2WMGA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in complex with the lewisy pentasaccharide blood group antigen.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
555
structure length
553
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIANYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLKGHHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords FUCOLECTIN-RELATED PROTEIN
total genus 199
structure length 553
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmgA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmgA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmgA02
2UY2A 3RCNA 3ZT7A 3M6DA 1E55A 5DMYA 1ZBWA 2GDUA 1ODUA 7A3HA 2VZOA 3W27A 3K46A 1S46A 1EOMA 1NM9A 1BLIA 4MNKA 1HF6A 4GI6A 1KQZA 1KGWA 1JYXA 1D7FA 2OSWA 1MXDA 3VUPA 4WF7A 1JZ7A 3WL1A 4HTYA 3KEHA 3VNZA 1QI4A 3GNOA 1GNXA 3WD0A 1UQZA 2CITA 5A8PA 1J12A 5A2BA 1J0NA 1FH7A 2VZVA 2CBVA 3F5LA 2RGLA 2J47A 1OJNA 1E70M 2F61A 3G6LA 1W9UA 1IZKA 4P7NA 1E5NA 5HXMA 2VC9A 4NRSA 4KWUA 3AIEA 4LX4A 3BLPX 3VGBA 1JAKA 1MW1A 2PWGA 3WD2A 3EMQA 5GNZA 3RM4A 2XFRA 1W1VA 5JBEA 3BH4A 2CYGA 3W0KA 1XRVA 3II1A 1JDDA 1OM0A 1V08A 1XD1A 3L4ZA 4GQRA 2DSVA 2WWCA 1V6YA 2WK2A 1PEZA 3BLKA 4AZ7A 3WQ8A 4W7UA 2WVVA 3AIBA 2DSWA 4ZE4A 4K68A 2D3LA 2DDXA 1OINA 4AIOA 5JIPA 4QDMA 2PWFA 1UUQA 1XCXA 1KBKA 3WD4A 1J11A 4AD0A 4AMCA 3WDQA 1PZ3A 1FA2A 1JYWA 1CGVA 2GJXB 2FGZA 1GJWA 2UY4A 3WQ4A 3CZLA 1J18A 1KCLA 3CUHA 2VX6A 3FNDA 3OGVA 3CHEA 3NUKA 2BY2A 2CNCA 3MV01 1M7XA 3A3HA 3ZJKA 3ZSTA 1W9VA 5CLTA 1CWYA 4FLQA 2XWDA 1N7RA 3SUVA 2PI6A 4PUEA 1HL9A 4KGLA 1K9DA 3FAWA 1BSIA 5I23A 1CBGA 1FHLA 4M81A 1V0MA 4TVCA 5A3HA 5IXEA 1WO2A 3DYOA 2DEPA 1JYNA 5EFDA 2EXOA 3VMPA 1VJSA 2VT0A 2GJPA 1ZB5A 3EDJA 2FHBA 2JIWA 1RWAA 1W3KA 1W1YA 2VO5A 4ATDA 3AYRA 4WK9A 1CLXA 1JG9A 3UR8A 4P8WA 4W84A 1C3FA 2C0HA 1HNYA 3VU2A 2J25A 3WNOA 3WUGA 2XPKA 2Y8KA 2OLHA 1VENA 1XD0A 3W6LA 3OZPA 5CGMA 4TVUA 1VF8A 1W2PA 1GOQA 1UH2A 1LWJA 2X1IA 3AMKA 1MW0A 3M07A 3IJ9A 7CGTA 1SMDA 1UD6A 3A6OA 1W9BM 3VIKA 3VX0A 4H8VA 3VIPA 3WFZA 3W37A 1ZJBA 4J3XA 2V3FA 3W24A 4QFUA 4P7OA 2GVYA 3UG3A 3W38A 2DPEA 1C91A 3ZR5A 3NDZA 1WDSA 3S6TA 1F9GA 3KL0A 2VMFA 1SYTA 3MANA 2EEXA 2EPMX 5A6BD 4UFKA 5E70A 3PHAA 1XSJA 3AXIA 1XH0A 1LLOA 1CXHA 3G6MA 3SCNA 3BAWA 1CXIA 1DP0A 1O7AA 1V3KA 4DWSC 1QPKA 3W82A 4CVUA 3GXIA 3ECQA 2RGMA 3K4AA 3GYCA 2WMIB 3VILA 2D24A 5GNYA 2DT1A 1V3LA 5E09A 5A6KA 4FMVA 2O9OA 4UQAA 3UETA 2VR4A 3AMLA 3AS2A 3MUAA 4MJ2A 4CKQA 3BCDA 2PWEA 2BV9A 2YBTA 1RWHA 2CBJA 4RE4A 3PTQA 2ZUWA 1UKTA 1QVBA 1GVYA 3UEQA 4JL1A 4CGTA 3CZJA 2CETA 5CJ5A 1OD8A 4DWSA 3AZTA 3QHOA 3B8SA 5F7UA 4D72A 1HM3A 5JIWA 1J10A 3BMWA 4Q22A 4Q7NA 4BQ4A 1W91A 3VD7A 2WAGA 4BCEA 1GPFA 2FH6A 5D8ZA 4NSBA 3EMZA 3ARUA 4CD5A 2YOCA 2BVDA 1B3VA 4U3CA 3O2LA 2ZWZA 2EPNA 4Z2KA 3SCVA 4H2CA 4TX8A 1B3YA 3CZEA 1JZ4A 4U5KA 3VPLA 3GBEA 1EGZA 4LPCA 2NT0A 3N17A 3WDHA 4WKAA 3VVGA 2WMFA 2VRKA 5FKYA 3T0AA 1D3CA 1XH1A 3N11A 3PZQA 3L2LA 2WLZA 3RPMA 2GSJA 2XIBA 1TZ7A 3ARQA 1EO7A 3TTOA 3ZR6A 5A1AA 2EBNA 1OJPA 3VDAA 5CPSA 1EH9A 1QI3A 2NT1A 4D6HA 5HPOA 3WSUA 4W5UA 3I3DA 4U3AA 4ZENA 5DT7A 1E40A 2CBUA 1V0NA 2E22A 1UR1A 4MTVA 1OIFA 1MYRA 5IHSA 3FXYA 2BVYA 2X8RA 2ZUNA 1NWRA 4PTVA 4UQ9A 1UKPA 3A4AA 2AOSA 3BSGA 2D23A 3WDPP 1H2JA 4UCFA 3SUTA 4J3SA 3VM7A 1VRXA 3WH8A 2YA2A 4UOQA 4Z2IA 4UQBA 2YDQA 2YDRA 5DEZA 1OJMA 2BHZA 3PBGA 4M82A 1GJUA 1HVXA 3IK2A 4HZ6A 3K8LA 3UG4A 2ZWYA 1UD3A 1UR0A 4P8VA 5KEZA 4ATLA 5ABGA 3APGA 3WUFA 1DWAM 4BZYA 4V2XA 1JYVA 2PF0A 2WWDA 1EQCA 3LPFA 3VIIA 1E43A 1ODZA 2PB1A 3QR3A 1WZKA 4R27A 1EHNA 4W5ZA 1JZ8A 3AIRA 4JFTA 2Z1SA 3VOCA 1VBRA 2DIJA 3BMVA 4W7VA 3OB8A 5HPCA 3N12A 1QBAA 4NRRA 4JFWA 4D6DA 2YIHA 2WC3A 5A94A 1B3WA 1FFRA 4EAMA 2DSUA 3BAXA 2X03A 3VIOA 2J8GA 1X6NA 4HU8A 1KXTA 2VURA 3WMBA 1J01A 1B2YA 5AYIA 4PRWA 1UD4A 1BVZA 4MAVA 3W26A 1ZS2A 1C93A 5E0CA 2WMHA 2A3CA 4EE9A 1ZBVA 1BG9A 4HMDA 3ZJ8A 3SCPA 2WMJA 2PC8A 4B15A 1NARA 1I1WA 3VD5A 1V0KA 5A2AA 2PWHA 2DT2A 5E0FA 1RWGA 3SCQA 2HVMA 2EPOA 1ZBKA 1E5JA 1RW9A 1F4AA 2J7GA 3CMJA 5AC5A 2VQTA 4UOJA 2BY3A 4XZWA 5CQ1A 4HA3A 4QLLA 3M7SA 1GQJA 3FAXA 4H7VA 5LA1A 3CZGA 2D0GA 2DT3A 5I6SA 4JZ5A 3AHZA 1F4HA 4W8LA 4MADA 2QPSA 1UD5A 4AIUA 2V3GA 1H49A 4N42A 5E6ZA 3WF0A 3B9AA 2WNWA 1QNQA 3ARTA 1DEDA 3EYPA 1UKOA 2J8FA 1GQIA 5HOSA 2D0HA 2E9LA 1W9PA 3RM8A 1JXJA 4X0NA 2J75A 4UFHA 1MQQA 3D3AA 3GNPA 1UR9A 5IHRA 1B3XA 4WIWA 3KWXA 3SCSA 3VMNA 1AMYA 1DHKA 1FP9A 2EPLX 1UYQA 2FH8A 5D9NA 5FL1A 3RJYA 4QLKA 2JIEA 1HMWA 1ZL1A 3F5JA 4A3HA 1V3IA 3VMOA 4MDPA 2WCAA 1KQYA 3PZOA 1GQKA 5A2CA 1HJUA 1WZMA 1C8QA 2PBGA 2ZXDA 4GQQA 4C7DA 4U2YA 2VX5A 2GK1B 1SMAA 4QCEA 3U7VA 5CLWA 2D3NA 4PMOA 3W28A 3WF2A 5CSYA 6A3HA 4HP5A 4F9JA 4D6JA 4FK9A 4BA0A 2JE8A 1V3MA 5EFFA 3AQUA 1WKYA 5EBAA 1TFVA 1NWUA 4D6FA 1CLVA 3DYMA 4DWSD 5GQBA 1CIUA 5M5DA 1TVPA 2W91A 2GUYA 1CGTA 3FHQA 4HU0A 2OYLA 3AICA 3VGFA 1XV8A 4Z2HA 1W3JA 3THCA 2WBGA 3CUFA 3GH5A 1NP2A 3SIMA 1DWIM 2QMJA 4AZCA 2YBUA 4HOZA 4ZEPA 5A6AA 3N13A 4OOZA 1KXQA 3RJXA 1GOIA 1PZ2A 4HA4A 1K9EA 2ZUSA 2YLLA 2XGIA 4L4PA 1ITCA 1ISZA 4FLSA 1VFFA 2WANA 1HJVA 5DF0A 4B16A 4MB5A 1AQHA 3FW6A 1OGBA 3VDCA 1G1YA 3A47A 1TUXA 1UD2A 4UQEA 3GXMA 3T0BA 2Y2WA 1W2VA 1QNSA 2G3MA 4OOUA 2CBIA 2NSXA 4MB1A 1VFUA 5BRPA 1Q6EA 2AAAA 5E6YA 2WLYA 4Y7EA 1DWJM 1H41A 3W4RA 1JL8A 1MFVA 5GPRA 3TTSA 2CIPA 3I3BA 5C70A 1V6WA 1CB8A 1R87A 5AY7A 4GZEA 4E8DA 2TAAA 1GHRA 4F8XA 1E1EA 3L4TA 1W32A 3B9EA 1E9LA 4MB3A 4JKLA 2OWCA 1GUVA 1QOXA 4IUGA 3CHFA 1UG6A 3HN3A 3DHPA 1EGUA 1RWCA 1UR4A 2V5DA 3WFLA 1XCWA 1E0WA 1E3ZA 2DIEA 2XUCA 3HU7A 2WM0A 3I3EA 1UWTA 4LYRA 1JI1A 1HX0A 1E6XM 3TONA 1Q6CA 1XGZA 2VQUA 1UWSA 3WH9A 1NOUA 3CZKA 4GPNA 1RP8A 5IFTA 3ZT5A 3W81A 3BAYA 2E8YA 5A8QA 1C82A 1G94A 3EDEA 1JZ3A 3AIVA 1OWQA 3WF4A 1Q6DA 3WDIA 4CU8A 2Y5EA 3CPUA 2OYKA 3MMWA 1H11A 2XM2A 2JEQA 4U2ZA 2A3BA 1W9XA 3AFBA 4AD3A 2YA1A 3BAKA 2CHNA 2XG9A 3RO8A 2W5FA 1GZJA 2Q1FA 1G9HA 1XYZA 3AXXA 2XIIA 3WKZA 4AISA 1BYAA 1OT2A 5IDIA 1UKSA 4AW7A 1N7OA 1EDQA 2OSXA 3PZMA 1CXKA 6TAAA 4MB4A 2VRQA 1UQYA 2ZX5A 4A4AA 4TOQA 2WZEA 2G3JA 2XSAA 3WMCA 4PBGA 4IISA 4MJ4A 2YL8A 3A4XA 1E3XA 2W62A 5FIPA 1LF1A 3LPPA 4AWEA 1HKMA 5M17A 1VFOA 2BNJA 1CEOA 4PYSA 2XHYA 3F4VA 3OGSA 2VL4A 2O9TA 4J3TA 4PMRA 2ZXBA 4NI3A 5I78A 1KCKA 5FL0A 1CZ1A 3A4WA 3WD3A 2CPUA 2EO7A 4H8HA 4AD1A 2ZXQA 1PIGA 2QV4A 3S2CA 4IPNB 2WDAA 3J7HA 4FLOA 2A3AA 3AHVA 3T0DA 4BQ2A 1BPLB 1CENA 4KMQA 2O9RA 1LL6A 1V0LA 1JZ5A 3MV11 4DUVA 1JD7A 1LG2A 1E15A 5ABHA 5A69A 5EMYA 4YPJA 3U7BA 4WKHA 1JGIA 1QW8A 3NDYA 1BQCA 5HNNA 2ZUUA 4HA1A 3MUY1 4HZ8A 3KE0A 4X0VA 2MANA 4GZJA 1E4MM 1NOWA 4UNIA 3BC9A 5A6MA 3PZIA 1V6VA 2W66A 1LG1A 1PBGA 5CG0A 3PZGA 2EJ1A 2VNCA 3VKKA 4PMNA 2OYMA 3WNMA 4HMEA 3ARVA 1M53A 3W6MA 5CPQA 2XJ7A 3MO4A 2GJXA 4UZUA 2Y24A 1BHGA 2E9BA 3SUSA 4YN5A 1R7AA 1RP9A 4KRTA 4S3KA 3T09A 4PMXA 4N0RA 3WEZA 2ZX9A 3IJ7A 1HJWA 2CERA 3CHDA 3GDBA 1MXGA 3RILA 1H0IA 2YA0A 1KR0A 1MW2A 1OSEA 3VIJA 4GINA 2IXUA 1JZ6A 4UOZA 1Q4NX 2F8QA 4PMZA 4CU7A 4MNMA 2BHUA 4OIFA 1GOMA 4P7QA 2WHLA 4ACYA 3AIUA 1V02A 1N82A 1LL7A 4AC1X 4D71A 1VAHA 1FH8A 5FOOA 4PMDA 5CPTA 1AVAA 1HMUA 8CGTA 1JFXA 3GZAA 3OIHA 2CHOA 3OLGA 3IAPA 1E6QM 3QHMA 3TTYA 4AD4A 1GW1A 1ZU8A 3AHYA 1E6RA 9CGTA 3L4YA 3D5HA 4W87A 5BROA 2E8ZA 2W92A 1US3A 2AMGA 4C7GA 4AD2A 3PTKA 1W9DM 1UOKA 2ZX6A 1F1SA 3VGEA 3WUBA 4P8UA 3T2OA 2D1ZA 3SCWA 1PX3A 3CHCA 4Z2GA 4J27A 3WEOA 3MSDA 3OLDA 4MNLA 2C8NA 2G3NA 3CUGA 1EIBA 1KXHA 2JEPA 3CH9A 3HJEA 3GXDA 3QOMA 3WUEA 4AZIA 1W3YA 1ISVA 4WKFA 1WCGA 3VIFA 1B30A 5TD4A 5JUVA 1V02E 4DM1A 3MS8A 2W63A 5BXTA 1V6XA 3BAJA 5KZ6A 3CBWA 3OLIA 3WDRA 1PJ9A 5BXRA 3WENA 2E40A 2PBOA 1HJQA 1V3JA 2WCSA 3IAQA 4WSKA 3UG5A 1QHPA 1E71M 1CXLA 3EDFA 1UWRA 1ISWA 5I79A 4XUYA 4XB3A 2FHFA 1KWGA 3EBVA 3JUGA 4J3UA 4CN6A 4JKMA 2BHYA 2D20A 2BVTA 1M04A 4PCSA 2DSKA 5M3WA 2Y4SA 4CN1A 2JFEX 3CLWA 2FGLA 2VZUA 4AEEA 3M46A 1JNDA 5D9MA 1WPCA 2WC7A 3K8MA 2CEQA 3BGAA 1J0MA 5FD0A 5ECUA 4CVWA 1JXKA 1RD6A 2WSPA 3SCUA 4CCDA 1WDRA 3WD1A 1X1IA 3NSNA 2J7HA 5JBFA 2JALA 2XFFA 5A95A 1WNOA 1QW9A 1YQ2A 2WB5A 4AY1A 2YLAA 3GNRA 1CGXA 1YHTA 1MWOA 4XX6A 3VDBA 1H1NA 1CGUA 4D1IA 1J0YA 1JDAA 1VEMA 3VD9A 4OKDA 2ESCA 3VDHA 3OBAA 2BRPA 2JF6A 1N7PA 1TE1A 4AZBA 4W86A 4JFVA 2V38A 4U31A 1EDTA 4CD6A 2A3EA 1VIWA 1D2KA 3TTQA 2XTKA 1BGAA 3ARXA 2HISA 1J9YA 1CXFA 4C7FA 2V5CA 1H4PA 4AZ6A 3OLEA 1B0IA 6CGTA 1UZ4A 3GBDA 1JI2A 5E9AA 1UWIA 3AMGA 3OA5A 3ZO9A 1B9ZA 1U33A 4PUDA 3AHXA 1U2YA 2BXZA 4B9ZA 2A3HA 1WB0A 2WKLA 4M80A 3WDJA 2X0HA 1X1JA 3LPGA 1DWHM 1RPKA 1C7SA 4M29A 3BSHA 1EO5A 3CO4A 4MPKA 4V28A 1A47A 3ZM8A 4M8UA 4DUWA 2YDSA 5JBDA 3RIKA 3VD3A 4OJYA 3BXWA 4PSRA 1IV8A 1PAMA 3AOFA 2XYLA 4GO8A 5A8NA 5BCAA 4XV0A 2Q8XA 2WMGA 1VBUA 1E6NA 2J7DA 5GNXA 1UA3A 1GOWA 4CD4A 2EPKX 4E4PA 1HVQA 1OB0A 4M56A 1UR2A 1FFQA 3AROA 1NWSA 2CESA 1H5VA 1XHGA 3KL3A 2ZOXA 1MQRA 4JHZA 2E24A 1HKKA 3W53A 2OSYA 5A6JA 4PTMA 5HDRA 5A8MA 1NOFA 5BYWA 4GXPA 1CDGA 5EB8A 4GIAA 1XYFA 1L0PA 4DM2A 3PTMA 1N7QA 3U5UA 4UQCA 4GI8A 1KGXA 5I2UA 4TVDA 3OGRA 2VOTA 1NQ6A 2IUZA 3KZSA 1BVNP 3ZJ6A 1FHDA 1MVYA 3PZUA 3UERA 4ZFMA 1FOBA 2VX7A 2GK1A 2BRVX 3VIHA 3MKKA 4URIA 4RE2A 3VO0A 1RWFA 1WP6A 1UH4A 1G5AA 5I5RA 1M01A 4BQ3A 1AQ0A 1HP4A 3WIJA 1BAGA 3WF3A 1PX4A 4M1RA 2VR5A 4V27A 4J28A 3W29A 1TR1A 3VD4A 3MMDA 4KH2A 1WZAA 3IANA 2XFYA 1X1HA 4U33A 4LQ1A 1UH3A 5C8BB 1N7NA 3CZ8A 3L4VA 3CGTA 2WCOA 3ARSA 1VEOA 1ISYA 2QPUA 1E6PA 2WW5A 3TOPA 4Z2JA 1V6UA 4KRUA 2YL5A 4PTWA 1QNRA 2NW0A 3AMCA 4CD8A 4LGXA 1FP8A 2ZE0A 1TVNA 1QNPA 2BFGA 5BWFA 2BY1A 3PZVA 1XSIA 1ECEA 1OGSA 1EQPA 3WF1A 4EKJA 1KB3A 3ZMRA 5M03A 4PN2A 2VUYA 1KXVA 3ALFA 2DH2A 4PEEA 1XSKA 4QCFA 3AZRA 4JFUA 1TCMA 3K4DA 1C7TA 4AXNA 5AC4A 1LQ0A 4TTGA 1WDPA 4CD7A 1LXMA 1W3HA 4L4OA 2X09A 2WBKA 2QLYA 2QF8A 1A3HA 3DHUA 4JCLA 1C90A 1E4LA 3OG2A 2VZTA 1DWFM 4CCEA 4CN4A 3RMEA 1CECA 2E0PA 3THDA 1JZ2A 3SURA 4IM4A 1B1YA 1DWGM 2YJQA 2WVSA 4LYPA 3NYDA 3VX1A 1TG7A 2XVNA 3SUUA 2DGAA 2J79A 1OBAA 1TMQA 1OD0A 4Z2LA 4YHGA 5ABFA 2QHAA 2FDMA 2UWFA 5BRQA 4RL3A 4DUXA 1W1TA 3AI0A 3AS0A 1EDGA 3ZIZA 4UQDA 3EDDA 1EA9C 4LYQA 1B31A 1OIMA 3EDKA 1JF6A 1UD8A 1HP5A 5DO8A 3SCRA 1HKIA 5AYBA 3VNYA 4E8CA 3NSMA 5I3DA 3LPOA 1LWHA 5A6BA 3MSGA 1U30A 1GHSA 3MUZ1 4W88A 4F66A 3NCOA 2O92A 3RM9A 1MW3A 3ARYA 3SCOA 1Z32X 4JL2A 4HPHA 1KBBA 2UY5A 3HMCA 1H3GA 4FLRA 2ZX7A 2XVLA 3DYPA 2Y8VA 1EOKA 4FF5A 3W25A 1GCYA 2J4GA 5A8OA 1TA3B 1ZBCA 1UR8A 1GORA 3WELA 1LL4A 5HBFA 5BXSA 2XVPA 4D6IA 1ITXA 3LMYA 2ZUTA 3AXHA 4AZHA 3WNNA 4B3KA 3NJ3A 4W8BA 1L8NA 3AMDA 3EMCA 1BYBA 1X6LA 4PSPA 3FN9A 2E9MA 4E2OA 2WKGA 2BXYA 4D1JA 1J0IA 1JF5A 2XM1A 4BF7A 2VZSA 1KR1A 4S3JA 3AYSA 1NH6A 1HN0A 1J0KA 3T2PA 1UWQA 1K9FA 3CTTA 3VINA 2D22A 4OUEA 4JAWA 1G01A 1BG4A 3WQ6A 5BXPA 4J3WA 4RE3A 3WY1A 3GM8A 3WL0A 3AISA 2UY3A 4PTXA 2J7CA 2PWDA 2WSKA 1E0VA 3AIQA 1E6SM 1PIFA 4W85A 4P8XA 3PZ9A 4TTUA 4JHOA 4AD5A 4PCTA 1Q6GA 1HM2A 3N04A 1C92A 1E56A 2G8ZA 2ZIDA 1HL8A 1SFSA 2DH3A 2WC4A 4UFLA 3WH6A 3O6AA 1W1PA 1KWKA 3POCA 1PX8A 1SR0A 1ISXA 2W67A 3UESA 3N1AA 3L4UA 1QI0A 1PPIA 2WZIA 3FY1A 5I77A 5IFPA 3AS1A 4JKKA 1JNEA 4BQ5A 4UFJA 1G0CA 5ABFB 2VTFA 2VJXA 1CYGA 1US2A 2QMKA 5LYRA 4HOWA 2OWWA 5I24A 2IXVA 4JIEA 3N15A 1EXPA 2WCGA 1K9TA 4KGJA 2X0YA 1HJXA 7TAAA 2D2OA 2DT0A 1ESWA 1HIZA 1E4NA 4YHEA 4JCMA 2XVGA 3SEPA 2CKRA 4HMCA 5C71A 3PZNA 4PMQA 4CCCA 2VVNA 4QP0A 3WN6A 3WBEA 1QBBA 1E1FA 5D9OA 3WEMA 2ZXAA 5D9PA 4X9YA 3VM5A 1UHVA 3ZOAA 3ZSSA 1I8QA 2VCBA 2ZX8A 3WNPA 4H41A 1GQLA 4ACZA 2D0FA 3FHAA 3GH7A 2ZUMA 1W3LA 2WHJA 2V3EA 3ZT6A 1ZJAA 1R85A 2FHCA 2J7EA 4D6EA 4LXFA 3F5KA 3VIMA 1JDCA 1XC6A 3VGDA 2YL9A 3T2QA 1WE5A 3RDKA 1LOHA 4GO9A 2XGBA 4W7WA 4WSJA 2VRJA 3ZJ7A 1CGYA 2CXGA 2J7FA 4QAWA 1BF2A 4OZOA 1MFUA 3VGHA 3OZOA 1KFWA 3BAIA 3WQVA 2WMKA 3WQ5A 4XZBA 1HKJA 1QHZA 4J7RA 1E6ZA 3BCFA 1J0JA 2WXDM 4NZCA 4OBSA 1EHAA 5LA2A 1H0GA 2VVSA 3N18A 1WAWA 2V3DA 2WVVB 3L2MA 1BYDA 1K6AA 3K1DA 5DT5A 1BGGA 1VFMA 2J74A 3U57A 4UTFA 3GH4A 3TP4A 1UA7A 4P7RA 4PMYA 4W8AA 1QI2A 1NWTA 4M24A 3DC0A 3L4WA 4ZE5A 1R86A 1RH9A 2WZHA 1OGGA 1LJYA 3UCQA 3WMSA 1UKQA 4PMVA 2W4XA 2E3ZA 1V03A 3ZQ9A 4TXEA 2WYSA 1CTNA 1P6WA 1VB9A 3PZTA 3B9DA 3ARRA 3VTRA 1Q6FA 2CKSA 1GONA 8A3HA 3NIYA 2VX4A 3WBAA 4JFSA 4CU6A 5CSUA 1BTCA 3AHTA 5ABEA 2E4TA 2WVUA 2X2YA 3GXFA 2BRWA 4AZCB 3MUIA 3VIGA 5A6LA 3VGGA 1UWUA 1M03A 2XVKA 3CIVA 1AQMA 2G4FA 2J62A 1NP0A 1GOOA 2W61A 1OCQA 1HJSA 2BS9A 5CXPA 2C7FA 1FH9A 1R8LA 4J3VA 4MNJA 2XSBA 5A6SA 1XH2A 4B9YA 2VI0A 2DQXA 3MMUA 3QOKA 4UFMA 3PN8A 4D6GA 1J0HA 2Z1KA 4GI9A 3WH5A 4WLCA 4H04A 1JFHA 1X1NA 4UZSA 4D6CA 3CMGA 1QI5A 3NSXA 1TA3A 4GKLA 2J77A 1QHOA 4ACZB 3O9NA 4UR9A 3SUWA 2YL6A 5I0DA 1LXKA 3N9KA 2G3IA 1MQPA 1CPUA 1C8XA 2WMIA 4AZGA 2VCAA 4U5IA 4GZIA 4ML4A 1WZLA 4HOXA 1H09A 1JD9A 5FCZA 4MDOA 2YKKA 3KL5A 2GJRA 2WVTA 4NF7A 1VJZA 4A3YA 1V3HA 1GVIA 1HT6A 4ATWA 1J0ZA 1CNVA 4TX6A 4UFIA 3E1F1 3QHNA 3UR7A 3WNKA 2B31A 3DECA 2XWEA 3U5YA 2G41A 5DFAA 4OBRA 2VCCA 2OWXA 4W89A 4ZXOA 3AS3A 1HN1A 5LA0A 4MAZA 2F2HA 3QGVA 4WJXA 4ZXLA 1I75A 2GDVA 3SCTA 1OJOA 2O9PA 3AJ7A 5CZKA 4DWSB 4F9DA 4HZ7A 3MU7A 5D4YA 1BFNA 1HXJA 2J7BA 4QLJA 1JAEA 2CCRA 1VEPA 4AZ5A 4AYSA 1OT1A 2GFTA 4AEFA 4R5EA 4HPGA 2EQDA 3ALGA 3IJ8A 4H8UA 4F79A 2J78A 3T08A 3CUJA 2WHMA 1JIBA 1IZJA 4BS0A 4W93A 3ARWA 1I1XA 4EK7A 5CGTA 4P7LA 2X05A 4PMUA 2WPGA 3L4XA 1E72M 1UZ1A 1BYCA 3ARPA 1R7OA 3ARZA 2BY0A 4IPLA 1KGUA 3K8KA 2ZUVA 1QNOA 1Y7VA 4CUCA 1DTUA 3TA9A 3WQWA 3POHA 2ZICA 4TUFA 3GTNA 1WDQA 2DSZA 3AIWA 1B3ZA 3WH7A 2JF7A 2WHKA 4EANA 1IT0A 1CXEA 1E4IA 3WNLA 4AIEA 1C8YA 1E73M 1O6IA 1GOKA 1CGWA 1B90A 1E0XA 5D8WA 4B3LA 3CUIA 3AZSA
chains in the Genus database with same CATH superfamily
2UY2A 3CIXA 1ZBWA 1D3HA 4HHMA 2GDUA 1ODUA 2VZOA 4GXWA 3W22A 3H2FA 4MNKA 2F6UA 4GI6A 3S5NA 1KQZA 1JYXA 3PPGA 1A4MA 1Q3NA 5I00A 2OSWA 3DH7A 2WPBA 2IKJA 4WF7A 1JZ7A 5D33A 4HTYA 2Y63A 1QI4A 2I7GA 3GNOA 1GNXA 1UQZA 2CITA 4DJFD 1R3QA 1FH7A 1HO4A 1I9CB 5C2GA 1W56A 1UC4A 1E70M 2GGJA 2GVLA 3G6LA 1IZKA 4P7NA 4GIYA 5LNUA 2A3LA 4HQVA 3CQIA 5C0QA 4NRSA 5I3FA 1K8CA 4GVGA 3AIEA 4BJHA 3LUTA 3BLPX 2PWGA 1PWLA 4I7UA 4Q4PA 4E8GA 4HJFA 3II1A 3H12A 5K2ZA 2HDJA 2E09A 4GQRA 2DSVA 4XBJA 1V6YA 2WK2A 3BLKA 5G2HA 3SAZA 3WQ8A 2JKAA 3H8AA 2NVCA 4ZE4A 1XISA 2QCLA 1OINA 3IGHX 4WDWA 4MIMA 1XCXA 2E5BA 1KBKA 5K3VA 3TC6A 4AMCA 3GTXA 3UPMA 1AK5A 3CMFA 1JCLA 4UMBA 3ABSA 4L80A 5D2WA 1AZ2A 1KCLA 3CUHA 1XG3A 4KCUA 4KS0A 2Y7FA 2G95A 5M2FX 3W71A 2R9RA 1LBFA 3NUKA 1M7XA 1XYLA 1Z42A 1FWSA 1P6CA 1W9VA 4FLQA 2XWDA 4LUTA 1T41A 2PI6A 4PUEA 1FWEC 2ZDSA 2GSHA 3GVRA 2G97A 3N34A 2XIJA 3V16A 3M41A 1ZQ5A 4Q8TA 4IF2A 3DYOA 5EFDA 3KLKA 2EXOA 4DBSA 3VMPA 1O66A 1FXQA 3EDJA 3EWDA 4DO5A 2FHBA 2V67A 2YXGA 1RWAA 1W3KA 2VO5A 3H7VA 3UXKA 3AYRA 3LBOA 4DO7A 2VFDA 2ACRA 3UR8A 4EF9A 2J13A 1C3FA 1FCQA 2W79A 4BFAA 1VENA 2CU0A 2ATMA 5CGMA 4IX2A 2EJAA 3U2ZA 3TZNA 1UH2A 1LWJA 4KIRA 2X1IA 4MJMA 1F6KA 1F9CA 4C60A 1VCFA 1XG4A 1UD6A 3QYSA 3A6OA 1W9BM 3NQ7A 1BRLA 4H8VA 4HSHA 3WFZA 3W37A 5EGRA 4WDXA 4J3XA 3P67A 2GVYA 3UG3A 4G7FA 3W83A 1WDDA 1R3WA 1QTWA 4H6RA 3EKGA 3ZVIA 1C91A 3GDTA 4FHAA 3M0VA 3S6TA 3M0XA 3KL0A 1WBJA 6REQA 3E74A 3CYJA 4M6VA 4HIBA 3W6YA 4UFKA 3PHAA 1FWWA 1XH0A 3MT1A 1HO1A 1TRIA 3BAWA 3W9ZA 2O0TA 1CXIA 4JTHA 7ODCA 3KTSA 1RCQA 3TXVA 4XAGA 5D03A 4Y8FA 4CVUA 3K4AA 3W73A 2GGHA 4UTWA 3ICJA 2O9OA 4UQAA 2VR4A 3AMLA 3AS2A 2BV9A 1VC4A 1RWHA 3MP5A 1C29A 1GVYA 4JL1A 3LU2A 1R2TA 3LRKA 1H51A 3AWOA 4D72A 5JIWA 3D6NA 5K4ZA 1P1XA 4BQ4A 4YCOA 1DJWA 3VD7A 3W70A 2V5JA 3HGJA 3M5VA 4N4PA 1IXNA 3EMZA 1ICSA 4CD5A 3QN3A 2VEMA 2BVDA 4FALA 2EPNA 5C7HA 5TBOA 3SCVA 1TZ9A 4TX8A 3SRHA 4F2BA 1RLDA 5AYZA 3GXPA 4Q4RA 2Y5SA 4ICNA 3WDHA 3M0HA 6TIMA 1SO5A 2WMFA 4S38A 3QKEA 4EXAA 3RPMA 1E1CA 3W7JA 2GSJA 2XIBA 3ARQA 4A8RA 2PTWA 1DQWA 3DHFA 1LROA 1PHQA 1J6PA 1ZY9A 1OJPA 5JMUA 5K9XA 1EH9A 3GDRA 4ZTYA 1OZQA 3WSUA 4QDPA 5DT7A 4TV6A 4C6LA 3WK0A 4EF8A 1UR1A 3W7DA 4H9TA 4PFMA 4I9JA 3LTSA 3FXYA 1BWVA 2ZUNA 1NWRA 3F03K 5LXXA 4GACA 3C8NA 2D23A 1WV2A 2VC5A 2OLAA 1GK8A 4QQUA 1AG1O 4QROA 1P1MA 1VKFA 3R0DA 1EIXA 3VFCA 4IPIA 4UQBA 2YDRA 4H3DA 4HD5A 1OJMA 1YE6A 2PE4A 4M82A 5I09A 2PTZA 3UG4A 3NQGA 1F74A 5LHEA 1W1A1 4X22A 2A1YA 4PTDA 4KWSA 1X97A 3R0KA 1DWAM 3DZ1A 4S1FA 4J3ZA 2X1SA 2PB1A 4R9XA 4WQ6A 1WOBA 4KESA 1A0CA 4NYUA 3USZA 2B7OA 3SI9A 2E6FA 5HPCA 2V2CA 3N14A 4Y96A 2YIHA 4JDYA 4DYKA 3VNMA 1FFRA 2DSUA 1TTJA 4MWAD 1PTGA 4WCJA 4N9DA 2H9AB 5LIYX 1J01A 4PRWA 1BVZA 3W26A 1ZS2A 4JEQA 2BTMA 4Q8QA 2WMHA 1XI3A 1FWTA 1ZBVA 2PDJA 4HMDA 4O12A 2IKHA 3SCPA 2WMJA 2FIQA 4B15A 1NARA 3BURA 1I1WA 1EL3A 1V0KA 4ZOAA 1RWGA 3CWNA 4DF1A 4ONVA 3OQ8A 3OPSA 1G4SA 2VQTA 3GXTA 4QSFA 3GZ3A 4EIVA 1GT8A 2BY3A 4XZWA 3QLDA 3NOEA 3RR4A 1R46A 2QUNA 1F4HA 3AHZA 4W8LA 3SY8A 3GFYA 3TCSA 1YNPA 1POKA 4HNNA 2QEZA 3GKAA 3WLKX 2FFCA 1DEDA 3NL2A 3N9RA 5F4WA 4QQ3A 1GQIA 2A7NA 2E28A 2E9LA 1W9PA 1JXJA 4UTIA 4UFHA 1UR9A 4TQTA 4WIWA 1FUYA 3VKAA 3VMNA 3UGVA 1J4EA 4CQBA 2EPLX 4Z08A 5D9NA 3ITCA 5FL1A 3UZZA 3BK0A 4MDPA 1KQYA 3PZOA 4YS1A 1HJUA 1JR1A 3LHTA 1PTAA 1F07A 4M19A 4HKPA 4IMAA 2GK1B 4QCEA 3NTYA 5CLWA 4L64A 2GVEA 4PMOA 5GVJA 2PRMA 4LS2A 3BW4A 4EOUA 1Q7MA 2J66A 4DJDD 4F9JA 4D6JA 4BA0A 2GOUA 2VFGA 4NZJA 3AQUA 1WKYA 1YPXA 3L65A 2Y6ZA 5T91A 3VZXA 3LQGA 4AVNA 1NWUA 4K7VA 2HNEA 3RX4A 4RXGA 5GQBA 1CIUA 5M5DA 1TVPA 3NXFA 2GUYA 3OBKA 3FIGA 2RJGA 3AICA 1B57A 1XV8A 3GU9A 3OHMB 4Z2HA 4QHRA 1OFDA 3GH5A 1TIWA 1NSJA 3SIMA 3DESA 3GIQA 4ZEPA 1KXQA 4GIRA 1K9EA 1SW7A 2PTDA 4LUYA 1KRCC 1ISZA 2F2KA 1XCFA 4B16A 3WQEA 3JRKA 2FTWA 3AYVA 1DKWA 1A3WA 2FB2A 3A47A 3OA3A 2WKJA 3VCCA 1QNSA 2HE5A 2EAWA 2G3MA 4ES4A 4K8HA 4HSOA 3V1PA 3EOUA 2OODA 1MEWA 1A53A 2AAAA 3EPMA 5T8GA 2WLYA 4QDWA 4Y7EA 1DWJM 3GIYA 3IJLA 3TTSA 2CIPA 5AY7A 4E8DA 1IEWA 1K03A 4RPQA 1O60A 1E1EA 2L5HA 2F6XA 1LBMA 1W32A 2ATSA 3SECA 4L56A 1E9LA 4IUGA 2Z25A 3DHPA 1IZCA 1RWCA 1UR4A 3AXMA 3CT2A 4NG3A 4F4RA 3I3EA 4LYRA 1JI1A 2OEKA 3TONA 4IWWA 4S3CA 1XGZA 4U4MA 3WQGA 1RP8A 3W81A 4HN8A 5HQEA 2E8YA 3QR0A 1DORA 1G94A 3EDEA 4YJ5A 1Q6QA 4CU8A 3P80A 3R12A 2OYKA 4ERIA 4CNPA 5I3JA 1JGMA 3LI1A 1T5AA 3TZFA 1W9XA 2J6XA 3N6HA 4AD3A 1KLZA 4PC8A 2PS2A 3AYTA 4J9JA 3S6OA 3IT4B 1PB0A 2QPXA 3TR9A 1OT2A 5IDIA 3BJTA 3P2VA 2QZRA 4QEHA 1ZAJA 3HPSA 4IISA 4MJ4A 1SFLA 1XGDA 3RU6A 5CZTA 1KM4A 4CNUA 5FIPA 4F3HA 2X0SA 4JBRA 1GEQA 4AWEA 3PF3A 4JPGA 1VFOA 3NQMA 3C0SA 2GPTA 1U5HA 5AECA 4AU0A 2O9TA 3IUDA 3WK3A 3TW9A 1CZ1A 3PWGA 3A4WA 2X7VA 4IQLA 1ZENA 1A5UA 2QV4A 3R43A 1UJPA 3LCHA 2P10A 4O11A 2C1IA 2HV5A 4FLOA 4MHBA 3T0DA 4BQ2A 2ODOA 1RJQA 1CENA 3TMLA 1V0LA 1JZ5A 5CAKA 3L5MA 1ENUA 3UWWA 1M1BA 3IRSA 5HNUA 4ZB2A 1UC5A 3NDYA 2GQ8A 1BQCA 3R6IA 3ZZ1A 5EMMA 2ZUUA 4HA1A 3MUY1 1E4MM 4A21A 5A6MA 1WX0A 4IOTA 1V6VA 3C56A 3KOYA 3VC6A 3C0QA 2VNCA 3VKKA 4NNCA 4RX0A 4RZBA 1LLZA 1M53A 2XINA 4L61A 1ZALA 1ZAHA 3MO4A 5I07A 3W2JA 1YRRA 4GLEA 2Y24A 5FJPA 4PE8A 4R7WA 3C2EA 1BHGA 1RQBA 4I9TA 1R7AA 3T09A 1O5RA 1OADA 1H7XA 2ZX9A 1MRAA 3NL5A 3GDBA 1DQXA 3RILA 3TNOA 1KW1A 1R0MA 3CPRA 2PFHA 3BZJA 3SQSA 1IHIA 3JS3A 1S2WA 2QF7A 3R7MA 4MY9A 1SZRA 1KM6A 4OIFA 1AD1A 4P7QA 3FGCA 3LK6A 3AIUA 1N82A 1F6YA 1FH8A 2Y7GA 5FOOA 4PMDA 1HMUA 1TWSA 4NASA 2H3BA 3OIHA 2QT3A 3BL3A 3W23A 4XKYA 1DHPA 3WQOA 3RMJA 3QQ0A 4ADTA 9CGTA 3HMJG 1A5OC 3D5HA 5E1QA 1FWIC 3PS7A 2E8ZA 3C52A 4ZCWA 3QYQA 1H61A 4BI6A 3VGEA 3WUBA 2OKTA 4LRSA 4Q8WA 1R30A 2D1ZA 4UTHA 4LCRA 3GG8A 2A4AA 1T8XA 1VS1A 3WEOA 3OLDA 2H8XA 4MNLA 3E0WA 3U3HA 1PTDA 3HJEA 5FJRA 2DIKA 4H7CA 1JCMP 1W3YA 3G1AA 1AODA 2Q8LA 2QUUA 1ELSA 3RCYA 3A24A 3MS8A 1OC5A 1TWDA 4NJHA 3T4CA 4QEEA 2XGZA 3OLIA 3L67A 1HUVA 1FDYA 1HJQA 1V3JA 2A0NA 2WCSA 4WSKA 3L7RA 4M3PA 5BWAA 4LVGA 1BXBA 1CXLA 1UWRA 3OIXA 3QY7A 2HS8A 4XUYA 3FEQA 2BHYA 2PTXA 3B8UA 5F4XA 2DSKA 5ECVA 2INFA 3M46A 1I2NA 4TX9A 1M7OA 2WC7A 2CEQA 3BGAA 1IR2A 1JXKA 1RD6A 4LANA 3SCUA 3EAUA 1WDRA 4RDZA 2J7HA 4ZO9A 4ZMGA 7REQB 4M7TA 4V15A 4YNGA 5G4HC 1VD6A 3FDGA 4AY1A 2YLAA 2EG7A 4O17A 3TC3A 1CGXA 4XX6A 3I7SA 1H1NA 4D1IA 4OKDA 1TE1A 2OCZA 1MUCA 4ZVJA 2A3EA 5J8LA 1B3OA 4C6MA 1ONRA 3ME3A 2FGBA 2HISA 1K02A 1Y0EA 4MGGA 3ELFA 2V5CA 2NVAA 3OLEA 1QWKA 4LEFA 4UWMA 4WXYA 3ES8A 1VBGA 5CSRA 2ICSA 1B9ZA 1U33A 4PUDA 4NAEA 4QNEA 2WKLA 4M80A 3HQNA 4EWND 3L0KA 1MUMA 1UASA 3G1XA 5HULA 3BSHA 1PZ1A 1EO5A 1FHVA 4MPKA 2DU2A 3SGUA 3RIKA 4PSRA 4LUJA 2R1KA 3TAOA 2Z26A 2ZTJA 3AOFA 2QJGA 4KRZA 5A8NA 1S3TC 3V5FA 4KWVA 2Q8XA 1XLFA 1XQLA 1ONWA 1UA3A 1GOWA 2FMOA 1ECQA 2VZKD 3VK5A 1UR2A 2A7RA 1QXLA 1OEPA 1YBQB 3HFTA 4KF1A 1H5VA 3VUSA 2NX3A 3KL3A 2ZOXA 4DRSA 2YCLB 3R79A 4JTRA 2I17A 3HO8A 5HAOA 3WQFA 5L6UA 1KFLA 1NOFA 2GUBA 1I2PA 1XYFA 5IBXA 1XW8A 4DM2A 1N7QA 3S0CA 4LAMA 4UQCA 3S1WA 4FNSA 4GUGA 1FOBA 1V7YA 1FHUA 4GGHA 2IQ0A 2W27A 2BRVX 3LCGA 4DQWA 4RE2A 4PR4A 1WP6A 1GPWA 4RJEA 2FZBA 3LBMA 1HP4A 4JTLA 4M1RA 2XSXA 2VR5A 1EGVA 1GVFA 4RCXA 4E6MA 3TK7A 3DG6A 3WLJA 3FJLA 3F2DA 3EWZA 1WZAA 1NF7A 2XFYA 1X1HA 3N2OA 3IIVA 3TN3A 1HKWA 1UH3A 3GDMA 4GX8A 1K4GA 1N7NA 4CEXC 5BRBA 2ZRVA 1ZTVA 3CGTA 4US5A 5DRCA 2VOMA 3V4BA 1XUUA 2BGQA 2Z2AA 4LS1A 4Z2JA 2QGYA 3B8TA 1E51A 1AH0A 3ANUA 4F0KA 3RITA 4PTWA 2INEA 1H50A 2GVJA 3TAKA 4LGXA 5XIAA 4UNLA 1R2RA 4LUIA 4C6NA 1QNPA 2QCFA 5BWFA 3PZVA 1P5BA 4QIUA 1OGSA 1EQPA 5CC3A 4EKJA 5DMMA 4PN2A 1XSKA 4QCFA 4X9SA 4KERA 3GG7A 1C7TA 3L23A 5AC4A 1WQ5A 4GCAA 1W3HA 2FYMA 4JCLA 1SZGA 3DHUA 4WHBA 3D3FA 3S5ZA 2C6QA 4GRSA 3URBA 1W17A 1GVOA 3IARA 5AOUA 5BOOA 3IIZA 1JRBA 3RMEA 1CECA 3GR8A 1XFBA 2XH2A 3PJTA 3KWSA 2GJLA 4O8RA 1JCXA 2PZ0A 4MWAB 1TG7A 3P14A 2J79A 1N2VA 1ZLPA 1TMQA 1OD0A 1KCZA 1I4NA 1BD0A 5RUBA 4PA8A 2PU0A 2YEPB 4YVVA 2Z7KA 3PJXA 1ZHAA 2HXTA 5HNRA 4DYJA 1W1TA 2TPSA 1KC7A 2REQB 1CB2A 3ZIZA 1P43A 1BKSA 4AWSA 4LYQA 3OYZA 1SJBA 1TE6A 3SCRA 4C1LA 4JN8A 5HJXA 4E8CA 5I3DA 3MSGA 1GHSA 3PP7A 5CBBA 4F66A 4NU7A 3WJSA 4LB3A 3HFYA 3W2KA 1LP6A 5AHEA 2AMXA 1FKXA 3DYPA 4S3EA 3PG9A 3IK4A 1EX1A 5BXSA 3GFXA 4D6IA 4C6QA 4JYDA 1ITXA 4Y9NA 2ZUTA 2AL2B 3AC0A 5DN1A 4DYEA 2VDGA 2CZVA 5HJYA 3AMDA 3I10A 1X6LA 4LUSA 3DI1A 4REQB 1IEVA 2VGBA 9XIAA 4PUUA 3DFSA 3FN9A 3FCPA 2WKGA 2BXYA 3DG7A 4C6OA 4RXFA 1JF5A 4NL1A 4EX4A 2XM1A 4LAOA 4TV5A 4NAEB 2GGIA 1KR1A 3HF3A 1NH6A 4NXSA 1HN0A 5EA9A 3LZ3A 1K9FA 3VINA 3PUGA 4HN4A 3M1ZA 3GO2A 1G01A 3N4EA 4RE3A 3GM8A 3Q58A 2WJZA 3AISA 5FJJA 4PTXA 1A4LA 3BGGA 4LTSA 5AB3A 3FJ4A 1FWRA 1E6SM 3A4JA 1A5BA 1TPWA 2V30A 3GX9A 3RG6A 4TTUA 2A7PA 4O1DA 1I2RA 3W7OA 1QCWA 4QS5A 3N04A 2ZIDA 3I6TA 1SFSA 2CXEA 1Q2SA 4DI8A 3CV6A 1AZ1A 3WH6A 3JZUA 1HQTA 4M6UA 3POCA 1PX8A 1POJA 1QI0A 1PPIA 2WZIA 3AS1A 3W7MA 1DJQA 1JNEA 3QH2A 4GYFA 2TMDA 2VTFA 1VP5A 1CYGA 1TCDA 3T42A 2QMKA 2UV8G 3LY0A 2OWWA 5I24A 2IXVA 3N15A 3R10A 3VOHA 1Z9AA 4DF2A 4YTRA 3PY2A 4Y9MA 4JTFA 2D2OA 2DT0A 4QS6A 4JQAA 4B3ZA 3SY1A 2DZWA 4JCMA 4E3VA 1S2UA 2QKFA 3LHWA 3SEPA 4EP8C 3SQLA 3V3WA 1S3HA 4PMQA 3NQVA 3LA4A 5D9OA 2G3FA 3VM5A 1NDYA 4XKYB 3S6DA 4PRRA 3QLLA 3ZSSA 1F3WA 1I8QA 1O4UA 1JULA 4ACZA 2XDFA 1XLHA 1TJPA 3W86A 2C18A 2J9ZA 3SIZA 3T55A 1F76A 3WQPA 1XLJA 1UWAA 4LEQA 3B9OA 1TVLA 3T81A 2HWGA 4TR9A 3T2QA 4PCFA 1OFQA 3RDKA 4W7WA 4WSJA 1OC6A 2Y0FA 1CGYA 2J7FA 1L6GA 1Z7AA 3FK4A 1NDZA 1BF2A 1T99A 4F2UA 3LRMA 4B4HA 2WMKA 4IIHA 5LIXX 3WQ5A 5AN7A 3KBMA 2PDQA 1DXFA 3MBFA 2GYIA 3QQWA 1H7NA 4JIPA 4IHCA 3LLXA 5LA2A 4E4UA 3FS2A 4GVFA 2VVSA 1RY8A 1XM3A 3B0PA 3GHRA 2WVVB 1BYDA 4INFA 2J74A 1SZNA 3WQDA 2WO5A 3O63A 3U57A 1A5AA 1FVPA 4YVXA 1GGOA 4OBTA 3QC3A 4P7RA 4PMYA 1QI2A 3BLEA 4LF2A 5EMUA 3PANA 2QCHA 1XLEA 3UY8A 3HG2A 4ZE5A 2AKZA 1RH9A 4WR3A 3W7RA 3S2LA 2WZHA 2X1RA 3CM4A 4C6CA 4J2PA 3KXQA 4MYXA 3ZQ9A 4M5PA 1VB9A 3PZTA 2CWNA 1G67A 3B04A 2YFOA 4PUWA 6ALDA 1Q6FA 2CWXA 3WLPA 4JFSA 3HG3A 1BTCA 1VBJA 1XYAA 4QGCA 1YMYA 3LV5A 3VIGA 2VD8A 4HA0A 3P84A 1UWUA 4K39A 1G4EA 1PKYA 3GNNA 4HNOA 3E2RA 3BV7A 3UG8A 1YXCA 3HM7A 2C7FA 3P0WA 4MNJA 5A6SA 4MMWA 4DX3A 2Q8ZA 2ACQA 1VHCA 1EB3A 3RUBL 4ZOCA 4GI9A 3WH5A 2WM1A 1XPGA 3C2OA 3N19B 4N7QA 4UZSA 4D6CA 5H8MA 1FWFC 3SB0A 1E0TA 1QI5A 3NSXA 3AU2A 3L2IA 4LC6A 4I6KA 3NEHA 1QHOA 4ACZB 4ZGYA 1JVNA 3HURA 3M0IA 5I0DA 4JTGA 1LXKA 1MQPA 1CPUA 4U5IA 2E1WA 2ZZ4A 4ML4A 1WZLA 2V9DA 2C91A 1PUDA 2GJRA 1VJZA 4A3YA 3NQDA 4MLRA 4I5XA 1J0ZA 4UFIA 5DY2A 3UR7A 4PB3A 3WNKA 3PULA 2XWEA 3U5YA 3SDOA 5DFAA 1MSSA 1P48A 2VCCA 2OWXA 3AS3A 2Y1HA 4FX7A 1TV5A 3QGVA 3PBMA 4FB7A 3VXGA 3G3DA 1XLKA 1LOQA 2GDVA 1OJOA 1W3NA 2ISFA 1NELA 4ZOBA 1WA3A 4JQ3A 4F9DA 3H7UA 3RAOA 1GJPA 5D4YA 4S3GA 2E5CA 1JAEA 2CCRA 2IPGA 1X8CA 4FI4A 4A05A 3NR0A 4XBKA 4AZ5A 4AYSA 2PC4A 1OT1A 2PCQA 1XBZA 3ALGA 3QQ1A 3RLUA 3V35A 4GHRA 5H8PA 3TQVA 2XN1A 4E38A 4JHMA 2IQTA 1Y8BA 4EK7A 4IPPA 3UJFA 5CGTA 3M47A 1EJUC 1XL9A 3HV9A 2WPGA 2PDUA 4H19A 2AKMA 1AA1B 4O0KA 1UZ1A 4IXHA 3ARPA 4HNTA 1ZAIA 3SJNA 3TA9A 4C6BA 3WQWA 1ZUAX 3FSUA 2KXSA 2DSZA 3IUIA 3TR2A 2QAFA 5DY3A 4EANA 4H6KA 2P8CA 1QPRA 5D05A 2V2HA 1E4IA 3REQB 3T6CA 1EF2A 4K1WA 4GUHA 4JIRA 1E73M 4R53A 2ABAA 3CUIA 4ERAA 4Q22A 3E96A 2VYOA 1J2BA 3GY1A 4BKNA 1L6WA 5CJNA 1S46A 3HOJA 3KHJA 3TYDA 1OYAA 3DEQA 4Z17A 3O0KA 1LYXA 3CV1A 1BLIA 3GTIA 4FO4A 1FWNA 1EYEA 3V1HA 1D7FA 2XU2A 1OCJA 3T4WA 5BU9A 1SUXA 2OFJA 1NFGA 3KOZA 3BO9A 5KSWA 3WD0A 3LCFA 1J12A 5A2BA 4BI5A 2XZ7A 3V0TA 2RGLA 4XZHA 2F61A 2ZTKA 3TYZA 1XIMA 7ENLA 4LX4A 4IIFA 1JAKA 1MW1A 4PGLA 2XFRA 3WLNA 2YPIA 3DBNA 4KEMA 1W1VA 5JBEA 3QV9A 2CYGA 3W0KA 1JDDA 1V08A 1IWPA 3APTA 1XD1A 3L4ZA 1S38A 5BNKA 1XIEA 1KNWA 2OJPA 1PEZA 3B03A 3P7YA 2AL2A 4W7UA 1W1ZA 2WVVA 3AIBA 2DSWA 4K68A 2OZTA 2D3LA 4LU0A 3HG5A 5TQLA 4QDMA 5AC7A 5HMEA 2VHLA 3E3HA 3RO6A 3RCMA 3WD4A 2BXVA 3MI3A 1OFAA 1PZ3A 1JYWA 2F6KA 2KX9A 1NU5A 1UPMB 2GJXB 2FGZA 2CHRA 3MO7A 3CQKA 3PFRA 1XIHA 1J18A 1C8VA 4GJJA 3ZYZA 1TREA 3OGVA 3TH6A 3CHEA 1GOXA 2CNCA 1XX1A 1DIDA 1S1RA 2OB3A 3ZSTA 5CLTA 1CWYA 2IPWA 4HVXA 5C2CA 1HL9A 4M7SA 4H01A 2E68A 5I23A 1SR9A 1CBGA 2GGEA 3BV4A 4ORIA 1S2VA 1V0MA 4Y6GA 5LNRA 3SGZA 4WX2A 1JYNA 1TPH1 1AL8A 1VJSA 3Q67A 1REQB 5B7YA 2EKGA 2JIWA 3KZPA 1MO0A 2PRHA 4RR4A 1LZOA 4WK9A 1UBPC 2C0HA 3ZLHA 2J25A 3GG0A 2ALDA 4AMAA 2XPKA 2Y8KA 4ADUA 3UA3A 3W6LA 1EFZA 2Z1XA 3LTYA 4OGZA 1GOQA 3B0YA 4V1YA 4NXKA 1MW0A 5EMKA 3CU2A 2QCDB 3IJ9A 2JGYA 5MKGA 4BI7A 1BXNA 1SMDA 1NAL1 1IQ8A 3VX0A 5CPNA 2FZDA 3GR7A 3VIPA 1ZJBA 2V3FA 4P7OA 1GVRA 4Z0JA 1SPQA 3LS9A 1TMHA 2DPEA 5I3GA 1O5KA 1WDSA 2QJNA 2ISWA 1F9GA 1LLWA 4RZ5A 4JYEA 5CG7A 2VMFA 5PTDA 4L6DA 3NVTA 1X1OA 5XIMA 4O53A 1LT8A 4MUPA 3DG3A 1CXHA 5HQLA 1W3IA 3SCNA 5BOFA 1W54A 4JTJA 3UD1A 3QPZA 2DVXA 1QPKA 4WY0B 3GYCA 4OECA 2D24A 5GNYA 4HNUA 2DQWA 3EWCA 3UETA 3GK0A 3GR4A 2ZQ0A 4L1XA 1EEPA 3PTQA 1Q6OA 2Z6IA 3N2MA 3UEQA 1H62A 2CETA 3SW6A 2QJIA 3B8SA 1ML1A 4AIBA 1RVGA 1S5WA 4Q7NA 4E0CA 4MZ8A 2JQXA 1W91A 1GG1A 1YLVA 5KETA 4BCEA 2B7QA 4GA8A 5D8ZA 1CB7B 1OK6A 2CZFA 2PGFA 3MYPA 3LEPA 1B3VA 4U3CA 1PKMA 2RDUA 2JKPA 2OZ3A 3CB8A 4Z2KA 1XLCA 1NFPA 2V0TA 4H2CA 3LMZA 5AHMA 2QCEA 1JZ4A 4Q6XA 3VPLA 2PLKA 3H55A 2FJKA 2NT0A 4B5XA 4DXKA 2HK0A 2I5GA 1HGYA 2POTA 3W85A 4GZ7A 1D3CA 1XH1A 3N11A 2HTMA 3L2LA 5E93A 1MUWA 4DBEA 1R3VA 2DZUA 1J5SA 3VNLA 1EO7A 3TTOA 2EBNA 1XBYA 4JTAA 4DI9A 3TQKA 1K6WA 4D6HA 5HPOA 1R3YA 3FA4A 4W5UA 5IRPA 4L65A 1E40A 4KFNA 1F61A 1KM1A 4M6QA 1QPQA 2E22A 4Y8EA 3PPFA 2ZZ1A 1ADDA 3TYEA 3EPNA 4PTVA 2NQLA 4S3AA 2FZ8A 3EKZA 2AOSA 3O8AA 3S3GA 3BSGA 3EB4A 4UCFA 3SUTA 3QSTA 4J3SA 1TJ2A 2Z4GA 3WH8A 4FIQA 1W0MA 2VUNA 2BHZA 2HSAA 3PBGA 2V5KA 2HZGA 3IK2A 3TU9A 4PCPA 1B5TA 4Q7BA 1UR0A 3QV8A 2Z28A 4HNLA 1MMFA 2Q71A 4ATLA 5ABGA 3APGA 3CK5A 3WUFA 1WKDA 2OR2A 1JYVA 2IS7A 5HATA 4HHLA 2Y5JA 4O54A 3VIIA 2Z29A 3QR3A 2POZA 1EC8A 1OG0A 2ZZ7A 2F38A 4JFTA 2Z1SA 3VOCA 2DIJA 1TB3A 3BMVA 4W7VA 3LXCA 3C2YA 3N12A 3IGXA 3SFKA 3H2MA 3O6DA 4EAMA 3MCNA 1OHLA 3LLFA 1PSCA 4HU8A 4LC8A 4DAFA 2VURA 2NSOA 4MAVA 3IT6B 1DJXA 1AW5A 3GVVA 3MKCA 4Y9OA 2BP1A 3W7QA 3L9CA 5HK4A 1US0A 3KRUA 2PC8A 3PM6A 3IVUA 4C5ZA 3PFMA 5A2AA 3ITVA 3KP1A 3N6QA 5E0FA 1OY0A 1ME7A 2R1PA 2EPOA 4JIQA 1F4AA 2J7GA 4HB7A 9RUBA 1JEZA 4JIIX 2WNQA 3V36A 3LLDA 7REQA 4HA3A 2PP3A 4QLLA 3FAXA 3FKRA 3N9SA 3IV8A 1YPFA 3NM1A 4MWAC 1UR3M 3GU1A 3GVGA 4NJJA 2RAGA 1XIGA 4AIUA 1CI1A 1H49A 2GOKA 3HGSA 3KFTA 2ACUA 3BANA 2RDTA 2QGHA 3ARTA 3EYPA 3C5QA 2PA6A 5HOSA 4B5NA 3RM8A 4ZB5A 4X0NA 5LXEA 1KM5A 3D3AA 3GNXA 3GNPA 3DAQA 3QTPA 1XBVA 1HFBA 3M0JA 4XUGA 1UYQA 2FH8A 1DPMA 2JIEA 3DIPA 1NY1A 1TJ0A 3NWRA 4A3HA 1VCGA 2DP3A 1TV2A 4DJFA 4GBDA 2HEJA 3H53A 3VMOA 4IGHA 4GQQA 2P1FA 4C7DA 1LTDA 1O68A 3TA6A 3UXAA 4U2YA 1Z8AA 4Q4MA 4QISA 2D3NA 1ITUA 3W28A 3S9IA 3PBVA 1MEHA 5CSYA 3S8HA 5M1TA 4HP5A 5HWMA 3ABQA 2JE8A 3SM0A 1TFVA 3TSDA 3DYMA 2AQVA 4A2SA 4HBKA 1XIBA 1CGTA 3FHQA 4GFSA 5T26A 3MI6A 1YE4A 5T9BG 3VGFA 3RLHA 5G4EA 3H24A 2PDFA 3F7JA 4IJCA 4WY0A 3THCA 5HWJA 2PD9A 3WCZA 2OVLA 1Q6LA 4AZCA 1XIIA 1WXYA 3G24A 2OX1A 4HOZA 3T9PA 3N13A 4YVPA 1GOIA 1PZ2A 1SZEA 4Z0SA 1OK4A 3P5ZA 2XGIA 1ITCA 3W1UA 1KTBA 4HNCA 1TPC1 2XIQA 5DF0A 2HNHA 4C6EA 4G6CA 3KRBA 3A9IA 3UWUA 3MSRA 1AQHA 3CEUA 1TUXA 3NZ1A 4UQEA 2I56A 2DZTA 2Y2WA 4AG0A 3T0TA 3UJSA 1MDRA 2CBIA 4TU1A 5BRPA 3GC2A 1Q6EA 5E6YA 2HRWA 4K2SA 3B0XA 1P0NA 3W4RA 1MFVA 1YEYA 3JR2A 3M0ZA 3I3BA 1RALA 1V6WA 4MF4A 1SO6A 5DBUA 4GZEA 1L6YA 2WQDA 1U5VA 2YDAA 2GL5A 2VENA 4NZFA 3DHDA 4WSHA 3UZJA 2O7SA 3A64A 3HN3A 1NDVA 5EBUA 1E0WA 3L0NA 5CPLA 3EX3A 2AQOA 4G5DA 2WM0A 1AH4A 2YZRA 5C9ZA 4Y9AA 2DW7A 1TPDA 2VQUA 3H2NA 1UWSA 1C9WA 5CPMA 3CZKA 4GPNA 5IFTA 3ZT5A 1A5MC 1C82A 3F2BA 3AIVA 1OWQA 1SJAA 1Q5MA 3WF4A 3WDIA 2Y5EA 4Z1YA 3CPUA 1P6BA 5HNTA 2A3BA 3L66A 3HQOA 2WV8A 3TYCA 2XG9A 1TTIA 4YL2A 2Q1FA 1XYZA 3WKZA 3AXXA 4AISA 3WLTA 1BYAA 2RFGA 1UKSA 4S3BA 2DY3A 2OSXA 3W1MA 1UQYA 2ZX5A 3EOLA 1FWHC 4TOQA 1ZGDA 1S5TA 3LHZA 4R34A 3WMCA 1NVMA 4A8LA 4WEVX 3VOJA 4EVZA 2Q01A 4MYAA 4AWTA 4LVBA 3TEVA 2W62A 4QJ3B 2NV9A 3ID7A 4AWUA 3F4NA 3OVRA 5HINA 1JRCA 3F4DA 3TTEA 2PODA 3W84A 4QTGA 5HUPA 3OGSA 4ZQOA 2VL4A 1PO9A 2IKGA 2CZDA 2OQLA 2ZXBA 3NQAA 5I78A 1DJGA 1KCKA 4E2DA 1JUBA 1XDMA 2EO7A 4H8HA 1EZWA 4AD1A 4AFYA 1PIGA 2WDAA 3R8HA 1GZ1A 3VOIA 1MXSA 5D2XA 2O9RA 4LAUA 3P74A 1RR2A 1E15A 2FZMA 2REQA 5EMYA 3U7BA 4WKHA 1ZNNA 1QW8A 4DBUA 5HNNA 4LOCA 3LM3A 3B0VC 3TV8A 1XRFA 3KVJA 2BWGA 4HZ8A 2GSEA 2MANA 1NOWA 4UNIA 4M51A 3PZGA 3O16A 5EKYA 4Q8PA 4PMNA 4HMEA 4M1BA 3PB2A 4JXCA 2VEGA 4X2PA 3R0UA 1ZFJA 1XPYA 3QV7A 3NQ6A 2KAUC 4UZUA 3EA3A 2DVTA 3SUSA 4HHPA 1TRDA 4UXDA 4CCZA 1O5XA 4UR7A 4KRTA 2C16A 1SZFA 1RQHA 1N55A 3WEZA 3LB0A 4GH3A 3V18A 2OO6A 3CHDA 3VIJA 3EX2A 4GINA 1Q4NX 3W2NA 4XZ9A 4MNMA 4Q7IA 3QZEA 1GOMA 4REQA 3CQJA 1V02A 1LL7A 4AC1X 1K8XA 3F4WA 5CPTA 8CGTA 3GZAA 5LGZA 4IIEA 3IAPA 1TV7A 3W02A 4AD4A 3WLSA 2BGSA 4W87A 4IMFA 5BROA 1M9HA 3TN5A 4JX4A 5I03A 2XH4A 1EJVC 2PP0A 1F1SA 2DORA 1A50A 3R11A 1PX3A 4D8LA 4AY7A 4Z2GA 4J27A 5FA5A 2UBPC 4DHGA 2C8NA 1ALDA 3PJWA 1REQA 3CUGA 4FSAA 4JQ1A 2JBMA 1AW2A 1EIBA 3VCRA 3CH9A 3GXDA 4E4FA 4EPEC 1S5VA 4H2HA 3T7VA 3FVMA 3THAA 1P0EA 1B30A 2AL1A 5TD4A 3G8EA 3UY7A 4DM1A 1ZRQA 1V6XA 3BAJA 2ZCGA 5KZ6A 2V6AA 3WDRA 5BXRA 2PDMA 3OOQA 2PBOA 2FVMA 4MZYA 4IMEA 4K37A 3UG5A 3UWZA 1F05A 3QEZA 1TWZA 1E71M 1V93A 5I79A 4JICA 2FHFA 3JUGA 4HT3A 2D20A 1V8EA 4PCSA 4CN1A 2JFEX 3CLWA 1DE6A 2XH0A 1WPCA 3ITLA 3D46A 4D8OA 3DERA 3I6RA 2MNRA 2RHGA 1Q8AA 3G0SA 1X1IA 2Y62A 3CV2A 3NSNA 4ZTXA 5JBFA 1AJ2A 1Y5WA 1V6TA 1YQ2A 2RUSA 1KTCA 4GIEA 3MY9A 2DW6A 1YHTA 1KRMA 3P6LA 5F2GA 2C0AA 1N7PA 3GHTA 1O94A 4CD6A 3IEBA 5MHBA 4WDTA 3THQA 1J9YA 3D47A 1H4PA 2HJPA 4HK6A 4AZ6A 5EL1A 3UD6A 1QFEA 5FEPA 3GBDA 1JI2A 2PDXA 3PUOA 5E9AA 2CZ5A 4IFKB 3AMGA 4BWLA 4FXFA 3AHXA 3FDKA 4PODA 1PVNA 1X1JA 3QMSA 4LYKA 4GNKB 4M29A 3LERA 3ZM8A 3LHVA 3PB0A 4IMDA 5TIMA 4RDVA 5JBDA 5EMJA 3VD3A 3CWOX 4OJYA 1IV8A 1PAMA 3KW3A 1TO3A 2XYLA 4GO8A 4JTSA 1M3UA 2D73A 5BCAA 2NUYA 4Q4QA 4XV0A 3DOPA 3BLIA 1YTKA 3U48A 4PBFA 1XUZA 3W1TA 3BJSA 4KCTA 4M56A 4PEKA 4IL2A 4JY8A 1TKKA 4ZZ9A 1DL3A 3EWUA 1XHGA 5C9XA 2E24A 3W53A 5A6JA 1DXIA 4PTMA 2O55A 2ON3A 5BYWA 3R94A 1K7XA 1CDGA 3BLOA 4IGMA 4HPXA 1L0PA 2ZZ2A 2P53A 4J35A 3U5UA 3S1UA 5D38A 5JQ9A 1KGXA 3E2SA 4TVDA 3OGRA 4Q4KA 2BOFX 2IUZA 4P5UA 3KZSA 1RBOB 3W76A 3ZJ6A 2OTDA 1FHDA 4GBUA 3NZGA 4ZFMA 2VX7A 2GK1A 3VIHA 3BUVA 4URIA 4GC3A 1QW7A 3EZ4A 4K1GA 2AQWA 3CEPA 1UH4A 1FCBA 3R8GA 4XVDA 2QCCA 4G56A 1AQ0A 5U7SA 3NDOA 3WF3A 2GDQA 2OEMA 1SO4A 1YDYA 3VD4A 2C14A 1FQ0A 1ME8A 2ZBTA 3MCMA 4PRTA 3BQ5A 5C8BB 4QJ1A 2PD5A 3L4VA 1JCJA 3CT7A 4EPDC 2WCOA 1TV4A 2FZNA 3W7KA 1ISYA 2QPUA 5FEWA 1E6PA 1V6UA 1PHWA 1QNRA 3AMCA 1GKPA 2R1MA 2V5BA 3LHUA 2ZE0A 4C6IA 3L0GA 2BY1A 1ECEA 3MBDA 1KLYA 1ZP4A 7PTDA 1MEIA 1KB3A 4DLQA 3G1YA 5G1MA 3URAA 1YXYA 2VUYA 3ALFA 4OV4A 2DH2A 3A12A 3AZRA 5D2TA 3K4DA 1LXMA 2X09A 3UYCA 4XO6A 2QF8A 1E4LA 3QM3A 2VZTA 4CN4A 4G2DA 1JZ2A 5GJPA 2Y61A 1LBLA 2PAJA 1B1YA 1OX4A 1WDWA 2W6RA 4OT7A 2JKEA 4LYPA 2VM8A 4B5SA 3SUUA 2DGAA 1OBAA 5LNWA 1KA9F 4OVXA 2W0UA 3IVSA 1FXPA 2FDMA 2UWFA 5BRQA 1V51A 4C90A 3AI0A 3NZQA 4PL2A 3E5PA 5FJUA 2E77A 5BOEA 3PG8A 1JF6A 3NL6A 1HP5A 1VLWA 3E5BA 1IGSA 3VNYA 4NIRA 3CNYA 1QNVA 3M16A 5FEZA 2O92A 1UBSA 1G7UA 2G5WA 5AVNA 5FI8A 3T1GA 3ARYA 3SCOA 4W9TA 1VGAA 3G8RA 1QR7A 1DVJA 4S3FA 2ZX7A 2XVLA 2QDDA 1EZ2A 1EJXC 3W25A 2PDYA 3BLLA 1SQ7A 2GVGA 3QZAA 1GORA 1U1UA 4G1KA 4JDBA 1XLGA 3EKLA 3WNNA 4B3KA 1ITQA 1XKYA 4R3UA 5TAOA 4MOZA 2FMNA 1YNQA 1R6WA 1KKOA 1MDLA 2NWRA 4OV9A 1FWJC 4GUJA 2E9MA 5IDZA 4D1JA 1J0IA 4GKTA 4F40A 2GGGA 3EA1A 1T6MA 3QC0A 4S3JA 5A8GA 5LIUX 3CTTA 5CAHA 3EEGA 3MW7A 4J3WA 2PLMA 5C9RA 1JDEA 3NO5A 4WGXA 3WL0A 3PWAA 3G1FA 2UY3A 2J7CA 3SBFA 4W85A 3CH0A 4DLMA 3A5VA 3Q94A 1OVDA 5I3IA 1C92A 2G8ZA 2VFEA 1A0DA 3NPXA 3KBWA 3P93A 4DNHA 4IQDA 3N2BA 1YPIA 2X2GA 5DQPA 1SR0A 3DKLA 3FY1A 5IFPA 1OABA 3PTDA 1H5YA 1G0CA 5ABFB 3RLVA 4MY1A 1US2A 1ZJIA 3TWBA 4HOWA 4EXBA 4UMAA 3RNDA 3ONCA 3TN6A 1K9TA 2BSLA 4AVOA 2TSYA 2V8ZA 2OPJA 7TAAA 1M7JA 1YW1A 1V4YA 2QIWA 3PQIA 3R5EA 4F0HA 2CLMA 1VYRA 3AALA 2XVGA 1HW6A 2CKRA 4X60A 3B0UX 4W4QA 1P0KA 4CCCA 2YXXA 4QP0A 2ZXAA 4X9YA 1UHVA 1BXCA 4JQ2A 4BK9A 5CC7A 4KT2A 3WNPA 4HZMA 4IJBA 1UZHA 1I45A 5JVLA 5A5WA 1W3LA 4B91A 2FHCA 3SFWA 4XSLA 3VNJA 5FJTA 3TW6A 4C1NA 3F5KA 3GSMA 3VIMA 3AO0A 1XC6A 4ZFCA 2B0MA 1WE5A 4GO9A 2XGBA 3CS2A 1J79A 3VGHA 4OZOA 3JW7A 1TZZA 1KFWA 3WQVA 4QNWA 2C15A 4O10A 3TXZA 5HUOA 3BCFA 4KEVA 1J0JA 1IWAA 5H8UA 2WXDM 4I5RA 2G37A 4A8NA 1WAWA 4H9XA 3BOXA 3EEZA 3WQCA 1PS9A 4O1AA 2VFIA 5FAJA 4UTFA 3GH4A 3TP4A 4W8AA 3MA8A 2MUCA 3L4WA 3KCLA 1GWJA 4DZHA 1OGGA 1LJYA 3UCQA 3DXIA 2E3ZA 4TXEA 5CC5A 2WYSA 4UTUA 3VNDA 1P6WA 4HYVA 4ZODA 1X96A 4QG6A 1CW2A 2C79A 3LCWA 3B9DA 3ONBA 3EOSA 1EBHA 4CU6A 3TYBA 4WJ8A 3H2EA 5ABEA 2E4TA 3HG4A 4CLMA 2X2YA 2BRWA 3MUIA 4F0MA 3O6YX 3VGGA 1X1ZA 1M03A 2PDBA 2XVKA 3LD5A 2DUXA 3DFHA 5AYYA 1SFTA 4ZO7A 4GUIA 3GYEA 2YCLA 4O1CA 2EPHA 2CC0A 1OX5A 1OCQA 1NF0A 4GQBA 3LNPA 5CXPA 4J3VA 2XSBA 1PE1A 3UNTA 4B9YA 1OJXA 2O4MA 1IEIA 1K7FA 4HGXA 3R89A 4UFMA 4WVXA 4GXMA 3GDLA 2BASA 2BODX 3MTWA 4D6GA 2Z1KA 1RY0A 1NQKA 4H04A 1JFHA 5AZ0A 3BTNA 3CMGA 1OC7A 3VE7A 1FBAA 4O14A 1I8JA 3TVAA 4I3GA 1W5NA 4GKLA 5G2WA 2J9XA 4UR9A 3SUWA 1L2UA 4O1EA 4F0LA 1RBLA 2XFWA 1H60A 4BEUA 4LRTA 2UZ9A 3CHVA 1H09A 1DE5A 2YKKA 1GEHA 1NJJA 4GQ0A 4NF7A 4CNNA 4I6VA 3L68A 4ATWA 4ECLA 4DAIA 3B8WA 1L9WA 4Q6JA 2QCGA 3B3DA 4GCXA 1DJNA 1HN1A 1RZMA 5LA0A 1AFSA 4L1WA 2FTPA 4MSSA 4ZR8A 3ISIX 2V68A 2O9PA 3DUGA 5CZKA 4DWSB 3WLRA 4C1NB 4QLJA 3HPZA 2I1OA 1WKFA 3C61A 3WLIA 1VEPA 3TUUA 3NQBA 4B5UA 4TMBA 5KZEA 2EQDA 4F79A 1D8WA 2J78A 5DBTA 2WHMA 1JIBA 2Z24A 1IZJA 4BS0A 2FJUB 4XD4A 3V0UA 1I1XA 3NXLA 1GQNA 5ABTA 4LY4A 3UXIA 2QW5A 2OOFA 4GYPA 3L4XA 1E72M 3GHSA 1BYCA 4K7YA 1R7OA 2BY0A 4IPLA 1KGUA 1W5QA 1Y5VA 3K8KA 1PZ0A 2HVOA 2ZUVA 4H83A 4CUCA 4TUFA 1W6TA 4L1GA 4GNVA 3SY5A 4FX6M 4HPJA 1K7EA 1IT0A 3WNLA 4AIEA 2ZRUA 1I2QA 3R25A 2J27A 1E0XA 5CKSA 5C9WA 4UFJA 4YLWA 3RCNA 3TYAA 4IT1A 4HNVA 3M6DA 5JH2A 1E55A 3AWNA 1VQTA 7A3HA 3K46A 1EOMA 1TQJA 2V82A 1NM9A 3TYUA 5B7ZA 3I4EA 3CC1A 3ZFHA 5F2LA 1HF6A 1XYCA 1KGWA 1TPUA 4LH8A 1MXDA 2D2HA 4A35A 1M7PA 2F84A 3VUPA 3WL1A 3E02A 1EYWA 3VNZA 3NPWA 3OVPA 3PBUA 4D8AA 2J47A 1OJNA 1W9UA 2DUZA 3HA1A 4L4MA 1PYFA 1E5NA 4I7VA 1FWBC 4KWUA 3DENA 4H9UA 3VGBA 4LNCA 3OU8A 5H1WA 3HPXA 4R85A 3RM4A 3LGEA 1H7OA 3HTWA 4J4KA 2OZ8A 3H7RA 3Q37A 4ILSA 1OM0A 3ES7A 3MHGA 4CQCA 3LX9A 1K70A 2Y8UA 4IMCA 1JPMA 2OT0A 1V77A 1P7TB 3S42A 2OKOA 3OG3A 3SN1A 2PRLA 2PF8A 4XK2A 2DDXA 3DGBA 3RGTA 2ZRWA 2PWFA 1UUQA 1J11A 3GAKA 4L7ZA 3T44A 3IJQA 2UY4A 3WQ4A 2OQHA 1RHCA 1YNYA 5D30A 3FNDA 3KX6A 1BSLA 2QVNA 1BQGA 2BY2A 1GKRA 1Q2RA 4HYWA 5FF3A 2Q6ZA 4GYJA 4MFDA 1N7RA 5D37A 3UPWA 3W1NA 3OW1A 4KGLA 1K9DA 1TPB1 3EWBX 1BSIA 3Q65A 1A5CA 4D2JA 1FHLA 4M81A 4RV8A 3U2OA 5F1VA 3FGCB 5A3HA 1WO2A 4DJDC 2DZPA 3NYZA 1GTHA 1KV8A 4Y2WA 3G0XA 3IS4A 4HTBA 1QK0A 1ZB5A 1Q6RA 3MDWA 4WDUA 2XN2A 3MCOA 1L6FA 4FF7A 2WSQA 3F1QA 5DX7A 3TKFA 4ATDA 3P61A 4P8WA 4W84A 1HNYA 3E38A 3OHIA 3HIJA 3QZ6A 4ENLA 3WUGA 3W1XA 3IUHA 2OLHA 3KRSA 1OFPA 3OZPA 3KCJA 4IIGA 2PWUA 7CGTA 3TLLA 4LBUA 3VIKA 3N73A 2ALRA 3C2FA 2GQAA 2I9EA 1RV8A 5U4NA 1T7LA 3CASA 4LUTB 1OF8A 3PSWA 1VFTA 2C19A 3H21A 3MANA 4XAFA 1X7FA 3W88A 3B8IA 2EPMX 2X7WA 2YR1A 1F8IA 3Q45A 3I6EA 1XSJA 3G1SA 1LLOA 4OFCA 1WUFA 1OQFA 3ANYA 1VZWA 1V3KA 4DWSC 3W82A 3GXIA 3I65A 4RE0A 2RGMA 2WMIB 4Z1AA 4L9ZA 1V3LA 3THUA 5E09A 3ERPA 3NGJA 4MG4A 2NV1A 4FMVA 4NQ1A 4NNAA 4GOAA 4CKQA 4NJIA 3IWPA 2PWEA 3RPDA 3U9IA 2YBTA 3TOYA 1LRNA 1UKTA 1QVBA 4JN7A 1S39A 4CGTA 3UF9A 3CZJA 5CJ5A 1IR1A 3NO1A 3AZTA 1XC4A 1PDYA 5F7UA 3MWAA 3DI0A 3LTPA 1J10A 3OBEA 4JD4A 2HK1A 2WAGA 1GPFA 1DIOA 4LVAA 2ISSA 4IP4A 2YOCA 3T0CA 5LNSA 4Q8NA 3BOLA 3O2LA 1XQKA 2ZWZA 3M7WA 2I5IA 4E2BA 5G5IA 4K38A 3MJMA 3CL8A 1B3YA 4U5KA 1EGZA 1XLBA 2QDHA 4IIBA 3N17A 1SGJA 4JTIA 4WKAA 1Q85A 3ZWTA 2VRKA 3QXBA 5FKYA 3T0AA 3PZQA 2WLZA 2Z0IA 3IPWA 5KMYA 4ORMA 3NVDA 2HCVA 3CO8A 1VPQA 1TZ7A 1UB3A 4AQLA 1T0OA 4AUBA 4D9PA 3ZR6A 4GG9A 5CPSA 1QI3A 2NT1A 3I3DA 4B2DD 4ZENA 2PU1A 3WLHA 5LSMA 1AL7A 2Z00A 8TIMA 2NX9A 1EUAA 1X6UA 4JOMA 1V0NA 4LFYA 2VEFA 2G50A 3WK2A 2BGNE 4MTVA 1MYRA 3KOFA 4DJEC 1MRQA 4NX0A 5IHSA 2BVYA 2X8RA 4FXJA 4UQ9A 1UKPA 3A4AA 4FNQA 4UTJA 3WDPP 4RDYA 4FXRA 4YTQA 3QV6A 3H23A 1LUCB 5HMDA 2YDQA 5DEZA 1U22A 4H6QA 2ZVIA 3H70A 1GJUA 1HVXA 4HZ6A 5DXXA 1RLCL 1UD3A 3JVAA 3BW3A 2H90A 4AC7C 1N8FA 3U6WA 1G4TA 3N2XA 4V2XA 2WWDA 1EQCA 1QJWA 3CYVA 3BDKA 1WZKA 4R27A 3UJRA 4DPQA 3R1ZA 1JZ8A 2FVKA 3W74A 1VBRA 3GLCA 3OB8A 4GC4A 2ZC1A 1QBAA 1B3WA 3STPA 2X03A 3VIOA 2J8GA 2O4QA 3FVDA 3IGUA 1KXTA 1B2YA 5AYIA 2YW4A 4PZVA 2WZTA 3OTRA 1UD4A 3OQEA 4WOZA 2A3CA 1QRQA 4EE9A 1BG9A 3NQ8A 3VKJA 3QGKC 1P4CA 1W37A 2E7FA 5C7VA 3VD5A 3RFAA 4GK8A 2YYUA 3GQYA 1TYGA 1E5JA 4R88A 4XZNX 3RYSA 5AC5A 4ZA0A 3M5ZA 4UOJA 1XICA 3QTGA 1E9ZB 1S2TA 2EGZA 3CAKA 3HGRA 3M7SA 1QAPA 5LA1A 3NNTA 3L21A 2DJLA 2D0GA 5C55A 5KINA 5EU9A 4JZ5A 1L6SA 2HMCA 3AU6A 1UD5A 4A3UA 1XIJA 4N42A 3RX2A 4YU1A 3B9AA 3WF0A 4F0SA 3C8FA 2ZZ3A 2WNWA 1QNQA 2Z27A 4AVFA 2E6DA 3MVIA 2D0HA 2OT1A 3NQEA 1R9YA 3RRXA 3DBPA 4LVFA 4B2DA 4DWDA 1AQFA 3LYEA 3CL6A 1AMYA 1DHKA 1FP9A 2E67A 1YDNA 3RJYA 4QLKA 3UJ2A 1ZL1A 3F5JA 5DCDA 2QULA 3RN6A 3EX6A 2TYSA 3F59A 2WCAA 3BWWA 1GQKA 5A2CA 2ZXDA 2PBGA 3LSBA 3GU2A 3B8VA 4KWWA 2X42A 2VX5A 1VRAB 4L9XA 2PDWA 3OZYA 3U7VA 1ADSA 3T8QA 3V5CA 3TSBA 2J8TA 4AH7A 5DXYA 1V3MA 2VEIA 2OXNA 5EBAA 1SJCA 5E0KA 4DWSD 4GY1A 4KPLA 3HV8A 1RJRA 4JTQA 1W3JA 2ZADA 2WBGA 1YDOA 3CUFA 3XISA 4GISA 3MI2A 1NP2A 1DWIM 2PDPA 4ZSUA 3W2UA 5A6AA 3RJXA 1Z69A 1J8VA 3KM8A 3EX1A 3RU8X 3BMXA 3QFWA 4X61A 3CUZA 3BJFA 4LT9A 3UWYA 4Z1DA 1OCBA 4MB5A 5HMFA 1U1JA 3FW6A 4HCHA 1OGBA 3VDCA 1G1YA 4FOJA 2XZ9A 1UD2A 3WBWA 2QDGA 3ZS4A 3BZGA 1W2VA 1LCOA 1E1CB 3RHGA 4OOUA 3AUJA 4YTUA 3O1NA 2NSXA 4XD3A 2OGYA 4MB1A 1VFUA 2WNZA 1FWDC 3BG5A 1R5YA 1EJTC 1H41A 4KWOA 4UC5A 4H9YA 2V69A 3C0LA 4O4VA 3W01A 4UTWC 4BR1A 1R87A 4FNRA 3ZR4A 4PB5A 1FY6A 1LQ2A 2BB0A 2FTYA 4KQNA 4R9OA 4F8XA 1XLLA 4Z1CA 4MB3A 1GUVA 1QOXA 3CHFA 4N6EA 3WFLA 3WLMA 2W9MA 2YW3A 2I14A 3I4KA 1E3ZA 3U8GA 2XUCA 3RX3A 3A3XA 2I16A 3AUOA 4FNTA 1UWTA 1VBHA 1SU5A 1HX0A 1E6XM 3MYOA 1EXBA 1Q6CA 3ZLFA 4DXVA 1IWBA 4A3RA 3WH9A 1NOUA 3TWAA 1MI3A 1Z6KA 4XAZA 3SN4A 3BAYA 1JZ3A 2NLIA 4IJRA 3N2TA 1S2AA 2FVLA 3MMWA 2XM2A 2JEQA 4U2ZA 3LI0A 1H1YA 3FKKA 4JTKA 1KRBC 3EB2A 3BAKA 1XDLA 3RO8A 1LUCA 2W5FA 1GZJA 2XIIA 2NXGA 3UZ5A 1D8CA 2JK2A 3SQMA 2P0OA 3PZMA 5BMWA 6TAAA 4MLJA 4XD6A 4GJIA 2I9UA 2VRQA 1F73A 4A4AA 3ATZA 2G3JA 2XSAA 1EGMA 1VYPX 4PBGA 4DZAA 4X63A 2YL8A 5G2IA 3N4FA 3WG6A 3A4XA 1E3XA 4CQ8A 1QT1A 1LF1A 3ATYA 3RRAA 3LPPA 6XIMA 4U28A 4PYSA 3GHUA 2XHYA 1TV8A 5REQB 5TNVA 1IXPA 4NI3A 4JTDA 5FL0A 4PUJA 1Q4WA 3WD3A 2CPUA 3GC4A 1OX4B 4ZO8A 2EG6A 3M6YA 2ZXQA 5CGQA 4AF0A 5A6TC 3S2CA 2Z2BA 3CAWA 2B81A 2A85A 3VYLA 3AHVA 1BPLB 3ITGA 1LL6A 4C6KA 3MV11 3QW3A 4DUVA 1W1IE 3ZLGA 1JD7A 3B05A 1LG2A 2HXUA 5ABHA 5A69A 4YPJA 4Q33A 4XZLX 1JPKA 4MFEA 1W8GA 1EP3A 3KE0A 3PR2A 4X0VA 4GZJA 4AX7A 3FOKA 1XLAA 4XAPA 3A3WA 3N29A 4XO7A 3PZIA 3URQA 1DXEA 3FSTA 2VDIA 4IG2B 3M44A 3MHFA 2V81A 2ABBA 4YCPA 5D32A 2OYMA 2E25A 3H2AA 3ARVA 1ZCOA 2X30A 2YB4A 3W6MA 5CH9A 1V7AA 4HCLA 5D02A 5EYWA 4FP1A 4RPPA 1KFJA 2E9BA 3B4UA 3BE7A 1RP9A 4S3KA 5H2ZA 3I68A 3IJ7A 1HJWA 2XIOA 1MXGA 4DVOA 3VKCA 3IACA 2YA0A 1MW2A 1OSEA 2F8QA 5C2XA 3NO3A 4GY7A 2BHUA 4JGDA 2WHLA 4ACYA 2Z6JA 2PSNA 1VAHA 1W3TA 2PDNA 3G1DA 1AVAA 1JFXA 3GB6A 1KFEA