 1QPKA 2CHNA 1XRVA 1FFRA 4CD6A 1JZ4A 2GJPA 3QHNA 5C71A 1DP0A 5A6MA 5HPOA 2W91A 1OINA 2VZTA 2CIPA 4GI9A 1CBGA 3MUIA 1NOUA 1JI1A 5AYIA 1UKPA 4GZEA 2WHMA 4HPHA 3ECQA 1BVNP 3AICA 1E6QM 3L4XA 2VJXA 4XUYA 4HA1A 4WKAA 4OKDA 5IXEA 2WK2A 2ZWYA 2ZOXA 1BGAA 1WE5A 3GZAA 5D9OA 1UYQA 3AHZA 2CPUA 1E6ZA 2CHOA 4AD4A 1PPIA 3VDAA 1ZBKA 2XM1A 3UESA 4W8BA 1FP9A 2YLLA 1VFUA 3OB8A 3PN8A 3UCQA 1RWAA 1R86A 1UWSA 3VU2A 3T09A 1BPLB 3SCOA 2VVSA 4D6CA 2V3FA 1XH1A 2J79A 1LLOA 2F8QA 1UWIA 4ZE4A 2CKSA 2VZOA 3W27A 2DT3A 1V6YA 3VMNA 3GNOA 3F4VA 3EDKA 4IM4A 5CLTA 4PMQA 1GOKA 3WD1A 3VUPA 1J0NA 1OJPA 1CXKA 1AVAA 5DT5A 3ARZA 2QPSA 3WF3A 3VDBA 4KMQA 1VBUA 3W81A 4TX8A 4H8UA 3WQ4A 4U5IA 2C0HA 1W3LA 2GJRA 5ABHA 3VIOA 3SUWA 3LMYA 1V03A 2VRJA 1KGWA 3AMCA 1J9YA 2V3EA 1K6AA 1G1YA 1UZ1A 3EDJA 5ABEA 1H4PA 3AHTA 1E0WA 3GH7A 4AD3A 2W92A 4W8AA 3VILA 3ZJ7A 1VAHA 3GH4A 4PN2A 4MJ2A 3GTNA 1UWQA 4X0NA 2XIIA 1DWAM 4HA4A 5DF0A 1NOFA 3VIHA 1TA3A 1E5NA 2EBNA 2YBUA 2D22A 1J0JA 1K9DA 1RD6A 1RWCA 3NSNA 3F5JA 4MB4A 1LXMA 3RM9A 1HKKA 1K9FA 1HJUA 5A94A 3AISA 1MW2A 5JBDA 1QW9A 1PEZA 1WDPA 4LXFA 4HOZA 2XVLA 3AS1A 4UQAA 1PX3A 2FH6A 3BAWA 4ACYA 3A3HA 2CBIA 3POCA 2WVVA 3PTQA 1JXKA 4P8VA 4GO8A 1F1SA 3WF4A 1YQ2A 3RM4A 1KQYA 4WJXA 2WSPA 2W67A 5JBFA 1E5JA 1JZ6A 3WD3A 1GOQA 4XZBA 4Z2KA 3GNRA 3A4XA 1HKJA 1G5AA 1XSKA 1K9EA 3KE0A 3VGFA 4ZFMA 1FHDA 4AZ5A 4PCSA 2BRPA 1WZAA 1OJNA 1WKYA 5FOOA 3ARWA 3WDJA 1CPUA 1E3XA 4D6HA 1OD0A 4U2YA 7TAAA 5A6JA 1GJUA 4AY1A 5IHRA 3OGVA 4PEEA 3ZJ8A 2VCBA 4LYPA 2DSVA 5JIWA 3L2LA 1ZU8A 1V3JA 2VO5A 2ESCA 5E09A 4ZXOA 1E6PA 3T2OA 2OYLA 5E70A 3W26A 1B9ZA 4FMVA 2E9MA 3AS3A 4CCDA 2ZUSA 3L4UA 1PIGA 4AZBA 1B31A 3CZEA 3IJ9A 3W29A 3GNPA 3B8SA 3CLWA 3U7VA 3WENA 1CXLA 3FAXA 1UH2A 4V27A 4JL2A 4UCFA 1W3YA 4RE3A 3VIKA 2RGMA 2J75A 3PZIA 2VI0A 3ARUA 4UZUA 3N12A 5GNZA 4YHEA 2X1IA 3AHVA 4U5KA 4LX4A 1CDGA 4MAVA 1V0NA 1OIFA 3UEQA 3BAIA 3WBAA 2J7HA 4W87A 3L4VA 3PZUA 1M7XA 5I3DA 2YA0A 4P7QA 1B3VA 5I0DA 1HMUA 2ZUTA 3MSGA 1MFVA 1GVIA 1E72M 4QDMA 1J0IA 4GI8A 5FD0A 1BSIA 4QCFA 1ISXA 3NUKA 1VIWA 4C7DA 4JCMA 1DWGM 1OD8A 4HZ6A 4UR9A 4KH2A 3CMGA 1NWUA 1O6IA 2QHAA 3WUEA 2ZX6A 5A3HA 3AZTA 1HJSA 1ZL1A 2CEQA 3VGGA 3W25A 1XSJA 5AYBA 3AI0A 1CB8A 2YDSA 5AC5A 2WBKA 3RJXA 2BVDA 1JD7A 5BXRA 4TVDA 4AD1A 1X1IA 1ZBCA 1UKTA 1DHKA 4TVUA 1RP9A 3BAJA 3TTQA 3GDBA 1R87A 1CXIA 2J7FA 1JZ3A 2J4GA 2X8RA 2DIEA 1UKOA 3DYOA 4J3TA 4M8UA 3VNYA 4B9ZA 3WH5A 3FW6A 2X03A 3WNPA 3CHEA 3VD9A 1FH8A 1E6NA 1OCQA 1US3A 2VCAA 4R27A 3LPPA 1N7RA 3MO4A 4P7RA 2VR5A 3W37A 1V0KA 3VINA 1LOHA 2ZUWA 4W89A 4UQDA 1HJQA 1K9TA 1PZ3A 1VJZA 2VX4A 3LPOA 4UZSA 3MV01 3VX0A 2YL9A 2WSKA 5F7UA 4XZWA 2BY1A 3OA5A 4JHOA 4PYSA 6TAAA 3RILA 2CKRA 2XIBA 2BY3A 2XTKA 2UY5A 1TZ7A 3MU7A 2O9OA 4P8UA 2J77A 1XCWA 1GONA 3GM8A 4BQ3A 3AIVA 5HXMA 1H49A 4W7VA 1ISVA 4UFMA 4YN5A 3WL1A 3VGHA 2UY3A 4JAWA 2WMHA 3OLIA 5E0FA 3GXFA 1W9BM 4DM2A 2XGBA 4AD5A 1ECEA 4KWUA 3SUSA 4EK7A 1UR1A 3WL0A 3VIFA 3AIRA 3ZSTA 1H11A 2VURA 3ARXA 1V0LA 4JFUA 3APGA 1HP5A 2BNJA 1WDRA 3MS8A 3G6LA 1XV8A 3RDKA 5CLWA 4P8XA 4MJ4A 3I3EA 2XVNA 2EQDA 1J18A 4IPLA 3AS0A 5A6SA 4HZ7A 4Z2LA 3WH8A 4WF7A 2WB5A 3FNDA 3UG3A 1QBAA 4BA0A 3N17A 5I24A 3L4YA 3UERA 3GBEA 2YDQA 2MANA 1BF2A 2VRKA 1JYVA 1JG9A 5D9MA 1GW1A 2ZWZA 1WAWA 2WMJA 3EBVA 5IFPA 4PMDA 5LA2A 1VJSA 3WNKA 2WZEA 3NJ3A 1OT1A 2QLYA 3M07A 5FCZA 1JFXA 3MANA 4NSBA 1UR9A 1J0MA 4AD2A 1HMWA 3SUVA 4EANA 2V38A 1MFUA 1QI3A 1OIMA 1QBBA 4U33A 2WCAA 1OT2A 1OBAA 2ZXAA 1VEPA 4LQ1A 4ZXLA 1Q6CA 1NARA 2G3NA 2BXZA 3RIKA 1EH9A 4MADA 1Q6GA 1BFNA 1CXHA 4D1JA 4BS0A 2ZX7A 8A3HA 2CBUA 4ZE5A 1I75A 2XFYA 4XB3A 5A1AA 2VL4A 1GCYA 2OWXA 1LWJA 2G4FA 1JF5A 2J7GA 4D72A 2EPMX 1HKMA 2AMGA 4YHGA 4H2CA 5A8MA 3K8KA 2WDAA 2EXOA 1FA2A 1VB9A 4WIWA 2BXYA 3VVGA 1CTNA 1CECA 1CLVA 3I3BA 4IISA 4J3VA 1AQHA 3SUUA 3M7SA 3SUTA 4B3KA 2VMFA 2V3DA 4CD7A 4XX6A 2J47A 3WH6A 3HU7A 1E3ZA 1PBGA 3ZM8A 3WMSA 3IJ7A 1BAGA 4AIUA 3K8MA 2WBGA 1UD6A 4BQ4A 1KB3A 5GNXA 2IXVA 2GK1B 1UA3A 1AMYA 4QCEA 3PTKA 4E8CA 4GXPA 2NW0A 1TE1A 1F4HA 2VTFA 5BCAA 2HISA 4OUEA 2WMKA 2GK1A 1E55A 5I6SA 1BGGA 2PB1A 1W2VA 3SCRA 1XGZA 1G9HA 3EMCA 3TTSA 3AOFA 3VTRA 1EHAA 1LWHA 1W3KA 3D5HA 2GSJA 1UWTA 1DTUA 1EDQA 1HVQA 1MW0A 5HPCA 4FLQA 3ZT6A 2CERA 1UWRA 3PZTA 5A6KA 5LA1A 3NYDA 3OBAA 3RPMA 3WNNA 5BXPA 4PMRA 4D6FA 2WVUA 3VDHA 3UG5A 1JDCA 4JZ5A 5A2BA 1W9PA 3ARTA 1HVXA 1ISWA 2XWEA 3N1AA 2EPOA 1BYAA 1QNOA 3BC9A 2X0YA 2XGIA 5C8BB 3FY1A 1J11A 2WHLA 1WDQA 3SCVA 9CGTA 1UQYA 2VC9A 3N9KA 4CU8A 2XHYA 4Z2JA 4W5ZA 1N7QA 3W28A 3WQWA 1VENA 2OLHA 5CGTA 1KR1A 1WZKA 3WF2A 1V02E 2QV4A 3CUHA 1OGGA 4QP0A 1NH6A 4NRRA 2X2YA 4AZCB 1C7SA 3VM5A 1C92A 3CZKA 1J0KA 1FHLA 4TUFA 2VVNA 4H41A 3PHAA 4DUXA 2Y2WA 4AZCA 1H5VA 2ZXDA 2JIWA 1HKIA 1OM0A 2J78A 1RWGA 1A3HA 1J01A 1CWYA 1B3WA 2NT1A 5JUVA 1C93A 1CGYA 3CUIA 1TFVA 1W32A 1VRXA 4MNLA 4ML4A 3N15A 2FH8A 3BLKA 2ZUVA 3T08A 1G01A 4PUDA 3BCDA 4W93A 3I3DA 3RJYA 5EB8A 3LPGA 4DWSC 1CGXA 3N04A 1V02A 1JXJA 5A2AA 2QMKA 1N7OA 2EO7A 3VIMA 3VD4A 4A3YA 3RM8A 1E4IA 1CGUA 1QNQA 2XYLA 3SCPA 1EOKA 4RL3A 4QLKA 1WZLA 2E8ZA 1ISZA 4CCCA 1MWOA 2WC4A 1E4LA 1VFFA 3QHMA 2DSWA 5IDIA 3VOCA 3WNMA 1BVZA 5IHSA 3WUBA 4CN6A 2E24A 1QNSA 1E1EA 3CTTA 2FHBA 1X1NA 3AIWA 1UR8A 3FHAA 4JFWA 4PRWA 3M6DA 1UR0A 4KRTA 5I2UA 1ISYA 1OWQA 4P8WA 2WZHA 3ALGA 4GQRA 2D3NA 1B0IA 2D20A 2BHYA 1W9DM 4ACZB 4AIOA 1WDSA 1KXHA 4J3UA 2V5DA 3DYPA 2W66A 2BS9A 1NWTA 2FGLA 3W0KA 3ARPA 4F8XA 4Z2IA 1BLIA 1GORA 4ACZA 1E1FA 2BV9A 2YLAA 5CPTA 3POHA 1C82A 1GVYA 4QFUA 5M3WA 1ZBWA 5I5RA 1QHPA 3HN3A 1E6RA 3D3AA 3CUJA 3VDCA 2D1ZA 5HDRA 1JFHA 5C70A 3DECA 3QHOA 3WQ8A 1HIZA 1KWKA 2IXUA 3GYCA 4FLRA 4C7GA 3UG4A 1UD2A 1V6XA 4HZ8A 4PTVA 3EDDA 2A3EA 2FHCA 1H09A 2WKGA 3OGSA 4UFLA 6A3HA 1MVYA 1JZ7A 1JNDA 3VKKA 4B9YA 3OZOA 1F9GA 5FKYA 2ZICA 2PWHA 4W7UA 3SCWA 1W9UA 3BMVA 1NWRA 4FLSA 2C8NA 5FL0A 2PC8A 1W3HA 1CXEA 3WEMA 4JIEA 4CCEA 2JF7A 1KBKA 2WZIA 3NSMA 1UG6A 2PWGA 3NCOA 3FXYA 3UETA 2XSAA 4GO9A 4HMDA 1OSEA 4UFJA 1V3IA 4MNKA 2WVTA 1TVPA 3SEPA 2G3JA 2BHUA 1UD3A 3WIJA 4NZCA 5DO8A 4OZOA 3KL5A 2BHZA 4MB1A 4HU8A 2JE8A 1J0ZA 5CG0A 3THDA 2WANA 1QVBA 2JALA 3T0DA 1MQRA 4MPKA 4BQ2A 2WC7A 4IUGA 2CNCA 5CXPA 1E4MM 3WF1A 1C3FA 2VUYA 3IAQA 1SYTA 1D7FA 2YL8A 1EO5A 3CIVA 5CSYA 3F5KA 2JEQA 4AISA 1XYFA 4U2ZA 4QLLA 5FIPA 1BYBA 1XYZA 2OSWA 4XV0A 1KR0A 1JIBA 4Y7EA 2YDRA 5DT7A 4D71A 2BVYA 1B1YA 3DHPA 3N11A 4F79A 4GQQA 5HOSA 1W2PA 1D2KA 2VRQA 1UD5A 1RWFA 1H0GA 3W24A 3GXIA 2E8YA 1CGVA 2J8FA 3WDPP 1JAKA 1WB0A 3WEZA 2OSXA 1E71M 3B9DA 4W8LA 4M24A 1EGUA 2CBVA 2YOCA 4J3SA 2JF6A 3K1DA 3AMDA 4TTUA 1G0CA 3BAXA 4KGJA 1R8LA 2XVPA 5A6LA 2FDMA 4AZGA 1V3KA 4NI3A 3WQ6A 3HJEA 4UQBA 3T0BA 2G8ZA 2O9RA 1E6SM 4R5EA 1V6VA 3NDZA 4F66A 4E8DA 2VZSA 1GHRA 3U57A 1IV8A 5JIPA 2NSXA 5D4YA 4OBRA 4V28A 3WELA 4EKJA 1B2YA 1MW3A 1FP8A 1NWSA 3PZGA 2J7CA 1JD9A 4X0VA 5TD4A 4HMCA 1CYGA 3WDHA 5KEZA 1XC6A 2BY0A 2BRWA 1FH9A 1AQ0A 1PX8A 3W6MA 1IZKA 4MTVA 1WCGA 1RP8A 1R85A 4OOUA 3A6OA 3ZJ6A 4OOZA 1CNVA 1UR4A 2EPKX 3KEHA 2G41A 1LQ0A 4CN4A 1BHGA 2WKLA 3HMCA 5D9PA 2D3LA 5M5DA 1E40A 3TP4A 2VOTA 1L8NA 4PMYA 2XG9A 4CN1A 1HJVA 2QPUA 5BXSA 4MNJA 1EQCA 1NQ6A 4GIAA 2E9LA 1JZ5A 4D6EA 1E4NA 1BYCA 1I8QA 3AIUA 4PBGA 1QNRA 4CU7A 4AEFA 3ZQ9A 5D9NA 3WN6A 1B3XA 3WMBA 1E15A 5D8WA 2XFRA 5A69A 2Y24A 4W84A 1J10A 4Q7NA 4J3XA 1GPFA 1UA7A 2J74A 1HF6A 5BRPA 2YA1A 2GDVA 3ARVA 3WEOA 3B9EA 1JYXA 1UH3A 1VFMA 2FHFA 2Q1FA 4UOJA 1WPCA 5E0CA 2AAAA 3CHCA 3ZOAA 3W38A 2PF0A 4JKMA 2WPGA 3M46A 5EFFA 1C7TA 4DWSB 2OSYA 3J7HA 1N7PA 4HA3A 3W82A 1OB0A 1UWUA 1EOMA 3ZR6A 3A47A 4P7OA 4GPNA 2W5FA 2OYKA 2ZUMA 4F9DA 4C7FA 2J7EA 3N18A 1UQZA 4BF7A 8CGTA 2DPEA 4WKFA 3VD7A 2GUYA 3CGTA 4D1IA 3AMGA 4LYQA 1MQPA 4L4PA 3WQVA 2C7FA 2VX5A 1GUVA 2XM2A 3CBWA 1L0PA 3RMEA 4JHZA 3RCNA 2V5CA 1W1PA 3T2QA 5CSUA 1GQLA 1VF8A 3BSGA 1X1JA 3ZIZA 1LJYA 1ITCA 3AMKA 3ZO9A 3WNLA 4H8VA 1DWHM 1TVNA 5DFAA 4URIA 4PUEA 3SCQA 2UY4A 1N82A 1DEDA 2GVYA 2WLZA 2VQTA 5DEZA 2VZVA 3WF0A 1WO2A 1U33A 1J0YA 3ARQA 3EMQA 5CPSA 2XUCA 5JBEA 4AZHA 4M1RA 2VQUA 1E43A 3VGDA 4M81A 1KXTA 1GJWA 2XVGA 5CPQA 4YPJA 3CHDA 3BAKA 1UD8A 2JFEX 4TX6A 3S2CA 2WMGA 4CKQA 4EAMA 1V3LA 2CYGA 3FHQA 2DT1A 2DIJA 2GJXB 3G6MA 3O6AA 3ZR5A 3AMLA 1W91A 2A3BA 3VGEA 3RO8A 1JYNA 4AMCA 4IPNB 2RGLA 4UFIA 4PMUA 1BG4A 1DWFM 4ZEPA 2W61A 4EE9A 4D6GA 5BRQA 3KL3A 2WM0A 2CBJA 3BAYA 3K8LA 4QLJA 1UKQA 3CPUA 2DSUA 5A2CA 2BY2A 2D0FA 2X0HA 4KRUA 2Y5EA 4AZ7A 1PZ2A 1ZBVA 2B31A 1HL8A 3WDRA 2DGAA 2ZX9A 5M17A 1ODZA 1SMDA 3PZNA 1WNOA 1HX0A 1QHOA 4MAZA 1ZJAA 3ZSSA 3TTYA 1SFSA 4J7RA 3SCUA 4PTXA 1S46A 3IK2A 3S6TA 1H0IA 3QOKA 2WHJA 3GXDA 3ZT7A 1RWHA 1ODUA 4PTMA 4AZIA 4B15A 4HOWA 4HTYA 4TTGA 4PTWA 1HM2A 4OIFA 5A8PA 1CEOA 3TTOA 4JKKA 1HP4A 2WCOA 4MDPA 3CZJA 5HBFA 5A95A 1B3ZA 3PZOA 5A8OA 3SURA 5D8ZA 3VM7A 3SIMA 4H8HA 4ATLA 1PX4A 3JUGA 1MW1A 4F9JA 1KGXA 1LG1A 2E40A 1GHSA 3GBDA 3IJ8A 4DWSD 1H2JA 1UUQA 1EXPA 4PSRA 3OZPA 2QF8A 5CZKA 2DH3A 2D2OA 3BSHA 4A3HA 1ZJBA 1PAMA 1GNXA 5I79A 2XJ7A 1GOIA 4U3CA 1E0VA 1JYWA 2X09A 3MMUA 2OYMA 1JNEA 1R7AA 3AQUA 3B9AA 2ZXQA 1JL8A 4PCTA 3VIPA 2WNWA 1ZS2A 5CQ1A 1NM9A 3CMJA 3MMWA 2Y4SA 1BQCA 3WUFA 4AWEA 1V0MA 2DSZA 4A4AA 3AJ7A 2WMIB 1O7AA 1V6WA 4NRSA 3VMPA 2O92A 4GZIA 4HOXA 2WCSA 4W7WA 1GOWA 2WMIA 4HP5A 3WBEA 2VNCA 1UH4A 3BH4A 2BVTA 5DMYA 2Z1SA 2WAGA 4GZJA 1LXKA 4U3AA 2E4TA 1HL9A 4Q22A 1D3CA 4GINA 2J25A 4CGTA 1QI5A 4S3KA 3L4ZA 3AXXA 3OLEA 2GFTA 3AIBA 3L2MA 1EA9C 2E22A 3AXHA 3OLDA 3WKZA 1E6XM 3U7BA 4PMVA 2WWDA 4UQCA 1OGSA 4JKLA 1EIBA 1FFQA 4RE2A 4CD5A 2OWWA 4K68A 1E0XA 4QAWA 1EQPA 1EHNA 2D0GA 2ZUUA 2VCCA 1XD1A 3VGBA 1JDDA 2CCRA 1M53A 2YJQA 1TA3B 4CUCA 3MUAA 5AC4A 2VX7A 1SMAA 5I23A 4AW7A 1E70M 4FF5A 4MNMA 1U2YA 3EYPA 4BQ5A 4E2OA 1QHZA 4CD8A 2OWCA 1C8YA 2PBOA 3LPFA 4UFKA 2D23A 4S3JA 5A6BA 1XCXA 3WSUA 1XHGA 1QOXA 2WVVB 3N13A 1NP0A 2PBGA 1KGUA 2WYSA 1VBRA 4MB3A 3II1A 4LYRA 2E3ZA 1CZ1A 2WXDM 3U5YA 4P7NA 1LL6A 5HNNA 3AYRA 4WSKA 2QMJA 4W85A 3OGRA 4PSPA 2DEPA 3W53A 3VMOA 1C8XA 3ZT5A 4AXNA 1CGTA 3KWXA 3SCSA 2V3GA 4J27A 3IANA 4HPGA 2ZE0A 1J0HA 1ITXA 2J7DA 3WD2A 2EPNA 4N42A 3T0AA 4PMOA 1US2A 1M04A 3OLGA 1CENA 1X1HA 2WLYA 4TXEA 1XH0A 4BCEA 4H7VA 1HN1A 3CZ8A 1ESWA 1VEOA 1HNYA 2ZX5A 4B16A 3U5UA 1TMQA 2HVMA 4JFVA 2D24A 1B90A 4MDOA 4GKLA 1BTCA 4MB5A 5EFDA 4CD4A 5BYWA 1HT6A 5FL1A 4UOZA 2DDXA 1W1VA 3WFZA 4AEEA 1I1XA 3AS2A 1JDAA 1Q6EA 1VEMA 1KCLA 3NSXA 3OG2A 2CESA 1QI0A 1GQJA 5LA0A 1JI2A 2WWCA 4LGXA 1XH2A 2EEXA 1SR0A 3KL0A 1EO7A 3AHYA 2J8GA 1CLXA 3THCA 2ZUNA 3WH7A 3BXWA 4X9YA 1I1WA 1W1TA 1KFWA 1X6NA 3KZSA 4J3WA 2DSKA 2XSBA 2PI6A 5E6YA 3VIIA 2A3HA 2WVSA 4P7LA 3WDQA 2VX6A 2EPLX 3MUY1 4AD0A 2ZX8A 3CO4A 3K4DA 3T2PA 1R7OA 1V08A 1KCKA 4DM1A 1HN0A 4HU0A 3W4RA 5BWFA 3CUFA 1W9VA 2EJ1A 5I78A 2E0PA 2J62A 2WMFA 1RPKA 1UZ4A
chains in the Genus database with same CATH superfamily
3HPXA 4C6MA 3CUGA 1LT8A 3EDFA 1LL4A 3FAWA 1F2JA 1IR1A 3CAVA 3WMCA 4JX5A 3TAKA 3KCJA 1BXNA 4P61A 5LYRA 4NF7A 4TVCA 2P53A 3EX1A 2MNRA 2ISSA 1A3WA 4JCLA 1TJ2A 3SY1A 1D7KA 1NF7A 1P6WA 4PMXA 4OECA 2NT0A 3UR7A 1BWKA 2R1MA 1EJVC 3ZJKA 2YL5A 3C4UA 1PYFA 3TYCA 2IQTA 4ATWA 4AZ6A 3N2MA 1Y5XA 1DIKA 3KFTA 4CVUA 4EF8A 4XIMA 3T0CA 1RH9A 4JEQA 2A3LA 3MMDA 4WK9A 4EPEC 3STCA 3CNYA 3AZRA 4TO8A 3V0UA 1HJXA 1MXDA 3M0JA 1K1DA 5EU9A 3PY2A 1DIOA 4WJ8A 3STFA 4RPPA 1C90A 2VHLA 3O1NA 4KEUA 4F4RA 3W6LA 4O15A 3MB9A 1A0CA 3TAOA 5C2XA 1LQ2A 4GVIA 4PBFA 3S9IA 3UD6A 4FLOA 3A4AA 1LROA 3NQCA 1VFOA 4REQA 3VO0A 2QCMA 1F7BA 4Z2HA 3FDKA 4NAEA 1OGBA 2ZZ1A 3MUCA 4L80A 4KERA 5LIWX 3GYEA 1QFEA 3XISA 3K4AA 2ABBA 2VZUA 2XDFA 3MUZ1 3BLLA 1KWGA 5FESA 1YKWA 2W62A 3O9NA 3QOMA 3W73A 1PCKA 1VPQA 2OEKA 3UJRA 4O12A 4DBDA 1Q7QA 4Y9OA 4V2XA 4W88A 1W3NA 3CHVA 3HZ3A 3MSDA 2PDCA 2XH0A 1GQIA 4LF2A 3W74A 1JUKA 4M6QA 1J96A 2OEMA 2FJKA 1U30A 1EDGA 4V1XA 4X61A 1A3XA 2PWFA 2Y5SA 1Y7VA 3BLPX 3PZMA 3C2YA 5CJ5A 1JAEA 9RUBA 5ABFB 2GDUA 1XBXA 5U4NA 4A8LA 5K7JA 2OQLA 1X1ZA 2QV5A 1QR7A 1FWAC 4ILSA 5AHIA 5ABTA 1N7NA 5CKSA 1UR2A 3G0XA 3QR3A 4GD0A 3S5YA 3W1RA 2BBFA 2Z6IA 1Q4NX 3WJZA 3PJUA 1XCFA 4B4FA 3NXLA 4PMNA 1KBJA 5BMXA 3TXZA 3GIYA 1ME7A 1EJWC 1DWIM 2HROA 4KIEA 4UOQA 1GYLA 3W1MA 4YU1A 3H2EA 3VD5A 4DJFC 3TOPA 5IFTA 1O5KA 2WC3A 4HPNA 1XYBA 3RMJA 4GIRA 3SN4A 3KBTC 1X6LA 4LUTA 4DZAA 4WLCA 2C14A 3I6RA 3WUGA 5CAHA 4XAFA 3FYPA 4YTRA 4RKAA 3P8JA 5CAKA 4N9DA 1FOBA 1N55A 2ZRVA 3CH9A 3JU2A 3N14A 3NIYA 3WQ5A 1WP6A 3W1LA 5T8GA 5C2CA 1KBBA 2X40A 4L4LA 2YZRA 3ZMRA 3BOLA 4E4PA 1FH7A 4ATDA 2DT2A 4AIEA 1PHWA 3AHXA 4S3DA 1T99A 3VNZA 1GVSA 1R2SA 3M0IA 2Y8KA 2VFGA 4IIDA 1EC9A 5JXQA 3N25A 4W5UA 4ZQCA 4WKHA 3MDWA 5E9AA 3BLEA 2A3CA 5I3FA 3ABZA 1KQZA 3PJWA 4XWUA 4DPPA 3ITVA 4H9MA 3OG3A 1TUXA 1KXQA 5CGMA 1OG6A 3WD4A 1QPKA 2HPIA 1JZ4A 1EX1A 2XZ9A 3R2GA 3U2EA 1RA5A 4A35A 1RK5A 3LHZA 2W91A 3QMRA 2VZTA 2CIPA 4QJ3B 4GI9A 2Z4GA 1JI1A 4GZEA 2ACRA 3IT6B 2QCDA 4HPHA 2PURA 4ZODA 3AICA 1E6QM 2E5BA 3KDOA 4YVVA 2WK2A 3EX4A 1WE5A 3GLCA 5D9OA 1K8ZA 1E6ZA 3LXCA 4WR3A 2CHOA 3PAJA 1FWCC 3UESA 4UR7A 1FP9A 3PPFA 3E02A 4LNYA 5BOOA 4ZMGA 4C1NA 2PCQA 4A29A 3SRFA 1RWAA 5EMKA 3S2LA 3VU2A 5BU6A 3V5OA 3S0CA 3SCOA 2VVSA 3UA4A 4DELA 4KPLA 2V3FA 4UCGA 4HSOA 3QMTA 3KBNA 2PD5A 5H8UA 2F8QA 1UWIA 2RH9A 4XZ9A 1VRDA 2VXNA 3QY6A 2CKSA 5AC7A 1V6YA 3LBCA 3ISIX 4C6JA 3G0SA 3ZLGA 2QW5A 2GJNA 3W02A 2J9ZA 3CPRA 1LQAA 4Y2WA 3DFSA 2FZ9A 3A64A 4TMBA 4IFKA 3VDBA 2ZVIA 4LT9A 4TX8A 2C0HA 4PUMA 2GJRA 5LIYX 3VIOA 1FDZA 1QPQA 1D3HA 4HK6A 3C3NA 1PUDA 1V03A 4AWUA 1XRTA 1KGWA 4I6VA 1J9YA 2PDWA 5AKQA 4S2CA 3AHTA 1LLQA 5AFDA 4PMJA 3I7RA 4PN2A 1DYSA 5G5IA 3GTNA 1H50A 1AJ0A 2Q71A 4HA4A 5DF0A 3VIHA 1FWBC 1TO3A 2XH4A 2HTMA 2YBUA 1Q5MA 3OP2A 1XIBA 1TB3A 4WVXA 3IGUA 2C1HA 4Q6XA 2HS6A 3RM9A 3UWYA 2FKPA 1HJUA 5JVLA 5KTLA 1WDPA 3L5AA 1ME9A 3WLRA 3BLIA 4C6FA 3W71A 3AS1A 1S5WA 4ACYA 2I14A 2WVVA 3DZ1A 3PTQA 2DVUA 3D3FA 3MKCA 3AWNA 1CB7B 1GG1A 1YQ2A 1S38A 3RM4A 3A21A 3GDRA 1TPEA 5E9XA 1R46A 1JZ6A 4K1GA 1WKDA 4FX6M 4Z2KA 3GNRA 4RV8A 3A4XA 4ALDA 1XSKA 3GUWA 3KE0A 3VGFA 2V82A 4AZ5A 4S3CA 1WKYA 3ARWA 1P43A 1KBLA 2NQJA 3TFXA 1YDOA 1YRRA 1E51A 3QGAC 1E3XA 1LRQA 4DJDC 2R24A 3BICA 5LNWA 2PLCA 4GGHA 4O10A 3ZJ8A 4LYPA 3EX2A 1P6BA 3LN3A 3PF3A 1V3JA 3GXNA 2VO5A 2ESCA 3NQFA 3W26A 4PCNA 4GX8A 3K5XA 4UTIA 3DFPA 2J6XA 4RZ6A 1PIGA 4OBTA 4AZBA 4YJ5A 1S2AA 3QFEA 3WENA 1F3XA 1J5SA 1CXLA 1UH2A 4V27A 1MZRA 4JL2A 1W3YA 4AVFA 1SM9A 4FEZA 4OU1A 1QUMA 2VI0A 3FX4A 4R34A 2Q3RA 3AHVA 4LX4A 4MAVA 2QCLA 2Z26A 3UEQA 1O95A 2J7HA 5I3DA 4GX9A 1WOAA 1MFVA 1GVIA 4A3UA 1J0IA 3ELFA 4GI8A 1BSIA 4QCFA 4E38A 3NUKA 1VIWA 1PVNA 4HNNA 4HN8A 4KH2A 5E5CA 5KZDA 1VPXA 1XWYA 2CLFA 2A5HA 4Q8TA 1ZL1A 4I6KA 3W25A 1XSJA 4IPPA 2OTDA 4F0LA 1JR1A 5F1UA 2R1LA 5T26A 3RJXA 4Q33A 2P76A 5BXRA 2VC7A 1UKTA 5HAOA 4TVUA 5CBJA 4IGMA 3TTQA 1TPDA 1VP5A 2X8RA 1JZ3A 4Z1YA 2DIEA 3CV7A 3DYOA 1QU4A 1W37A 4Z0SA 5C7HA 4Q7IA 3UP8A 1FH8A 2VCAA 1OCQA 3TK7A 5DMMA 3NEHA 1V0KA 2X1RA 4ZSTA 3VINA 1LOHA 2WQPA 1TE6A 4W89A 3QC3A 4UQDA 2C79A 3TSMA 1H7RA 2VX4A 4RDYA 5E93A 2GYIA 2Z00A 4A2SA 3EA3A 4JIRA 3TN4A 1S2VA 4Q8NA 6TAAA 3RILA 4IL2A 2UY5A 3U0HA 2CW6A 4IIHA 5I3KA 2EJAA 3GY1A 3M5ZA 1QJWA 2YCIX 3AIVA 3NQ7A 4XSMA 3V5CA 6TIMA 3VGHA 1GVOA 2WMHA 1BXCA 1TX0A 4FNQA 5AN7A 2XGBA 3O6YX 1QW7A 4EK7A 1T96A 3WL0A 4G9PA 3VIFA 3SQSA 1TPVA 2XFWA 2XIQA 4JFUA 4QE1A 2WNNA 3APGA 3KP1A 3H24A 4LSBA 3TW6A 3G6LA 4C90A 2YEPF 2HNEA 3GVGA 1RCQA 3GR8A 1G4TA 3H12A 1Q2RA 2PDNA 3GG7A 1DORA 1I60A 3EWBX 4H83A 2GZXA 3F4DA 4WF7A 2WB5A 3LQLA 1ZAJA 1Q6QA 5I24A 1FWFC 3UERA 5B80A 3GBEA 2YDQA 1FXQA 1BF2A 1VYSX 3L0NA 8RUCA 3KBSA 2YGYA 2ZWZA 4PBEA 2ZZ6A 1WAWA 2WMJA 3OYXA 5IFPA 3WNKA 4HVXA 3QQWA 3HMJG 3WBYA 5FCZA 2Y7DA 1OJXA 1OFPA 2W79A 1J0MA 4AD2A 3SUVA 2V38A 1MFUA 1P5BA 1OIMA 3BLFA 1QBBA 4OHQA 1RXOB 1OT2A 1KCZA 2ZXAA 1VEPA 4ZXLA 1Q6CA 4QTGA 1NARA 2G3NA 2BXZA 4GCAA 1Q6GA 5DCDA 4HTBA 3R11A 1MO0A 3CPGA 3N2CA 4X3ZA 3O0KA 1PWMA 1I6NA 1H5YA 3DOPA 1GCYA 1QPNA 4FZIA 3MYPA 4DJFD 2OB3A 4YHGA 4H2CA 4DAFA 4UTTC 1EF3A 3H55A 1WOBA 3D47A 4DYEA 1CLVA 3I3BA 1S5NA 1X39A 3UW6A 3H2FA 4B3KA 2VMFA 1O12A 4CD7A 4O52A 1LBFA 3SADA 4C65A 2PZNA 1OFBA 5LNSA 3I10A 3IJ7A 3K8MA 3W7QA 5GNXA 4G56A 4I3GA 4QCEA 3PTKA 1E0TA 1OX5A 1OC5A 4GXPA 3A3XA 5CGQA 3STGA 2P8CA 2HISA 2WMKA 4E8GA 4HU4A 3CYVA 1JUEA 3NZPA 4M5PA 4OGZA 4DPQA 2PSNA 1L6GA 1TRDA 3CV6A 3TTSA 3TC6A 5REQA 3GDTA 3GNDA 1EHAA 1LWHA 1W3KA 2GSJA 1UWTA 3LTPA 4FLQA 3DXIA 3LLFA 3ZT6A 5CJMA 1GKQA 2GGJA 5A6KA 4US5A 2OGYA 1N7KA 3VK5A 3FKRA 1AW1A 5BXPA 5FJIA 2OZTA 1JDCA 3NR0A 4JZ5A 1OYBA 1ISWA 2XWEA 3N1AA 1RALA 1I45A 2Z1BA 4XD6A 3FY1A 5FEWA 3N9KA 4CU8A 4EWJA 4Z2JA 2OMAA 3ZLHA 3NDOA 3WQWA 2IKHA 2OLHA 2VZKB 3WF2A 5IDZA 2QV4A 1NH6A 3LSCA 4AZCB 4RV3A 1OADA 3TJ4A 2POZA 2XH2A 3LHVA 2ZDSA 3N2TA 4TUFA 1O66A 3PHAA 3EOOA 2TODA 2Y6ZA 1H5VA 1OM0A 4MM1A 2J78A 5LIKX 1RWGA 1A3HA 1AK5A 4L1WA 2ALRA 5H1WA 1IEIA 3LK6A 1O5QA 5G1YA 4ML4A 2FH8A 1W1A1 3HQNA 2IKIA 2ZUVA 3T08A 1G01A 2GVJA 3QY8A 3BCDA 3RJYA 4QS5A 1PXGA 4ZVJA 5DXYA 4H8NA 1CGXA 2ATMA 3KUMA 3TNBA 4PTDA 3L12A 4Q32A 4A3YA 2NXHA 4PB5A 3UT0A 3DEQA 4K37A 3SR7A 3LSBA 2BSLA 1AH0A 4BWLC 4WSHA 3T4WA 1EOKA 2OFJA 1TYGA 3LCXA 2E8ZA 3NQDA 3E96A 2I57A 2YB4A 2WC4A 2DUAA 2WJFA 1E4LA 1KTNA 4I7UA 1UIPA 1TJRA 1ZAHA 1DJQA 1ONWA 1EGMA 3LXAA 3N73A 4HYWA 3GC5A 3O16A 3R25A 5I3JA 5I2UA 1ISYA 3ALGA 5JMUA 1GVEA 3L67A 3GTIA 1U1HA 4WZHA 1NWTA 3GW3A 3W0KA 4F8XA 1GORA 4ACZA 3P7YA 2YLAA 3POHA 4S3EA 1GVYA 4QAIA 3FJNA 5M3WA 1ZBWA 3GAYA 5M2FX 3GFZA 3ZVHA 1QHPA 2IPGA 3HN3A 3CQJA 1WX0A 1FHUA 3GSMA 5C70A 3COTA 3IV3A 3QTGA 3P14A 3DECA 1L9WA 1Q13A 4G7FA 1OK4A 1RK6A 3QKEA 1HIZA 1KWKA 2IXUA 4FLRA 1UD2A 1V6XA 4PTVA 3L0GA 3T8QA 3PPHA 2A3EA 5B7ZA 2FHCA 5AHNA 5HWMA 1W17A 4UFLA 2C1IA 4JBRA 1EA0A 1JNDA 3PS7A 4B9YA 1UPMB 5D37A 3F2BA 2GJLA 3S1VA 5MHBA 4DJDD 5FL0A 2Z29A 4JIEA 1ZCOA 2V30A 4XKMA 1UG6A 4DI8A 2PWGA 4C6DA 3UETA 3FSTA 1ZAIA 4KWVA 1GWJA 1V3IA 3S2JA 2YXGA 4ECLA 2OU4A 3VXGA 3PUGA 2WVTA 1TVPA 3W7NA 1G69A 3OA3A 4LAOA 3SDOA 2VZKD 2BHUA 1UD3A 3GDMA 4NZCA 2BHZA 2Z2UA 1JEZA 1SFTA 4HU8A 2JE8A 1J0ZA 2V4IB 2Y8UA 3HQOA 4IIEA 1A5MC 3BCJA 2FTPA 2JALA 5PTDA 1Z3NA 3M6YA 1MQRA 4JTRA 4MPKA 2CNCA 1C3FA 1RJRA 5KINA 6ENLA 1D7FA 3CIVA 3F5KA 3LY0A 2RDWA 4U2ZA 4RZ4A 5FIPA 1BYBA 4XV0A 4UTKA 1KR0A 5I7GA 1DJYA 1BKHA 3PB0A 4JTTA 5DT7A 3TIMA 3P6LA 3DHPA 5HOSA 4KCVA 2PDBA 1UD5A 1RWFA 3IJQA 1I0DA 1H0GA 4HSNA 2V63A 2IKJA 2YW3A 3DFNA 4XAZA 2J8FA 1VFTA 1JAKA 1VYRA 3WEZA 2ZA2A 4M24A 1IF2A 3TYZA 3A24A 3LGEA 2YOCA 3UU0A 1ZTVA 3AMDA 3BAXA 2X7WA 1R8LA 1Z9AA 2FDMA 4GIEA 4AZGA 3H7RA 4MFEA 4Y8FA 4GUIA 3SN0A 2NVDA 1ADSA 2O9RA 4R5EA 2EG7A 2VFFA 3ITOA 4E8DA 1TV7A 3AWOA 5HR6A 3LLXA 2E67A 5HQEA 5JIPA 5D4YA 2CFFA 1MW3A 4MMWA 1NWSA 3NPWA 4RK8A 5FJTA 4A3RA 1BRLA 2BY0A 4QSFA 2VWSA 3NQBA 3CYJA 3KWSA 4FNRA 1RA0A 3E5PA 4WOZA 1FQ0A 2Y5JA 4OOUA 4PTNA 3ZJ6A 2G41A 4NX5A 1G4PA 1EYWA 1RVGA 3HMCA 1QATA 5T9CE 4Z08A 5LXEA 4Q4SA 5M5DA 1RAKA 2DZVA 4V33A 4XKYB 1XQLA 5G4HC 1QAPA 2XG9A 3WQEA 4DNHA 5C9UA 2QPUA 2I9UA 1IXNA 4ENLA 3G3MA 3UZWA 1TV8A 2PGWA 4RXGA 5TNVA 2E9LA 2PDYA 4FNTA 1D9EA 4GKTA 4PC8A 4AYGA 1Q6RA 2BMBA 1E4NA 1O1HA 1I8QA 1RJQA 1QPRA 3AIUA 3VAVA 1MUWA 4C6KA 1OVDA 1JCYA 2YCLA 4ZA0A 3WN6A 4JN6A 1E1CB 2FVMA 1FY6A 1GPFA 1Y65A 5IBXA 3FGCB 2DZTA 3UWZA 1GK8A 1VFMA 5HJLA 2FHFA 4PULA 1TPC1 3R1ZA 3R7MA 3WFAA 5EMLA 3QC0A 2EKGA 3NXFA 4FOKA 2WO5A 3TWBA 1N7PA 4ZO7A 3GD6A 5G2HA 1WV2A 1UWUA 1EOMA 1SQ7A 4FAMA 1WKEA 3RX2A 3HIJA 2ZUMA 1OFRA 3YPIA 3VZXA 3OQ8A 3H2OA 4KETA 4E3TA 2ATSA 4DNMA 1O4UA 1PHQA 4LYQA 3CM4A 3WQVA 1NU5A 2VX5A 2XN2A 3G1RA 3CBWA 3G18A 1I0BA 2V5CA 1A5NC 1GT8A 1W1PA 4ZQPA 1QOQA 1X1JA 3W1PA 3TYDA 3T40A 4ORIA 4PUEA 3L5LA 4Q6JA 3VE9A 1OX4B 2J66A 1ZRQA 1WUEA 5DEZA 1YDVA 2VZVA 3UYCA 2G3FA 1WO2A 3E49A 4YLWA 1AD1A 1XYMA 3B05A 2XUCA 5JBEA 2FQIA 3BOXA 4AZHA 4NJKA 1GTEA 3FLUA 1Y0EA 1KXTA 2XVGA 3G1DA 3BAKA 3DENA 3DG6A 1MRAA 2WMGA 1X38A 1IT8A 4EAMA 1V3LA 2DIJA 2Z2BA 1LTDA 2FVKA 3PWGA 3QVQA 3G6MA 1AA1B 1YPXA 3SM0A 2A3BA 1L2UA 3RLHA 1NIUA 1ZP4A 5DBUA 4IPNB 1S3TC 4PMUA 1BG4A 4WHBA 2W61A 4ASTA 4H6KA 1PS9A 2CBJA 3K8LA 1F6PA 3QN3A 1YTDA 3CPUA 4IZGA 4JTJA 3ICJA 2Y5EA 1PZ2A 4GABA 2CXEA 3OOQA 2P1FA 1KKOA 2B31A 3WDRA 2YCJA 2WJEA 3RU8X 5M17A 1X97A 2NLIA 3E0IA 3NAVA 1WNOA 2J8TA 3RLVA 1RHCA 4MAZA 3GG8A 3LHUA 4DZIA 1SFSA 4J7RA 4EAYA 4F48A 1IGWA 1S46A 1X1OA 1RQHA 3KVLA 3QOKA 4GJJA 1B54A 3D0CA 2VOMA 3S2NA 1RWHA 1QO5A 2CWXA 3PVFA 5M1TA 2VEPA 4PTMA 4HTYA 1L2QA 3GVWA 4AG0A 3BW4A 3QZEA 2OX1A 3TQPA 2ZDRA 1ZQ5A 2ZA1A 4OIFA 1LRNA 4PGLA 3GRIA 4NIRA 4EXAA 2Q8LA 1XIGA 4AX7A 1B3ZA 5A8OA 5HANA 4PA8A 4HK7A 1QOPA 4H8HA 1HO4A 3GAKA 4JTFA 1MW1A 4F9JA 1KGXA 3WBXA 3ATYA 4PSRA 3IT4B 3EA2A 2QF8A 3S1XA 3UVAA 1XJBA 2DZAA 4HHPA 3VYLA 3VCCA 3KM8A 5I79A 2XJ7A 3Q58A 2O4QA 3GNNA 1AQFA 1E0VA 1FX6A 3P74A 3W87A 3MMUA 3RYSA 5D30A 1HUVA 4ERGA 4JOMA 3B9AA 1GJPA 4MG4A 3BOFA 1V0MA 3T4CA 3S8HA 2V9DA 4FHAA 2Z25A 1YBQB 1RLDA 1G67A 1Q6OA 3AJ7A 1MNZA 1MUCA 2NXIA 1HG3A 3UXIA 1XKJA 4NRSA 4GZIA 3O0FA 3TSDA 4HOXA 4JXCA 1GOWA 2WMIA 4JQ4A 2VNCA 4JN7A 3O6DA 5DMYA 2E6AA 2WAGA 4GZJA 1LXKA 4C6IA 4ZO8A 4GQGA 3GVVA 1DV7A 2GFTA 3H54A 1BXBA 3OLDA 3WKZA 1WKFA 2QEZA 4PMVA 1VCGA 5J5DA 4JKLA 4TR9A 4FOJA 1XQKA 4I7WA 5MKGA 2OWWA 1P1XA 3LNPA 1FWRA 3OODA 3EB3A 4U28A 2GL5A 3PNUA 1ONEA 4ZR8A 3B97A 3CQ0A 4GACA 1QMLA 4J35A 1DJXA 4I5UA 4AW7A 1E70M 2OQHA 1NDZA 1IEXA 4BQ5A 5CZTA 3MTWA 2B7PA 4HNTA 5T9BG 3KDNA 2BLEA 3UPMA 1PV8A 2PBOA 1KM3A 3N2OA 1A5AA 1Q65A 3N13A 1NP0A 2PBGA 3BANA 1KFBA 4WJEA 4MB3A 3UZJA 1SZFA 5HNNA 4Y96A 5K9XA 3N2XA 4WSKA 4MWAE 4PSPA 2A1YA 3I7QA 3U3HA 2W6RA 1XFBA 1DQXA 3N2BA 4NG3A 4J27A 1Y5VA 1ITXA 2DZPA 3B8UA 2J7DA 4BJHA 3M0ZA 3OBKA 3SAZA 1M04A 2WLYA 3W2JA 1FDYA 4H7VA 3IIOA 1IEWA 2QUTA 3H4XA 3WLJA 4B92A 2PDFA 1XGDA 3KRZA 2YYTA 4F40A 4JFVA 4KBXA 4MWAA 4LRSA 1I2RA 4MDOA 3TSBA 3KBMA 4MB5A 2I9EA 3CAQA 1HT6A 3L68A 1HKVA 4S3BA 4UOZA 2C0AA 1W1VA 1XG4A 4AEEA 1JDAA 1Q6EA 1K03A 4N2YA 4AFYA 4A05A 3PP7A 1EP2A 1UC5A 3NYZA 1GQJA 4LU0A 2WWCA 4GVFA 1XH2A 3KL0A 1JULA 1IXQA 1H7OA 1EUAA 3BWWA 3K4WA 1RY0A 3NNTA 2PWUA 4HYVA 3W2UA 1W1TA 3QXBA 4J3WA 4FX7A 5E6YA 3VIIA 4LAKA 3IUHA 3MP5A 1RPXA 4ZOEA 1VJIA 3B03A 4AUBA 5CPOA 3W75A 3V1PA 3WDQA 1DTNA 1WDDA 2DY3A 3LTYA 1ZY9A 4DM1A 1DQUA 5F4SA 4NJIA 4E5TA 1YXDA 2NQ5A 1P0NA 5CEWA 1TTPA 3K2GA 1FKWA 4HU3A 2P50A 2CZDA 3HFTA 3URQA 5EBAA 5KZ6A 3O63A 4BFAA 4N7QA 3DHUA 4FOUA 1XLDA 3VIGA 4IFOA 1A47A 2E7FA 4AU0A 1KXVA 3PZQA 2ZXBA 3AYSA 3HPSA 4L65A 2GOKA 3GH5A 2CLMA 4KESA 4F2BA 1SZRA 2FPVA 2BFGA 2R8WA 3EB4A 1LF1A 5A6BD 2ZIDA 3KBUC 1H1NA 5D2TA 1VQTA 4YL2A 2FYMA 2QCNA 1J79A 4QEEA 1J12A 3GXMA 3MKKA 5IM51 2WHKA 4JTIA 1UKSA 4H9ZA 1F5ZA 2UWFA 1GKRA 3B8DA 2A21A 2NUWA 4N9BA 4WDXA 2Z1KA 3TUUA 2W27A 2VT0A 3W2NA 2ZRZA 1R6WA 2PEVA 5E6ZA 3FA4A 4H9UA 1TCMA 1JRCA 3TTEA 5I03A 7A3HA 3QMSA 4DUWA 1NOWA 2BGNE 1Z6KA 1VZWA 3BG5A 5AB3A 5IOBA 1NVMA 3B40A 1E9LA 3FGCA 4LC6A 3VIJA 2D0HA 3OQEA 4UQ9A 1GOOA 4R9OA 2HPMA 5GJPA 1YHTA 4QM1A 4HN4A 3BJTA 1X6UA 3CQIA 1TTQA 3SCNA 4Z2GA 8XIAA 3G77A 3V0TA 2J9YA 4LNCA 2XN0A 2CWNA 5KITA 2YBTA 1GQKA 3THQA 1F61A 3IEBA 4R3UA 4U31A 3O2LA 3C56A 1JRBA 1EFZA 3FJLA 2C6QA 3O06A 3MV11 4LF1A 4M80A 3R4IA 4XVEA 1W1YA 3DYMA 1EYEA 1OCBA 1V3HA 3ARYA 3I65A 3GHSA 2X05A 1OABA 3ABOA 1X98A 3N6QA 2Y8VA 4DJEA 3JZEA 3MY9A 1BWVA 4QQUA 3DDMA 1KA9F 2H8XA 1Q8AA 3H4GA 2WOQA 5M03A 3PWAA 1QNPA 1XIFA 2JGQA 1OJOA 3AXIA 3LHYA 3N4AA 3DGRA 4IWWA 2EF9A 5C9RA 5CSSA 1J6PA 3VD3A 3K13A 1OG0A 3WMLA 1VLIA 2PZ0A 4GY7A 1PJ9A 1NF0A 3TMLA 5AHEA 4I90A 3WY1A 4BZYA 5A8NA 1TPB1 2YA2A 3MI3A 3E0FA 2Y70A 3UY7A 4MY8A 1LL7A 4BI6A 2XINA 4KEZA 2WW5A 1JJKA 3WG6A 1AQMA 1UHVA 2X1TA 3W07A 3N3MA 3W86A 1J2BA 3G0UA 5HQLA 3K46A 4C6LA 3LOTA 5LIUX 2CETA 3L23A 3RUBL 3DFYA 2QDGA 1P0EA 1C9WA 4I5XA 4Q8MA 1NTHA 2H9AA 2C71A 3N9RA 4GLEA 1V4YA 3RITA 3M9YA 1ZB5A 4O19A 3IVSA 4WY0A 4XBSA 3HV8A 2ZTJA 2PS2A 2AMXA 4OWGA 1UP3A 3MVIA 3PBGA 1HTIA 1B3YA 1IHIA 5HUOA 1GZJA 2VR4A 4ZQMA 3ZYZA 4HCDA 3AFBA 1S5VA 4MJMA 2J88A 2A3AA 2WM1A 1SZNA 3AIQA 1NFPA 3WQDA 3VPLA 5DMLA 2MUCA 3E5BA 3DC0A 4B5TA 5JQ9A 3TONA 2F9RA 4AYSA 3GB6A 3APYA 2NLYA 1SW3A 3PTMA 2CHNA 2GJPA 5DCBA 1DP0A 4O0ZA 5A6MA 3CUXA 1CBGA 1NOUA 3C0SA 3BZJA 3TA6A 4JTGA 1DPMA 1H7XA 3ECQA 4DF0A 1QXLA 1SPQA 5IXEA 4XVDA 1AL8A 2ZWYA 3LD5A 3DN5A 1BGAA 4RNHA 3B8WA 4XO7A 1SSDA 1UYQA 2CPUA 2QJMA 1PPIA 3C0LA 2XM1A 2V5BA 4W8BA 3EXRA 1VFUA 4G1NA 2VEKA 1R86A 1O68A 3B3DA 1F8MA 3T09A 1BPLB 1VS1A 2WSYA 2VDIA 3B8VA 3UYIA 2HSAA 4HCHA 3GTFA 1HKWA 1EEXA 2PRMA 3EDKA 3KLLA 1LUCB 1UBSA 1GGOA 3M47A 2C13A 1O94A 3VUPA 1J0NA 3S5ZA 3WK3A 3EEZA 3ARZA 1UIOA 3WF3A 4KMQA 1C9DA 3WQ4A 4GE8A 1GKPA 1XS2A 4DO7A 3SUWA 3LMYA 4RR4A 4NUWA 4MZ1A 3AMCA 2I5GA 2V3EA 3F2CA 1K6AA 1UZ1A 3EDJA 4IG2B 5ABEA 1LORA 1FWEC 1E0WA 3MSYA 3GH7A 2J24A 4GUJA 4LJ3A 2A85A 3UFYA 2W92A 1D8WA 3ZJ7A 2QYGA 4MJ2A 4B2DD 4E3VA 1NOFA 4I7VA 3HG4A 1UCWA 2D22A 1XUZA 3LRMA 1UP2A 1M6JA 1RWCA 2ZZ4A 1LXMA 3T07A 5SWUA 1OZQA 2V2CA 3EOLA 4WRHA 5FA5A 2Z24A 1XPGA 2VEFA 3IWPA 3BAWA 2PP0A 3POCA 1TRIA 3U6WA 3TMQA 1JXKA 5IRPA 4UB9A 3DKJA 4TU1A 4H9TA 4CEXC 4J2MA 1J93A 1W8SA 2B7QA 2ZFAA 3WF4A 4YIWA 3N3TA 2WSPA 3WJWA 1E5JA 4S38A 3KOZA 2AKMA 4H19A 4XZBA 1MXSA 3AXMA 5AOUA 1K9EA 3O6CA 1FWHC 2YXXA 3T81A 4KWWA 2BRPA 4M6PA 1DJZA 5GVJA 3FEMA 1VCFA 1OD0A 4H1ZA 7TAAA 4AY1A 3PQIA 4XBJA 5CJNA 4N4PA 5BMWA 3OGVA 3GR4A 3NL6A 2REQB 1NFGA 1IWPA 1PSCA 1GEQA 5CBBA 5E70A 1B9ZA 1B5TA 2Y88A 2VDHA 2ZUSA 4CCDA 4BEUA 3L4UA 3GIQA 3GNPA 3B8SA 1E0UA 3FAXA 4ZTYA 3VIKA 2RGMA 5FF2A 1RD5A 3RU6A 3PZIA 1VFLA 4UZUA 3VE7A 4YHEA 3RRXA 4IQDA 4C1LA 3WBAA 1KFJA 1KM4A 4W87A 1B3VA 3SI9A 4R7WA 2FLIA 2ZUTA 1CCWB 1UROA 2QF7A 5J5RA 3RK8A 1E72M 4JTLA 5FD0A 1QT1A 1R9XA 3I4KA 4FNUA 2DW7A 4JCMA 1VD6A 1NWUA 1O6IA 5A3HA 3AZTA 5AYBA 3SBFA 5F2LA 1WYIA 1W1ZA 2YDSA 3MWCA 2WBKA 1WXJA 2J27A 2AAMA 1X1IA 1ZBCA 4E6MA 1OEPA 3H2AA 3GDBA 3O7UA 1CXIA 5HMDA 3NQAA 2J4GA 4J3TA 3LCGA 3VNYA 3WH5A 3FW6A 2X03A 4NY2A 3VD9A 2QUNA 1US3A 4R27A 3TN5A 3LPPA 3A12A 2VR5A 4LBSA 4JTAA 3Q37A 2NV9A 1S3HA 3E2VA 2DZWA 3RLUA 1PZ3A 2POTA 2CLPA 3PK7A 1TKKA 2BY1A 2PDGA 4JPGA 1F6YA 4AEOA 4GY0A 3VKAA 3W00A 3U48A 2BY3A 5FSEC 2YR1A 3CL7A 3W7CA 4DHGA 5C55A 4RDZA 4R85A 4LS1A 3TC3A 3VCRA 1GONA 3VKBA 3ANUA 2YCKX 4W7VA 1ISVA 3KVKA 3UZ5A 4JAWA 3NPUA 2KAUC 1O1ZA 3R13A 4HD5A 3UPWA 4AD5A 4KWUA 3SUSA 2Z7KA 2Y7EA 4L1XA 4WDTA 3W2LA 4MUZA 3AIRA 4K39A 3MHUA 1I2PA 3ZSTA 4NVTA 3CWNA 4QGCA 2DU2A 1XDMA 1V0LA 2ISDA 3T7VA 1ZZMA 1HP5A 3VNMA 1UBPC 2HE8A 3MS8A 2Y0FA 3N6JA 3RDKA 3TJXA 4RZ5A 4MJ4A 4HNUA 3I3EA 2EGZA 5D2YA 2X2GA 2ZRUA 5FJUA 1J18A 2CU0A 1EB3A 3AS0A 1UPPA 3M7WA 1P0DA 4Z2LA 2OLSA 4G5DA 1QTWA 4E2DA 1DHPA 1HQTA 4BA0A 3USZA 3NPVA 1WBHA 1XX1A 1I8JA 4XG1A 2MANA 1HGYA 2PA6A 2VRKA 4BF9A 1JG9A 3FVDA 3FDGA 4YTUA 4X63A 4GGBA 1SFLA 3W6YA 4FALA 1UUOA 4JTQA 2WZEA 5HNTA 2O56A 3MYOA 1JFXA 4P5UA 4NSBA 1I2OA 5CZJA 3P67A 1XLLA 2DW6A 4EANA 2FGBA 3IIPA 1QI3A 4MLRA 1DXEA 4H01A 1FVPA 2D2JA 1Z48A 5EL1A 4G1KA 1UW9A 4LQ1A 4LVDA 3VNLA 2QGHA 1BFNA 2ICSA 4AVOA 4GRSA 2CBUA 1HGWA 4XB3A 4TV5A 3S83A 2OWXA 1LWJA 4AY8A 3BLOA 1JF5A 1EJTC 1VYPX 1FA2A 2HK1A 2BXYA 1UB3A 3NQGA 1CECA 5C54A 4MYXA 2A2IA 3M7SA 2RDUA 3BE7A 2V3DA 1OCJA 2XU2A 4LVFA 3WH6A 5AC8A 4MPQA 1BAGA 3E0VA 3SGUA 1G6CA 1L6YA 1SZEA 2IXVA 2NWSA 1AMYA 3M4HA 3EXSA 1GZ1A 4G6CA 4B5SA 1K4HA 4OUEA 2GK1A 1E55A 1YE4A 2JKAA 5TIMA 3NZ1A 5EMUA 5F2IA 1W2VA 3SCRA 4UTJA 4GI4A 5KETA 3AOFA 4DIAA 5LNVA 2P0IA 3CU2A 2F38A 5HPCA 3TYUA 4NZ1A 3IPWA 3RX4A 2BGSA 3QW3A 1P7TA 3WNNA 4O16A 4PMRA 4XTDA 3UG5A 1LM1A 1ELSA 3QKZA 1HVXA 2F6UA 2HXUA 3MA8A 5FEXA 4M19A 2XGIA 1J11A 1UQYA 3E74A 2XHYA 3M0MA 1KM6A 1XFCA 3C86A 5XINA 3W28A 3AUJA 7REQB 1VENA 1X7FA 5LHEA 4WUIA 5DXXA 3QV7A 4QP0A 3NM1A 4CNOA 4NRRA 4C60A 3VM5A 1W1IE 4WXYA 4H41A 3TV8A 3F4CA 4PZVA 3N29A 3CLMA 1HKIA 1RBAA 1Z44A 3CAKA 2TYSA 4IL0A 3LGDA 2SFPA 3QSTA 3H6OA 1CGYA 3CUIA 4HGXA 5CZ0A 1TFVA 1W32A 1AUSL 4PUDA 3I3DA 5EB8A 4NJHA 4UMBA 3CEPA 3HG3A 2O0TA 2QMKA 2G97A 4HNCA 3H7UA 5BRBA 2EO7A 2AL2A 4JGDA 3HTWA 2E28A 3EWDA 1VBHA 4BK9A 3N4EA 3CJPA 1CGUA 4EVZA 5A8GA 3SCPA 4RL3A 4D9PA 1ZJHA 2VEGA 3GXPA 3WLOA 1FWWA 3BDKA 1T5AA 1VFFA 3QHMA 1A50A 1B9BA 4DO5A 4JTCA 3WNMA 1Z8AA 3W1UA 2AL1A 1DL3A 3HV9A 3WUBA 4CN6A 3D6NA 2E24A 2V5LA 1E1EA 4IMCA 1QWKA 3FHAA 3P81A 3FYOA 4PRWA 1KFKA 2GVGA 1OWQA 3GVQA 2WZHA 4GQRA 5HWJA 3T8LA 1B0IA 4AIOA 3LGGA 4QRNA 4J3UA 4UNLA 1V77A 1S5MA 1PZ0A 4O11A 2FGLA 4Z2IA 3ARPA 2BV9A 3IRDA 2I5IA 2CLEA 1C82A 3LCFA 4QFUA 2PD9A 3W7EA 4R33A 2OCZA 4AH7A 1IE7C 2QULA 2TRSA 5KSWA 2EG8A 3D3AA 3G8RA 3CAWA 3B0PA 3VDCA 5HDRA 3TZNA 1JFHA 4QJ5B 1A53A 3HA1A 3GNXA 4EXQA 2ISVA 3NM3A 3PR2A 3QHOA 3WQ8A 3RPDA 1A5CA 3UG4A 4IP5A 1H09A 4LEQA 4A3QA 3TQ0A 3JVAA 4F0MA 2YDAA 1MVYA 3CTLA 3OZYA 1JZ7A 2ZICA 2GSHA 2QCFA 4UXDA 4W7UA 1NWRA 1PKMA 4FLSA 1XDJA 5D05A 2CZEA 3M0KA 3PB2A 1MEWA 2PC8A 1A5LC 1LRTA 4CCEA 2PDXA 3QBUA 1LYXA 2JF7A 2WZIA 3NSMA 2D2GA 4GO9A 1OSEA 4UFJA 2O4MA 4MNKA 3VNJA 3R0UA 3HG2A 3IACA 3SEPA 2G3JA 4Y9NA 4AQLA 3ITYA 2CZVA 3PPGA 5DO8A 1LWIA 5EKYA 4NILA 2E68A 4CNPA 4ZQOA 1F05A 1XLFA 5C9XA 2KX9A 5CG0A 5DBTA 1G7VA 3GWQA 1U5HA 3T0DA 3W01A 3DBNA 3T42A 3VKJA 1JQVA 3ITXA 4BQ2A 5K4ZA 5CXPA 1E4MM 3WF1A 3S5OA 4LYKA 1DIEA 1SYTA 2YL8A 3C2VA 5CSYA 4XBKA 3T0TA 1NDVA 2OPJA 3EKGA 4HJFA 3EWYA 4B5NA 4CLMA 3NZRA 4AVNA 2OSWA 1NJJA 5H8MA 1F3WA 1X96A 1JIBA 3QLDA 5TQLA 1PCWA 5C6MA 4D71A 1B1YA 4GQQA 1W2PA 3QY7A 1D2KA 2VRQA 4EP8C 5CCZA 4LANA 3W24A 4AHOA 2HNHA 3UXAA 1CGVA 3ZFHA 1WB0A 2OSXA 3LA4A 4W8LA 1TWIA 3IVUA 1V6TA 3BV7A 2VD8A 4G7EA 4TTUA 4DF1A 4GYKA 3WO8A 3LBMA 4FIRA 3TVAA 2DJXA 3RG6A 3HJEA 4UQBA 3R8RA 1XW8A 1V6VA 4E4UA 4AF0A 2VZSA 1GHRA 3NQ6A 4OTKA 5C0QA 4OBRA 4OVXA 5AC6A 4V28A 3R12A 1K4GA 4DZ5A 1JD9A 5TD4A 4HMCA 3WDHA 1EUNA 3U9IA 1PTGA 3MZ2A 4GYPA 1AQ0A 5D04C 1LOQA 3LBOA 3OPSA 1RP8A 2WNZA 5I3IA 3GC4A 1CNVA 4QITA 1LQ0A 1BHGA 2WKLA 1VHNA 2D3LA 3A13A 1FWGC 3TP4A 3EWZA 1L8NA 4PMYA 4W4QA 1G7UA 1XBVA 4DBEA 3UWWA 3DHDA 3LTSA 1LLZA 1NQ6A 5JH1A 3FCPA 4RW5A 4MGGA 3EPNA 1VKFA 2PTDA 3LUTA 4NXSA 4ZB0A 1JZ5A 3WK1A 4IPIA 4PBGA 1QNRA 4AEFA 2I7GA 3MVTA 3KOYA 3GC2A 2BOFX 1E15A 3SRKA 2Y24A 4W84A 4Q7NA 4KEVA 4XAYA 4J3XA 2VR2A 3WQOA 2J74A 2YA1A 4TIMA 3WEOA 3VUSA 1K7FA 3B9EA 1KM0A 2OR2A 1WPCA 2AAAA 3A5FA 4CNSA 1BWLA 3WJSA 3W38A 3C2EA 1EIXA 1O5XA 2R91A 2WPGA 4IXHA 4H7CA 1FHVA 2OSYA 4LRTA 4GA8A 1OB0A 2FB3A 1TWZA 4P7OA 3G24A 2OYKA 1Q7MA 4IIBA 2H6RA 2I5QA 4F9DA 4C7FA 1GVRA 2J7EA 3Q67A 2QJIA 2EPHA 2GUYA 2OKTA 3CGTA 4D1IA 3JS3A 3LV5A 2IPFA 2C7FA 4XISA 2XH7A 1TPWA 1L0PA 2E1DA 4MKVA 1AJ2A 4J1OA 3OHMB 3RCNA 1PZ1A 3THAA 1VC4A 4DUOA 3IGHX 4FXSA 3AMKA 1S1PA 4J40A 4DBSA 2P88A 3FV9A 4URIA 3EA1A 4DXVA 3SCQA 2UY4A 1N82A 1EXBA 3LI1A 2ZE3A 2VQTA 1K7XA 1O60A 1PKLA 1U33A 1XISA 2E5CA 3EMQA 3CB8A 3DI1A 5G1TA 2FB2A 4FF7A 3QYSA 3RLGA 4M81A 1TWDA 4XZNX 1BKSA 2YX0A 1UD8A 3O05A 2JFEX 2ASHA 2WNQA 3WQCA 2BWGA 3S2CA 4KS0A 4Z1AA 2CYGA 4YMZA 1REQA 1R9ZA 1X8CA 2ZKMX 4G2DA 3O6AA 2Q09A 3ZR5A 5E0KA 4CCZA 4NYYA 2WZMA 1W91A 3RHGA 4GVHA 3EB2A 1VFHA 3OTRA 4CNTA 1RCXB 4MUPA 2V0TA 2C91A 3KL3A 2HV5A 1UKQA 5A2CA 1ICSA 1ZJIA 4ZOBA 4KRUA 4HPJA 3ABRA 3DFQA 3MZNA 1HL8A 1TZZA 4HCLA 2ZX9A 4NQ1A 1UC4A 3PZNA 3CO8A 3SCUA 4BI5A 3BQ6A 4PTXA 1H0IA 4YNGA 3ZT7A 3ONCA 3PWIA 1ODUA 4B15A 4HOWA 3ZR4A 1J5TA 1H60A 5F1VA 5HULA 1L6SA 3AYTA 5A8PA 3S1UA 1HP4A 2WCOA 4MDPA 1JPMA 1OZMA 3SURA 2WV8A 5D8ZA 1A0EA 3E0WA 1PX4A 4ATLA 4KIRA 4NZJA 1JCJA 3W7DA 3JUGA 1BSLA 4OV4A 1YIXA 3S42A 1GHSA 3ITTA 1H2JA 4IX0A 2CLOA 2X0SA 1UUQA 4GJIA 1YDYA 2ZZ2A 4LBRA 3KTCA 4JTSA 2DH3A 3W76A 2ZQ0A 1PAMA 3CT7A 1JCTA 4UTWA 4HA0A 3S6OA 2CZFA 1ICQA 3HQPA 4JIPA 2OYMA 2XIJA 3B9OA 4PCTA 1VLWA 3CMJA 2Y4SA 1BQCA 3WUFA 2I1OA 1TSIA 2FJUB 5DQPA 1GG0A 2JKPA 2VGBA 5FJRA 3IVTA 1XLKA 1O7AA 3GQYA 3OZMA 1WDWA 4LS2A 1V6WA 1JCNA 3PBUA 4W7WA 1NSJA 2IKGA 2GWNA 1UH4A 3BGGA 3SZ8A 2GUBA 2Y62A 4K6AA 2ZBTA 2Q3OA 4PL1A 2E4TA 4Q22A 1HL9A 4H6EA 2X30A 4GINA 3RNDA 4S3KA 4YYFA 3AXXA 3OLEA 3NVDA 3OJGA 2VC5A 3L2MA 3E9AA 4Z0JA 3AXHA 2HCVA 3LRLA 2FZ8A 4GH3A 1UJPA 2XN1A 1OGSA 1FFQA 4RE2A 4GCXA 4GQBA 4MSSA 1YNQA 2D0GA 4LAZA 5HK4A 1LDCA 3VGBA 4MKNA 4PRRA 1M53A 2YJQA 4D8LA 3QGKC 2VX7A 5I23A 4IT1A 4RUBA 3ITLA 4MNMA 3EYPA 1KM1A 4E2OA 1QHZA 2NSOA 3BG3A 2Y63A 3UF9A 3OVRA 4FNPA 4UFKA 2D23A 4IJBA 4S3JA 1VHCA 3WK0A 5KZEA 3JR2A 1XHGA 2WYSA 1VBRA 1ZNNA 3RPTA 1V8EA 3II1A 2E3ZA 2ZYFA 1CZ1A 2WXDM 3U5YA 1OY0A 5LGXA 2XISA 4XUGA 1VPYA 3AYRA 2VEIA 1KM5A 1N8FA 1XM3A 4E2BA 1Z41A 4UMCA 3EZ4A 3OGRA 4GYFA 4EACA 4F0KA 1FWDC 1GOXA 3OHIA 3W53A 3VMOA 1C8XA 1MUMA 3ZT5A 2QAFA 2B7NA 1RR2A 1UP0A 1CT5A 3UNDA 4HPGA 4Q4MA 4S1FA 2ZE0A 4JTHA 2WZTA 4GJ1A 3WD2A 3MUXA 2R82A 5D2VA 1R3YA 1US2A 4Z17A 1CENA 1X1HA 4HK5A 4K2SA 4TX9A 3TWAA 2E25A 3KLKA 4JNYA 4UIOA 1Q85A 3DC8A 1XLHA 4PH6A 1F3EA 1ESWA 2AQOA 1HNYA 1J2WA 3WCZA 2R6OA 3HM7A 3EKZA 1QWGA 1BTCA 4ZOCA 3H22A 4CD4A 1N8WA 3EPMA 2ZTKA 4QISA 3WFZA 3AS2A 3D46A 3NSXA 3OG2A 3TU9A 2CLIA 3IRSA 1PB0A 2CESA 1ML1A 3KTXA 4UR8A 1EO7A 1CLXA 5FJOA 3THCA 4A21A 2RAGA 1XXXA 4J5NA 3W3OA 2PF8A 3DG7A 4X9YA 5CH9A 1I1WA 1RZMA 4DQWA 2DSKA 2XSBA 3G1YA 4IHCA 1K77A 4O8AA 3MP4A 3BMXA 3CMFA 1XLBA 2VX6A 4H2HA 2OZ0A 3T2PA 1R7OA 2ZRXA 1HN0A 3W4RA 1W9VA 1RCOB 4IXXA 4ZZ9A 4CNUA 1ICPA 2J62A 3KOWA 2WMFA 1RPKA 1SVDA 1UZ4A 1XLEA 5EY5A 3DCPA 2KXRA 4O4WA 2BRVX 1CLKA 3V36A 1W3JA 3W7MA 3BG9A 2E6FA 4RE4A 1QW8A 4KF1A 2J7BA 4TV6A 4MKSA 4QDWA 1TQXA 3H70A 3RXZA 2ISFA 1PDYA 3TQVA 1C91A 1VFSA 3VZYA 3W7RA 4L4MA 3PUEA 1SU5A 2AGTA 2NQ9A 1CGWA 3NO5A 2DH2A 1XRFA 1IWBA 3I6TA 1QI2A 3ME3A 1MXGA 4W86A 2XIOA 2DVXA 3BGAA 2VFIA 2G50A 3H26A 4OJYA 5D33A 3WD0A 1YDNA 3ARRA 4KGLA 1V3MA 1B30A 3Q94A 4LVGA 4DUVA 3ARSA 4B3LA 3BCFA 1JPIA 4S39A 1MYRA 2PDKA 1B3OA 1TR1A 2R14A 1J4EA 3LEPA 3SJ3A 2XWDA 2E9BA 4REQB 4JDBA 2YIHA 3WFLA 3SY5A 4NAEB 2O9TA 4N0RA 3AU2A 1E73M 1V7YA 2IMRA 3STEA 1JZ2A 3UR2A 3ZLFA 5BROA 1M7OA 3GTXA 2XFFA 1Z7AA 3LCIA 1WZMA 2CXGA 4CVWA 1FCBA 2GGGA 2R94A 3ABXA 5I07A 1PTAA 3ALFA 4EX4A 4B5VA 4H7ZA 3TJIA 4LB3A 1DJNA 1UOKA 2HZGA 2ABAA 4OBSA 4HNOA 4JD4A 4JQ1A 1ZALA 2C1GA 2RDTA 3AROA 2F61A 2CHRA 3WX7A 4WDWA 3LMZA 3C0JA 5GQBA 2INZA 4UNIA 2IUZA 2P3ZA 2G95A 2YBVA 1JGMA 3QJAA 4H3DA 2P3EA 3GVRA 4H6QA 1HXJA 2NV2A 3PFRA 5GPRA 5K4XA 3U2CA 2YKKA 3OIHA 5AYYA 3E6EA 3F5LA 4ADTA 7CGTA 3GE7A 1Q6FA 3HGSA 3TW9A 4L6OA 3OYZA 2W4XA 5ABFA 3WNOA 1A5UA 3UJFA 2XPKA 2BGQA 2W63A 2PWDA 4O1AA 4DN1A 1OJMA 4HHHA 3L4WA 3HURA 4FX8A 5GNYA 4JFTA 1TTIA 1YADA 3GFXA 2PDHA 4IQJA 4M6VA 4AXKA 1Q66A 2V8ZA 1RW9A 4M56A 5BZAA 1EJ7L 4M29A 4O54A 3RCYA 1US0A 3W7OA 2DORA 3QQ0A 4LUTB 5XIAA 1CXFA 1LG2A 2WKJA 1LBMA 1Q6DA 1BD0A 1XYAA 3GU9A 2UY2A 4KFOA 3BUVA 5CG7A 4H04A 4UTUA 2PGFA 1EZWA 1E56A 3EX6A 3KS5A 7TIMA 4HHMA 3QF0A 4UQEA 3E1F1 4JL1A 3AIEA 4RZBA 3T78A 1JZ8A 3V1HA 4F0HA 5ECUA 4D6JA 1TV4A 1U5JA 4S3GA 3SCTA 3IAPA 5D09A 2BZNA 8XIMA 4MVAA 1XD0A 4HMNA 1F76A 5BXTA 3CZLA 4MIMA 4IMEA 2E5DA 3KCLA 1Z42A 3EDEA 1LZOA 4M51A 2OZ3A 3GZ3A 1H41A 4CQDA 2Z0IA 2VM8A 3GHRA 1JF6A 1DIDA 3KP0A 3CV1A 2F84A 3CHFA 4D8AA 3L4TA 1ZENA 2DQXA 2RUSA 3PTDA 2QJHA 3AZSA 1JDFA 1XRVA 2QCDB 1FFRA 1RSCA 1L6FA 4CD6A 1TV2A 4IIFA 5U7SA 5HPOA 3PC0A 2PTWA 3MUIA 5JH2A 1UKPA 3CIXA 1KLZA 1BVNP 4K1WA 4XUYA 4OKDA 3FVMA 4EPDC 4ZQRA 3BARA 1Q7ZA 3CV2A 1K8XA 4C1NB 3MO7A 3H23A 3S1WA 3VDAA 1ZBKA 2CLLA 2YLLA 4ONVA 3PN8A 2QR6A 1UWSA 3DBPA 1W5PA 2G37A 4D6CA 1XH1A 2J79A 3U8GA 2Z28A 4LUSB 4ZE4A 5AECA 2QQ6A 2DT3A 1AFSA 3VMNA 3SQMA 4C6NA 3GX9A 3QR1A 3WQFA 3F4VA 3P5ZA 4IFKB 4PL2A 5CLTA 1PTDA 3WZ0E 1ZFJA 5CC6A 1GOKA 4I8DA 3B06A 5DT5A 2QPSA 4NL1A 5FJJA 1VBUA 3W7HA 3W81A 4H8UA 3AJXA 3E2QA 4U5IA 1XLCA 1W3LA 5ABHA 1RUSA 1TJ0A 3A3WA 2V68A 2G96A 2RJGA 5J04A 1G1YA 3UCDA 1Q63A 1H4PA 4LH8A 1ITQA 1K02A 5I06A 4Q4KA 4AD3A 4GUGA 4W8AA 1L6WA 1NEYA 3ANYA 3W1TA 2E09A 2QCGA 1DWAM 1RBOB 3LG3A 3FXGA 2OELA 4GC3A 1K9DA 3NSNA 4QEHA 3W72A 3KRUA 1K9FA 3T05A 5A94A 1MW2A 2QS8A 5JBDA 1QW9A 1PEZA 4Q4QA 4HOZA 2QPXA 4K3ZA 3TKFA 1SJDA 2EAWA 4RXFA 2PP3A 1D3GA 3A3HA 4GG9A 2CBIA 3UD2A 4P8VA 4GNVA 1UMYA 4DLQA 5HNUA 4GYJA 2CLHA 1XLJA 1R0MA 1P6CA 5JBFA 4FNSA 1KO0A 1W56A 4AY7A 3QR0A 3THUA 1G5AA 1UUMA 2JK2A 3SSZA 4ZFMA 1R9YA 2P0OA 1OJNA 5FOOA 3QQ1A 3IJIA 3QH2A 4D6HA 5HINA 1S2TA 1T40A 1XINA 4C5ZA 5IHRA 3UZXA 4PEEA 2VCBA 2AQVA 2DSVA 3M5VA 3L2LA 5E09A 1E6PA 3T2OA 2QUUA 4FMVA 5GJMA 3NQEA 1QDSA 5RUBA 2TMDA 2PDMA 2Z6JA 4L9ZA 3CZEA 3IJ9A 1OK6A 3WQPA 3N34A 2NQHA 3TQKA 1EX5A 4UCFA 4RE3A 4CQAA 2J75A 3ARUA 2FTWA 1PL9A 2X1IA 6XIMA 1CDGA 2QIWA 1V0NA 1OFEA 3ZXWA 5BOFA 3SFKA 3BAIA 5FI8A 3L4VA 4IP7A 2YA0A 3MHFA 1EJXC 5I0DA 5HR7A 2OO0A 1HMUA 1NDYA 2QCHA 3QW4B 4O17A 2OVLA 4OQVA 4QDMA 4DRSA 1DWGM 1VCVA 4QHRA 4HZ6A 2GSEA 2QNEA 4O0QA 3CMGA 2J9XA 1TREA 3WUEA 2ZX6A 3IJLA 3VGGA 2BOGX 3SJNA 2OO6A 3VKCA 1CB8A 5G4WA 5AC5A 4QS6A 4LUJA 4LTSA 3CASA 4TVDA 1BEUA 4AD1A 2BTMA 1VBJA 4DJFA 1RP9A 3E38A 4M8UA 2FDSA 2OT0A 8TIMA 4HYRA 3WNPA 1XLIA 1E6NA 1GTHA 3FEQA 2YYUA 2C18A 3W37A 3W1QA 4PB4A 5LHFA 2ZUWA 1PYMA 2R9RA 3SY8A 1ZSXA 1VJZA 3LPOA 3VX0A 2YL9A 1SO6A 3UGRA 4JHOA 4LAMA 2CKRA 2XIBA 1TZ7A 3MU7A 2OODA 3UXKA 1UZDA 4YYCA 1YXCA 4P8UA 2D73A 3P62A 2J77A 1IXPA 4QG9A 1XCWA 1W3IA 3GM8A 4BQ3A 4MHBA 4C91A 5HXMA 1S1RA 3C8FA 4YN5A 2Y7FA 4C6BA 2UY3A 3L2IA 3P3BA 1DOSA 5E0FA 3GXFA 3OBEA 1W9BM 4KWSA 1Q8JA 1VIZA 4HB7A 5AYXA 4F0SA 4BY3A 5HJYA 4QG8A 3DG3A 2VURA 3UWUA 5A6TC 2V2HA 4PB3A 4KKXA 4U10A 3L9CA 2C19A 4FB7A 4HZMA 2BNJA 1WDRA 3K30A 5CLWA 3MI6A 2XVNA 2EQDA 3A4JA 4IPLA 5A6SA 1KW1A 3WH8A 4GUHA 1H7WA 3LX9A 4FIQA 4PCFA 4Q8QA 1NELA 2DZSA 3UG3A 5JU6A 4ZO6A 3L4YA 4DWDA 1PO9A 2NUXA 1JYVA 5HQMA 1YYAA 4PMDA 1VJSA 4X2RA 3DAQA 5AHLA 1DJGA 2PWVA 3BPWA 3NJ3A 1OT1A 3RF9A 3MANA 1S2CA 3URNA 5K3VA 1IGSA 3V4BA 4JTDA 5L6UA 4XZHA 3EOUA 2IQDA 4L6HA 4U33A 2WCAA 2BG5A 5FF4A 4QE5A 2BOEX 2NQLA 1O0SA 5CPLA 3RIKA 1EH9A 4N4QA 4DY1A 1I2NA 4BS0A 1XIEA 8A3HA 4A6GA 2DIKA 3P80A 4ZE5A 1KKRA 5A1AA 3W70A 2VL4A 3BTNA 2ACUA 3HJZA 2YCEA 2YPIA 2G4FA 3GIPA 1HKMA 2ALDA 2PDPA 5HA7A 5A8MA 3K8KA 2WDAA 2EXOA 3FS2A 1CTNA 4IISA 4O0KA 1AQHA 1CX9A 1IQ8A 4UNKA 3W88A 1TIWA 4XX6A 3SGGA 2J47A 3HU7A 1PBGA 2A6NA 3MW7A 2XSXA 4DLFA 1TX2A 2QVHA 1SSGA 4BQ4A 4R88A 4HNVA 3TYAA 1KC7A 5BCAA 4LUYA 1WAUA 5REQB 1TUFA 5I6SA 1BGGA 1GPWA 2TSYA 6REQB 1XGZA 3XIMA 3EMCA 4DAIA 4L5ZA 1VGAA 1TMLA 1CI1A 3VTRA 2ZCGA 5HJXA 3D5HA 1EDQA 1MW0A 3HG5A 3UJSA 1IEVA 2H3BA 1UWRA 2YEPB 3NYDA 3RPMA 4J9JA 3B04A 1EBHA 2WVUA 3VDHA 4Y8EA 5A2BA 3CXOA 1W9PA 5G2WA 3ARTA 1AH3A 2WJZA 1VR6A 3LLDA 4L9XA 1QNOA 4DJDA 3U2OA 2X0YA 2V2DA 2WHLA 9CGTA 4JQ3A 2FPTA 2VC9A