2WMGA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in complex with the lewisy pentasaccharide blood group antigen.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
555
structure length
553
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIANYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLKGHHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 199
structure length 553
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmgA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmgA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmgA02
3THCA 2DIEA 1AVAA 1C92A 4FLSA 2V3EA 7TAAA 1LOHA 1BYAA 1EHNA 3PZGA 3AIBA 4HOWA 1H49A 4DUVA 3EDEA 1JYXA 2RGMA 4C7FA 1JFXA 2XSBA 3VIMA 2WBGA 2YA2A 3NJ3A 1PBGA 3VM5A 1QHZA 4P7QA 1WAWA 5JIPA 2J25A 3MV01 3GH7A 1WP6A 5GNXA 3S2CA 1C82A 2JIWA 4JFTA 2WCSA 1OT2A 1V08A 1H3GA 1NWTA 1V02A 1XD1A 2EBNA 1BVZA 1IZJA 1XSJA 3MMUA 2DEPA 1UH2A 5I5RA 2YLLA 3RJYA 5IXEA 1HN0A 2Y8KA 3RDKA 3A4XA 3WDQA 2WZIA 1Z32X 2WMFA 4J3VA 2D22A 3K8MA 1OIMA 4KWUA 1JYNA 1CTNA 4EKJA 4BQ2A 1W9UA 3EMCA 1HJVA 2WSKA 3LPFA 1V03A 3RPMA 1JF5A 3W29A 1ISXA 2QMKA 2E0PA 1GVIA 1UA7A 1DWJM 1N7NA 1GQJA 2A3CA 2J7GA 3RM8A 2WMJA 4H8UA 4ACZB 1J9YA 3CIVA 1WZAA 2OYKA 2BNJA 2YL9A 2X05A 4W89A 4TTGA 4JKKA 3ZT7A 3CO4A 1OB0A 3I3DA 3UCQA 3CZLA 3WUEA 1DEDA 2Z1SA 4QDMA 2Y5EA 4AD3A 2ZX7A 1ITCA 4W8AA 1G5AA 2J7CA 2WYSA 3WL1A 1B3VA 1KWGA 3SEPA 5D8ZA 3AXXA 1ODUA 4AZHA 4ZXOA 1UD5A 2GJPA 4W93A 4D72A 4BCEA 1RWFA 3I3BA 4D1JA 3CUFA 3WD2A 3VIPA 5CLTA 4W8BA 1AQHA 2PWGA 3VGGA 1V3LA 2G3JA 1A3HA 1KBBA 3LPOA 5ABFA 4Y7EA 1M01A 2BRVX 3CHCA 3WIJA 3ARTA 4XX6A 4ZE5A 1NOUA 2G4FA 3WF0A 3N17A 1BYDA 1LL6A 1H09A 5A1AA 5E09A 2VO5A 4CU8A 4CGTA 2Q8XA 3WUBA 4OZOA 5BXPA 5I79A 1QBAA 3NYDA 2WHKA 1XCWA 2VL4A 5A6AA 2XWEA 3WH7A 2J7FA 1WKYA 2QPSA 4UTFA 3DYOA 3VGDA 3VNZA 1JAKA 3ZJ8A 1I1WA 2CBVA 4CN6A 1OIFA 1W9XA 3BAKA 4CD6A 3AZSA 4GINA 4TX6A 2D0GA 1E9LA 3PZIA 1UWSA 1CB8A 2DDXA 1JF6A 2W5FA 3RO8A 1GUVA 4A4AA 2E24A 2ZWYA 5HPCA 4AZIA 3POCA 3AHTA 4AEEA 1JDDA 2PB1A 2XSAA 1NH6A 4E2OA 2OSYA 3WY1A 1H11A 3M07A 1ZBKA 1NWRA 2G8ZA 2XVKA 2ZX6A 3M7SA 2J7DA 2J7HA 4UR9A 1QPKA 2BRWA 2BVDA 4JIEA 1UWUA 1PX4A 4PMOA 3ARXA 4AZ6A 2C0HA 1CGWA 3OLDA 3TTQA 3VILA 2DQXA 3ALGA 1KBKA 1HN1A 1V3HA 2QPUA 4A3YA 4F66A 3VPLA 5A95A 3FHAA 4TOQA 2EO7A 1W1TA 5DFAA 3ECQA 1JZ4A 1EDGA 2EPMX 2ESCA 3VMPA 3HN3A 1HX0A 2DPEA 1KXQA 1XHGA 1E15A 1W3HA 4R27A 1ISVA 5A6LA 1OD0A 4GQRA 1V6XA 1C8XA 2CITA 2CHNA 2YIHA 2NT0A 1GHRA 1PIFA 2CETA 1G9HA 5BRQA 4OIFA 2WC3A 4HP5A 3BAIA 1UH3A 4UNIA 2VI0A 2J47A 4P7NA 3DHPA 3EYPA 4P7RA 4JHOA 3O6AA 5I77A 1SR0A 4HTYA 4LQ1A 1C7TA 4P8XA 2EJ1A 2E9MA 3RCNA 5HPOA 2BY0A 2YA0A 3WD1A 3RILA 1RWCA 3CTTA 3N13A 2JEQA 4TX8A 1G1YA 2EQDA 1HP5A 4BF7A 3WQWA 4UQDA 1GNXA 3OZOA 4JCMA 3MSGA 3VUPA 1EOMA 2FH8A 3OLGA 1Q6CA 4RE3A 1NOWA 4HMEA 4NF7A 3WDHA 2VZVA 1GHSA 4W88A 3L4WA 4PRWA 1H41A 1HJQA 1LL4A 3PTKA 4D6IA 5AC4A 1JAEA 4AZCB 1IV8A 1RP8A 2VCCA 3WD4A 5CSYA 1G01A 4AISA 6TAAA 4JCLA 3WEZA 5E6YA 2J79A 2VNCA 1DWAM 4M80A 2HISA 3QHOA 1UD8A 1MW0A 1E70M 8A3HA 4AWEA 1J0JA 1ITXA 1N82A 2CKRA 2WW5A 5LA0A 1FHDA 4HOZA 2WANA 5A8NA 1W1PA 1JZ3A 4AXNA 2O9OA 4F9JA 4B15A 3KE0A 1HVQA 3PTMA 2AMGA 1OJPA 4WLCA 3D5HA 4D71A 3GH4A 3CBWA 1JZ5A 1LG2A 2E9BA 4WSJA 3WMBA 5CLWA 1V3MA 3ZT5A 2D3LA 1BG9A 3OA5A 1BG4A 2O9TA 1M53A 1CNVA 1OGSA 1R85A 1E5JA 2YDSA 1KQZA 3BC9A 1PAMA 2OYMA 1VF8A 1ZB5A 2X0YA 2PWEA 5FOOA 3O2LA 1ZBWA 3GNOA 4AIOA 2VZTA 3BLPX 4IUGA 3NDZA 3WQVA 3VGBA 4L4OA 1E6ZA 3AHYA 3CHFA 3KZSA 4XZWA 5I24A 2CNCA 5I78A 3VO0A 1E6XM 2QMJA 4FK9A 1VFUA 3THDA 4BZYA 1V3KA 3T2PA 4ACYA 4WF7A 3TA9A 3AMLA 3ZOAA 4DUWA 1E6QM 1WDRA 1ZL1A 1W91A 1MW2A 3VX1A 2XVNA 3K8LA 1W1VA 3LPPA 4MDOA 1W3YA 1S46A 4TUFA 2YDQA 1WB0A 4H7VA 5ABEA 3MUZ1 4W7WA 4P8UA 4S3KA 1FH9A 2J78A 1TVPA 3CUIA 4UQCA 4BA0A 5I0DA 1BYBA 1PX3A 3AIQA 1UR0A 2EPNA 1OJOA 1EA9C 1VBUA 4IPNB 4WIWA 3EMQA 4UOZA 3W0KA 4OUEA 4FF5A 3ARPA 3WEOA 3PHAA 4PMNA 3J7HA 4UOJA 3SCRA 5F7UA 3ZSTA 1OSEA 4UFIA 4AYSA 4B9YA 2UWFA 2OYLA 2FGLA 4AMCA 1V6VA 4AIUA 3RM9A 3ZJ7A 5CPSA 4UOQA 5A6MA 3LMYA 2PC8A 1W32A 1N7RA 1UG6A 5CZKA 1KGUA 1VJSA 1UR8A 1QHOA 4FLRA 5A6BD 2ZX5A 2VT0A 3W26A 4W87A 5M3WA 1L0PA 4CCCA 4PMVA 2PWDA 3EDKA 1J0NA 1US3A 2CCRA 5GNZA 5EFFA 3BMWA 4W84A 2V5CA 3WF4A 3ZR6A 1MVYA 1UOKA 4KMQA 1JGIA 3OBAA 3SUTA 1J0IA 3KEHA 4AD0A 1KR1A 3OGRA 4B16A 1HKKA 3ALFA 3W24A 4D1IA 2IUZA 4MB1A 3PZ9A 3CUJA 1TE1A 1V02E 3AXHA 4UQAA 4QCFA 2UY5A 1YQ2A 2WNWA 1F4HA 1WCGA 3WL0A 1W9BM 1E4NA 5CGTA 1U33A 2XIIA 2DH2A 4W7UA 1E71M 2W92A 1X6NA 4RE2A 3PZOA 1PPIA 3AJ7A 2HVMA 3ZSSA 4NRSA 4M81A 3ARZA 3IJ7A 2UY3A 1KXTA 3GNRA 3K4AA 1BAGA 3U5UA 3WD0A 1CDGA 2G41A 4IM4A 1XD0A 2WCAA 2ZUVA 3AMCA 3CZ8A 2NSXA 1G0CA 1CXLA 3B9AA 1QVBA 1JFHA 3WENA 3SUVA 3CMJA 2BHYA 2WMHA 4ATLA 3WNNA 2YKKA 1JG9A 2XFFA 4AZGA 4QLJA 2VCBA 3N12A 3SCNA 4Q22A 4QLKA 2JFEX 1W3KA 1UWTA 4YHEA 1ZJAA 1KCKA 4LGXA 4PMDA 1MQRA 2WWDA 3MU7A 2O92A 4JL2A 1JZ2A 1DP0A 1Q6EA 3SUSA 3IAQA 2PF0A 4JFVA 3BH4A 3FW6A 3ARQA 4CVUA 1ISZA 3L4UA 5AYBA 4HPGA 3MMWA 5JBFA 3WEMA 2CPUA 3MUY1 1E6PA 2WB5A 4QCEA 2VQUA 3L4YA 1TZ7A 4MADA 1UR1A 1H0GA 4NI3A 5KEZA 2J4GA 2V3DA 4LX4A 4W5ZA 1EO7A 3HMCA 5M03A 1EXPA 1QNSA 4D6GA 1RWGA 1CLVA 3DHUA 3AMDA 2CHOA 3WDRA 4P7LA 3BAYA 4GZJA 2CEQA 4D6JA 1NP0A 2QLYA 4UQEA 1N7OA 1TR1A 2WHJA 2WBKA 5CPTA 2GJXA 2WMIA 5BXSA 1TA3A 5E6ZA 1ESWA 2WAGA 2VX5A 3GXDA 4MAVA 2PI6A 2WHMA 3AS1A 2BRPA 2JF6A 4BS0A 4F79A 1E72M 1UKTA 3AS0A 4PMYA 4V28A 3VIOA 5ABFB 1W9VA 1WDPA 1WZKA 4H2CA 4DM1A 2VMFA 5TD4A 4U5KA 3D3AA 4UZUA 2GK1B 1HKIA 4GXPA 1AMYA 1LF1A 2ZWZA 1I75A 3CZKA 3IJ9A 5A6SA 2V3FA 1VENA 3U7VA 5D9PA 3PZVA 2OWWA 3GBEA 2J8GA 2DT1A 2CIPA 3UG5A 3N18A 3VD5A 3W25A 4DUXA 5FL0A 2ZUNA 4JHZA 2WMGA 2EXOA 1TCMA 4MJ2A 1HT6A 1D3CA 1MW1A 2WVVB 3WMSA 3CUHA 2VUYA 4R5EA 1QI3A 2D1ZA 4EK7A 1QHPA 1E6RA 2G3NA 2JF7A 1TG7A 3SCSA 1X1HA 2WWCA 1ZS2A 2D23A 4N42A 1JI1A 2WKLA 3VGFA 3UEQA 2AAAA 2JEPA 1DWIM 4JAWA 1CEOA 4UFMA 3PZTA 3OLEA 5E9AA 4QP0A 4JL1A 1M7XA 4UZSA 5IFTA 2X2YA 2XHYA 4H8HA 4FLQA 4ACZA 2YOCA 3AYSA 3KL5A 4UFJA 1ECEA 3ZR5A 4AZ7A 1E73M 1GOKA 5FCZA 1J0MA 1UUQA 2PWFA 2WPGA 5CGMA 3FHQA 5D9OA 2VJXA 2O9RA 1B9ZA 4W7VA 4B9ZA 1KFWA 5A6JA 1E40A 2E40A 1C91A 5I23A 4MDPA 1XYFA 1VFFA 2WMKA 4EAMA 5DT5A 2GFTA 1UH4A 4U2ZA 4KGJA 3W38A 2DSWA 4MNJA 1BTCA 2DIJA 3AXIA 4H41A 1OD8A 4PEEA 1K9EA 3DYMA 4U5IA 2XVLA 2ZUWA 3W82A 4A3HA 4NRRA 2X1IA 1I8QA 5GPRA 1EHAA 2XFYA 1Q4NX 5IDIA 1PZ2A 3K46A 4Z2KA 5BXRA 3GDBA 2NW0A 5HOSA 2BY1A 4J3SA 2VURA 2VRJA 2WZHA 3AICA 2XWDA 3DYPA 3GXFA 5GQBA 4MB4A 4MJ4A 1NOFA 5HXMA 1E0VA 1ISYA 2DT3A 1QI0A 1JD7A 3AS2A 2ZIDA 1LWHA 3GH5A 1H4PA 1JI2A 1E4IA 1R86A 5EMYA 1A47A 1C8QA 5DMYA 3AISA 4IISA 4U33A 4W8LA 1HMUA 4MNKA 2YBTA 4JKMA 1VFOA 2W63A 4PBGA 2W91A 3GM8A 5CPQA 2VCAA 1UQZA 1B90A 3KWXA 4J3WA 3L4XA 1KXVA 1CXFA 3OB8A 5C70A 5HBFA 1W3LA 5CG0A 2J62A 2BFGA 1XSKA 1QNQA 1JYWA 1OGBA 2WKGA 4KRTA 1M03A 1W2PA 3S6TA 4TTUA 1AQ0A 2CKSA 1MXDA 1CGTA 5HDRA 1WDQA 1E43A 1NM9A 3WQ4A 4CN1A 2VRQA 1CGVA 1FH7A 3CH9A 3ZQ9A 1SYTA 4AZ5A 2D0FA 2WLZA 1C93A 1CGUA 2VRKA 3UR7A 5I3DA 4N0RA 3QOMA 1QW9A 5JBDA 3MSDA 1QI5A 1UZ4A 1E6NA 1E5NA 5A8QA 3U7BA 1O7AA 4CU6A 2EPOA 5M5DA 3VD3A 4AD1A 2Z1KA 1WO2A 1F9GA 4M1RA 3TOPA 3ZIZA 1QI4A 3SCUA 4GZIA 2XJ7A 2E3ZA 3A47A 3WNLA 4WSKA 4YPJA 3CHDA 4GO9A 4FMVA 1CGXA 1LQ0A 2E8ZA 3F5JA 3W4RA 1X1NA 4PMQA 3L2MA 2Y2WA 4CKQA 1CXEA 4CCDA 1B3ZA 1UWQA 4WKAA 4H8VA 1L8NA 1JNEA 1VIWA 1FP9A 4XUYA 4JFWA 2GJRA 1TVNA 3BSGA 5JUVA 2BXZA 1HM3A 1V0NA 2IXVA 4B3KA 2MANA 3ZM8A 2FGZA 2CESA 1HF6A 4LPCA 1R7AA 1WZMA 4AIEA 4PMUA 1QNPA 1PJ9A 4CU7A 4BQ4A 3N04A 2C7FA 4X0NA 2ZUSA 1R87A 1BPLB 3MANA 1H0IA 1E3XA 2F61A 2E22A 3IAPA 1J0HA 4HA3A 2O9PA 3B9DA 3MUAA 3WQ5A 4Z2GA 3WNPA 3DECA 5C71A 1R8LA 3WNOA 5IHRA 1NWSA 1DWFM 1QW8A 5CXPA 4HU8A 2WK2A 1PX8A 2XGIA 2YL6A 1BFNA 1UD3A 1WE5A 3MMDA 3N11A 2BVTA 3WDIA 3AIVA 3EMZA 1G94A 4BQ3A 1W1YA 2GDVA 4CUCA 3W27A 5AY7A 2BY2A 4GIAA 3EDFA 2C8NA 3GYCA 4LYRA 3VDBA 4GI9A 3W81A 1QOXA 3WH9A 4JKLA 1RD6A 4AZCA 1KWKA 3VD9A 1B3XA 3A6OA 3QOKA 2XYLA 4DWSA 1E0WA 1WZLA 3AHZA 1NQ6A 4XZBA 4C7GA 1WNOA 2Y4SA 5DT7A 1GOIA 3NSNA 4M24A 1CYGA 4KRUA 1GOOA 3WMCA 3BMVA 8CGTA 4ATWA 4PSPA 1JZ8A 1NARA 1XH2A 3AHVA 5IHSA 4TVUA 3APGA 3BAWA 3T08A 4CN4A 4ZXLA 3MV11 3QHMA 3I3EA 1V3JA 1DHKA 5FL1A 4UFKA 1BVNP 2FDMA 3UG4A 1LWJA 3WELA 2A3BA 3OGVA 1UA3A 3ARSA 3AIRA 3GZAA 3N9KA 3F5LA 1WDSA 4E8DA 5EFDA 1X6LA 1B0IA 2ZXAA 1HJSA 3BCDA 1HJXA 2V38A 4OKDA 4OJYA 2BXYA 3UG3A 1K9DA 3OGSA 3AZTA 4GI8A 1J0ZA 1M04A 2CYGA 3FN9A 2OSXA 1RW9A 4HU0A 1W3JA 1GJUA 2BV9A 4HA1A 3RJXA 4H04A 5FD0A 1W9PA 2JE8A 1JXKA 3SURA 4QFUA 1W9DM 5HNNA 5A94A 4D6EA 3CMGA 3VIIA 3W6MA 3ARRA 2EPKX 2A3EA 2ZOXA 4J27A 2AOSA 3SUUA 4PMRA 2WM0A 1E4MM 2GSJA 1HMWA 4UFLA 3VGHA 1GONA 1SMDA 2ZE0A 3WQ6A 4PCTA 5E0CA 1OCQA 2XM2A 4J28A 4E8CA 2W67A 4K68A 3M6DA 4EANA 2OWXA 4M82A 3SCPA 2WXDM 2VC9A 3CZGA 4PMXA 4P7OA 4ZFMA 3VM7A 3WDPP 1B3YA 1N7QA 4Z2LA 1UD2A 3VX0A 1SFSA 3POHA 3OIHA 4JZ5A 4W85A 4HA4A 1KR0A 1QNOA 5JIWA 5FKYA 2D2OA 2QF8A 1P6WA 1EOKA 2W62A 3W28A 3VD7A 4ATDA 1VJZA 3ZT6A 3BLKA 4AD5A 4X9YA 4KH2A 2QV4A 1JD9A 1VBRA 6CGTA 1US2A 2UY2A 1JZ6A 4TVDA 1PIGA 3NSMA 3AIEA 3A3HA 1PZ3A 4L4PA 5DF0A 1FFQA 3MS8A 2ZUTA 3MO4A 2VR5A 3M46A 1BHGA 2G3IA 3NSXA 2E8YA 5IFPA 1O6IA 2D20A 2UY4A 2GJXB 3N15A 2YDRA 2WMIB 1UKOA 3AHXA 1TA3B 5CJ5A 5A6KA 4URIA 5D9MA 3VTRA 4PTWA 2PBOA 1HVXA 1V3IA 1HL9A 2WSPA 3WFZA 1UD4A 1YHTA 4GKLA 4JFSA 3U5YA 1RH9A 1H2JA 1TMQA 1XSIA 1VEMA 3JUGA 4AD4A 2NT1A 2J8FA 2JALA 1E0XA 2YBUA 1UKSA 5BWFA 2XUCA 3WF3A 1OGGA 1LLOA 3AI0A 2J7BA 1BYCA 4ZEPA 3UESA 2J74A 2DSZA 1ZBVA 3VOCA 3L4TA 2YL5A 1VEPA 5CSUA 4PMZA 5A8PA 1XH1A 4PSRA 3AOFA 2F2HA 5C8BB 3WBAA 4PYSA 2BHUA 3EDJA 3WSUA 3WUFA 1CENA 3CZJA 1MQQA 4LYPA 1JXJA 1JDAA 1QNRA 4IPLA 1HM2A 3TP4A 3E1F1 1GOMA 3SCWA 1FHLA 5A8OA 1VAHA 1FP8A 3VDCA 1E1EA 1QI2A 3II1A 1ZJBA 2CBIA 1Q6FA 1CIUA 2DSKA 1FH8A 2WVSA 2YJQA 1B31A 2D0HA 5KZ6A 1J10A 3T0BA 3U57A 1V6YA 1LXKA 1UD6A 2J7EA 1VRXA 1HJWA 2W66A 5LA2A 5I2UA 1ZBCA 3AQUA 1UR2A 3GNPA 3AMKA 1GJWA 3FY1A 4HZ6A 3WNKA 1AQMA 5BROA 2RGLA 2W61A 1PEZA 3SCVA 3CZEA 4CCEA 2X0HA 1MYRA 5BYWA 4CVWA 5GNYA 4J3XA 2QHAA 4CD7A 3A4WA 4Z2HA 1RWHA 2EEXA 2WHLA 3L4ZA 3QHNA 1NWUA 3MUIA 1U30A 4U3CA 3AROA 1BSIA 5D4YA 2X09A 4AC1X 1VEOA 2ZUMA 2GUYA 2GK1A 3B8SA 1B2YA 3ZJ6A 2ZXQA 1V0MA 3FXYA 4BQ5A 4F9DA 3IK2A 3ZO9A 1J11A 1D2KA 5A69A 5AYIA 1HXJA 1E6SM 2PWHA 4OOZA 3LPGA 1BLIA 3FAWA 2J77A 2DT2A 2WVUA 4P8VA 3PZQA 4LXFA 5DO8A 4OOUA 3OG2A 3VIHA 2D24A 5A8MA 7CGTA 1ZU8A 1JZ7A 4UFHA 4WJXA 1KB3A 3VMNA 2PBGA 1QBBA 4U31A 2WVVA 3IJ8A 3WKZA 3G6MA 4MPKA 1XH0A 5DEZA 3EBVA 1BGGA 4NZCA 2JIEA 4MNLA 1U2YA 1MFVA 1OM0A 3PBGA 5LA1A 3UETA 2VZOA 4M56A 3WNMA 1JDCA 1SMAA 2VOTA 2E9LA 3WF2A 3W53A 3MKKA 2XG9A 1EGUA 4Q7NA 1OJMA 4V2XA 4HOXA 3SIMA 3PZNA 1IT0A 1XRVA 4HZ8A 2X8RA 1CZ1A 1HNYA 2WC4A 5ABHA 3WFLA 3AS3A 4F8XA 3BGAA 4J3UA 2F8QA 2VX4A 2BY3A 4AEFA 4QLLA 3WH5A 2FHFA 1OINA 1Y7VA 2ZUUA 2WC7A 1F4AA 2ZICA 1GVYA 1EDQA 3VD4A 1B1YA 3K1DA 1J0YA 4MAZA 1GZJA 2DGAA 1MWOA 1X1IA 1UKQA 1CECA 3GXIA 1OWQA 1F1SA 2FH6A 3VKKA 3T2QA 4J7RA 3N1AA 4RL3A 4XB3A 3FNDA 1C7SA 2IXUA 4M29A 4MNMA 2VVNA 3VU2A 2YLAA 1HKMA 4FLOA 1MW3A 3T2OA 4GI6A 2DSUA 2GDUA 4UQBA 1GW1A 3K8KA 3QGVA 1HP4A 4ZENA 3CLWA 2ZX8A 4D6CA 4TXEA 1MFUA 4U2YA 1MQPA 4WK9A 1NP2A 3BXWA 1UWIA 2FHCA 2W4XA 2OWCA 1EQCA 3NUKA 1WPCA 1RP9A 4AW7A 3KL3A 1HIZA 1ISWA 3VGEA 3ZJKA 1CXKA 3T0AA 2VZSA 1JYVA 5BCAA 2V5DA 3VNYA 4PCSA 4W86A 1UQYA 1Q6DA 1LJYA 3ZMRA 3CHEA 4PTVA 1EDTA 3PN8A 1DWHM 4GZEA 2XVPA 5D8WA 2CERA 1BQCA 2WZEA 3PTQA 1CXHA 4S3JA 1V6WA 5CQ1A 2BHZA 4W5UA 4UCFA 1HJUA 4XV0A 3KL0A 1OJNA 1VFMA 3ARWA 4X0VA 1J01A 5D9NA 1V0KA 3BCFA 3O9NA 2A3AA 3BAXA 2XM1A 1HL8A 4OBRA 1FOBA 4RE4A 2VZUA 1KQYA 5ABGA 1FA2A 3TTSA 3VIJA 5LYRA 2CBJA 2WLYA 3VMOA 3VVGA 1JIBA 4MB3A 2VR4A 3HJEA 2Q1FA 3BAJA 4DWSB 1CXIA 3NDYA 3SCQA 2ZXBA 1BF2A 4NSBA 3RIKA 3AIUA 1JL8A 1LL7A 4GO8A 1X1JA 4UQ9A 3AYRA 1IZKA 3ARUA 4D6HA 3ARYA 1K9TA 4CD8A 3WF1A 5EB8A 1XC6A 2WDAA 2ZX9A 3QR3A 3WH8A 1B3WA 3L4VA 2A3HA 1V0LA 4AD2A 2WCOA 1E4LA 1H5VA 3WDJA 1RWAA 3W6LA 4U3AA 3CUGA 2XGBA 5A2CA 1E3ZA 1UHVA 3B9EA 5A6BA 3T09A 1CWYA 1XCXA 2B31A 3F5KA 5ECUA 3TONA 3WUGA 2Y8VA 4AY1A 3FAXA 3VDAA 1W2VA 1GPFA 2XVGA 3A4AA 2TAAA 3AIWA 5JBEA 4EE9A 3NCOA 2DH3A 1MXGA 1BGAA 3VDHA 3WH6A 4CD5A 1E56A 3OZPA 3G6LA 4PTMA 3SCTA 4AZBA 5E70A 2OSWA 1I1XA 2WCGA 2BVYA 4GPNA 1H1NA 1XGZA 3UERA 4ZE4A 5A3HA 3VINA 3OLIA 3AMGA 3GTNA 1GORA 1GCYA 2VX7A 1DTUA 5BXTA 1JNDA 2CXGA 3WQ8A 1KGWA 1VB9A 3PZMA 2ZXDA 5M17A 2XPKA 3BSHA 1LXMA 3W37A 3WD3A 1LG1A 1J12A 1V6UA 1B30A 1ODZA 2XFRA 7A3HA 1UR4A 2EPLX 4WKHA 1E1FA 4HZ7A 2DT0A 1J0KA 1CPUA 4PUEA 1C3FA 1OT1A 4Z2IA 2E4TA 4J3TA 3WN6A 1GQKA 3L2LA 4C7DA 9CGTA 2BS9A 4KGLA 4PN2A 1UWRA 2WVTA 1CLXA 1EIBA 1UR9A 4V27A 3VIGA 2Y24A 2V3GA 4E4PA 1K9FA 4MTVA 1RPKA 3EDDA 4PUDA 3PZUA 3TTYA 2X03A 2VVSA 4TVCA 1C8YA 3ARVA 4WKFA 1KCLA 4JFUA 1UKPA 1HKJA 4MB5A 3RM4A 1K6AA 4DWSD 3VIKA 2XIBA 1GOQA 5I6SA 1GOWA 2J75A 3RMEA 3GBDA 3CPUA 5EBAA 5E0FA 1D7FA 3DC0A 4CD4A 3TTOA 2XTKA 4HPHA 4ML4A 3AFBA 4HMDA 1EGZA 3F4VA 1C90A 2VTFA 4HMCA 3K4DA 4D6FA 4DM2A 4YN5A 1OBAA 1Q6GA 4PTXA 2YL8A 1XV8A 1XYZA 1J18A 6A3HA 1UZ1A 1E55A 2OLHA 3GXMA 5A2BA 4P8WA 4LYQA 2VX6A 3HU7A 2FHBA 4Z2JA 1CBGA 1TUXA 4M8UA 3AZRA 2VQTA 4QAWA 4B3LA 4GQQA 2CBUA 2D3NA 1R7OA 1N7PA 4OBSA 3T0DA 1EH9A 3NIYA 3IANA 1GQIA 4YHGA 3WBEA 1EQPA 5BRPA 5AC5A 4D6DA 1TFVA 2YA1A 1DWGM 2GVYA 3VIFA 2G3MA 1GQLA 2DSVA 3SCOA 3UR8A 1KGXA 5FIPA 1CGYA 1FFRA 4DWSC 3CGTA 3SUWA 1KXHA 5A2AA 1EO5A 1UYQA
chains in the Genus database with same CATH superfamily
3TTEA 1LOHA 1BYAA 4PTDA 2C18A 4GVIA 1BKSA 4HOWA 4C6JA 1NSJA 5I02A 2WBGA 3NEHA 5B80A 1PBGA 4GRSA 1VRDA 3VM5A 3B4YA 4P7QA 1ONRA 7TIMA 1RK5A 1A0DA 3MV01 3ZZ1A 3GH7A 1WP6A 2PDGA 1IXPA 2JIWA 4JFTA 3ZVHA 3NM3A 2EBNA 1BVZA 1CW2A 5BU9A 2ZDSA 4KESA 5I5RA 4ZQNA 1X8FA 3ABSA 3UA3A 4Z1AA 3PJXA 3P2VA 4J3VA 3H70A 1OIMA 1PCWA 4EKJA 4BQ2A 2YFOA 5EY5A 3V36A 1S3TC 3WX7A 4XWUA 3TROA 3LPFA 3B04A 3RPMA 2E5CA 4CQ9A 3W29A 2DIKA 2PCEA 5K9CA 1UA7A 4DBEA 2ZA3A 1DWJM 3DFTA 2WSRA 3IRDA 4HK7A 4LAMA 1YTDA 5EA9A 1AZ1A 1J9YA 3ITXA 4H3DA 2YL9A 4X2RA 4FXRA 3VOIA 1K3UA 4W89A 2JKPA 4GJJA 4JKKA 3E2SA 3KW3A 1EA0A 5TIMA 2GZXA 3URBA 3TNOA 3QN3A 4NL1A 3CO4A 3KCJA 1OB0A 3M16A 3NPVA 3WUEA 2BWGA 4AD3A 1ITCA 4W8AA 3MP3A 2BLEA 2J7CA 3S42A 1B3VA 4HCLA 4DX3A 5D8ZA 1DKWA 4AZHA 4ZXOA 3TYUA 4B5WA 5BW6A 3EXTA 1PTDA 3M9YA 2HNEA 3KVMA 3WD2A 1EF3A 4NAEB 1XBYA 2PWGA 1FWIC 1V3LA 2G3JA 3GWQA 2FMOA 1ZY9A 1WDDA 4Y7EA 2C1HA 3KDNA 3CHCA 4HTBA 4N02A 3ARTA 3WIJA 4JTLA 3SIZA 4ZE5A 1NOUA 2OJPA 4DAFA 4QTGA 4J4KA 3IGUA 2B81A 3V1HA 2VO5A 4JD4A 1T96A 4FNSA 3UZ5A 1BXBA 3E74A 1SW0A 3L65A 3KTXA 3KXQA 1XCWA 5I3IA 2VL4A 2XWEA 4AQLA 2GPTA 2J7FA 1P0EA 3VKJA 5BRBA 3UD6A 4I7VA 5C0QA 1OIFA 3BAKA 3EWBX 3C56A 3ITOA 3ID7A 3W2KA 3B06A 5IBXC 1UWSA 2CWNA 3F1QA 2DDXA 3BE7A 1AJ0A 2J9XA 1QPRA 3CWNA 3AHTA 3UJRA 2PB1A 4S23A 3GNNA 2OSYA 2OO0A 4GIYA 3S47A 1W1B1 3M07A 3PM6A 3WY1A 3GR7A 5CEWA 4A6GA 5TNVA 3GG8A 2NQ9A 4NJJA 2OXNA 4QITA 3ATZA 1A5OC 4H6RA 4MWAB 3U2OA 1DJWA 1CGWA 1B54A 3ALGA 4JIQA 1KBKA 1HN1A 1V3HA 4E3VA 4I5XA 4A3YA 3R12A 1F73A 4F66A 3Q58A 4R53A 4C65A 1W1TA 2PFHA 5DFAA 1FRBA 3KRZA 6XIMA 3ECQA 3LLFA 1JZ4A 3T4WA 1EDGA 4AU0A 2ESCA 1H7PA 1XIBA 3FA3A 3NQVA 1XHGA 5HMEA 1OF6A 4JDBA 3IK4A 1TIMA 3MI6A 4IZGA 2CITA 2CHNA 1B4KA 2NT0A 3T42A 1PIFA 2REQA 2ZYFA 3KBNA 1JCXA 3OBKA 4CNUA 4OIFA 2HRWA 2X0SA 4JTHA 1XBZA 1W8GA 1GG1A 3W3OA 4P7NA 3DHPA 1FWFC 3ZXWA 3EYPA 4IMDA 3S1UA 3T44A 3EPNA 4L1XA 4LQ1A 4GABA 3TC7A 3RILA 1P0DA 1TJRA 1HP5A 2VGGA 4MKNA 4G7EA 4NXSA 3NQ2A 1GNXA 4JCMA 1P0BA 2NQ5A 2YW3A 5EPDA 4PR4A 1DQXA 4IP7A 4O19A 3VKAA 4NJGA 1NOWA 4HMEA 2I1OA 5G2WA 1YLVA 2E67A 2QDHA 2H9AA 4L56A 1LL4A 4NILA 3G1VA 3LV5A 1JAEA 4UTTC 4C6BA 1IV8A 2RDUA 3R4IA 3O63A 3V1PA 4K39A 3WEZA 2PDXA 3TCSA 3QKZA 2HISA 4MY1A 1UPMB 3RAOA 2HTMA 5FJRA 4A22A 1N82A 2CKRA 3C3NA 1VBGA 1ONXA 3U4AA 2HWGA 2WANA 5A8NA 1M3UA 4B15A 4MWAD 1P43A 2AMGA 1OJPA 3D5HA 3GH4A 1JZ5A 5CLWA 1LT7A 1TWIA 5LNSA 3NFUA 3A12A 3NR0A 3T1GA 3E5BA 4H19A 3ERPA 3FXGA 4MSSA 2VEGA 1M53A 1TV7A 1UR3M 4XO6A 3IV3A 3ENLA 4XD3A 2OEMA 2YDSA 3W7EA 2X0YA 2PWEA 5E9XA 5FOOA 3O2LA 1ZBWA 4IUGA 4ZB2A 3RCMA 2CLFA 1TRIA 1JVNA 3RITA 3AHYA 3CHFA 4XZWA 5I24A 1DJXA 1IEIA 2NLIA 5I78A 1E6XM 2EKCA 4L6HA 4BI6A 2NV1A 4GA8A 3BV4A 4A8RA 3BO9A 4DUWA 1PDYA 3CUXA 4TQTA 1ZL1A 3VX1A 2QS8A 2XVNA 4JN6A 3P5YA 2YDQA 1WB0A 2NVDA 4H7VA 2Z1BA 1DIKA 4BA0A 2GVJA 1VC4A 1JPHA 4YIWA 4C1LA 1EA9C 3FFSA 1VBUA 1ENUA 1L6SA 1YPIA 2O7SA 2CZ5A 3W7CA 4WR3A 4S39A 2QCEA 7XIMA 2ZADA 3J7HA 4UOJA 4Y9MA 4RZBA 3WK1A 3I65A 2UWFA 2OYLA 3GR8A 2F2KA 5A6MA 3LMYA 2PC8A 2P76A 1S39A 4DXVA 2BTMA 4QDWA 5FJIA 1UR8A 1JCLA 3V18A 3UT0A 1QHOA 1W5QA 4B4FA 1L0PA 3UCCA 3V75A 4CCCA 3B8VA 5GNZA 3OW1A 1W54A 4W84A 1E9IA 2V5CA 3WF4A 4JICA 1UOKA 2IPJA 3SUTA 1KRCC 3E0WA 1F3EA 2NZLA 3GUWA 1Q2SA 1AD1A 5LGXA 4IG2B 1KR1A 3E3HA 4KFOA 2PEVA 3OGRA 1D7KA 1EKOA 1EWDA 4S3CA 4DY1A 4AHQA 1Y0EA 2R8WA 1V02E 3T4CA 4WJEA 3H21A 1RCOB 2UY5A 3A3XA 1WCGA 3QYQA 3QPZA 5CGTA 1E4NA 1SZEA 4Y9AA 2XIIA 2DH2A 3NQAA 2KX9A 3H4WA 3REQA 3N34A 3WLPA 5I00A 3VCNA 1JPMA 3PZOA 3AJ7A 3TX9A 3ZSSA 1Z42A 4HCHA 1CB7B 3VABA 3ZVHB 1KXTA 5LHEA 3U5UA 3WD0A 5DLCA 4BEUA 4ASTA 3GDMA 2DW7A 1MXSA 4NQ1A 1G0CA 3M0MA 1CXLA 1JFHA 2QCNA 3SUVA 3W7RA 3CMJA 3QGKC 5K9DA 1JUEA 3VAVA 2ZRUA 2XZ9A 1KCKA 4PMDA 4RNFA 2O92A 3SUSA 3NGFA 1OYCA 4HU3A 3R8HA 1XYLA 4XSMA 4JFVA 1Q85A 3BH4A 4A8NA 5AYBA 4HPGA 3MMWA 3GX9A 3G8EA 3WEMA 2CPUA 3RFAA 2QYGA 5EBUA 2WB5A 1BRLA 2VQUA 3GTHA 5KITA 4NI3A 4MHBA 1EO7A 1Q6LA 1EXPA 1QNSA 4QR6A 1KA9F 3BW4A 1EYWA 1LBMA 1J96A 1XCFA 1GVSA 4KWOA 3UP8A 4IUOA 2R1PA 2CEQA 3S4TA 3G0UA 4A3UA 1TR1A 1LUCA 2WBKA 3W1PA 4EPDC 1EJ7L 1ZNNA 4AX7A 2YZRA 2NQZA 4X61A 3EWXA 2WAGA 3F2DA 2OEKA 1M6JA 2BRPA 2JF6A 3GIPA 3PFRA 3AS0A 2ABBA 3PBWA 3VIOA 1TUFA 1WZKA 4H2CA 5H8MA 3BSMA 4WOZA 5TD4A 4CNOA 3D3AA 3KVLA 3S8HA 4GXMA 4PC8A 2IQ0A 1ME7A 1NFPA 1KRBC 4DI9A 2X42A 3CZKA 1LZOA 4KFPA 3DI1A 1VENA 4NUWA 3UG5A 3AAMA 3W74A 4IJBA 1S1RA 4UTWA 1J79A 3VA8A 3ORWA 3GNXA 1QI3A 1QK0A 1X1HA 2PC4A 1T40A 3NQBA 4JGDA 2A7NA 3RRAA 1IXNA 4JN7A 3UEQA 3VGFA 3NPXA 4BHYA 1RR2A 4UFMA 4DO5A 3T0CA 4GY1A 1M7XA 3PAJA 5IFTA 4H8HA 4ACZA 3IJIA 4UFJA 1E73M 1J0MA 2VJXA 4W7VA 1XG4A 1KFWA 3IIVA 5A6JA 1O4UA 2E40A 5I23A 1XYFA 1H60A 1TPWA 1PCKA 4U2ZA 4N4PA 4EX4A 3R8RA 1JCYA 2QJIA 3E02A 4I7WA 3B40A 3DFPA 4S3DA 3KOZA 3AXIA 1BEUA 3TJLA 4HT3A 2ZUWA 3I4EA 3SAZA 4A8LA 3KS5A 4NRRA 2P1FA 3THAA 1LRNA 1EHAA 1IGWA 2XFYA 5EMMA 2D69A 4R88A 2X1UA 4Z2KA 5FI8A 5DCEA 5HOSA 5TBOA 3C4UA 1H1YA 3N2TA 4C90A 3A64A 4LUIA 3LHUA 1NDVA 3TSDA 3GXFA 5GQBA 5HXMA 2AQVA 3WYZA 3C2OA 4OTKA 3N9SA 1GT8A 4WEVX 3AS2A 5G1MA 4AX6A 3GH5A 4XBKA 2GLKA 5FJOA 1E4IA 4A21A 3QMRA 5AHEA 5DMYA 4IISA 4U33A 4W8LA 1HMUA 2VR2A 1HKWA 4F0LA 3LEPA 9XIAA 4LBSA 1W1A1 1B90A 2PTYA 3KWXA 1T7LA 4FX8A 1KXVA 3HF3A 4NU7A 4G7EB 2BFGA 1M7PA 4YVXA 4AB4A 2Y7GA 1EJVC 1W2PA 3C8NA 3R0DA 1AQ0A 2FJKA 2XFWA 3S5NA 5HDRA 1WDQA 2NX1A 5BNKA 1EB3A 4TR9A 3LA4A 4CN1A 5CPLA 2FZNA 3FKRA 3CH9A 2H9AB 2VOMA 4PUNA 2VRKA 5AHNA 3JRKA 5I3DA 1HL2A 1O94A 5G2HA 5CPNA 3B0VC 5JBDA 3R43A 1MMFA 4EWND 1TMHA 1E6NA 1E5NA 4R9XA 1O7AA 2EPOA 4MJZA 4RNHA 3O3RA 3TN3A 5M5DA 3B0PA 5DMLA 1HTIA 5E1QA 4PZVA 1F9GA 4M1RA 1M9HA 1SJDA 3CWOX 1QI4A 2OEJA 4MVAA 4GZIA 3STPA 3D6NA 2XJ7A 3M0VA 3G18A 3GAKA 3GFZA 4WSKA 2NV9A 3CHDA 3KLKA 4IQJA 3P67A 4WY0A 2QDEA 4LJ3A 3LY0A 4G6CA 1B57A 1B3ZA 2Q02A 4WKAA 4UMAA 1L8NA 4XZIA 4XUYA 3K4WA 5HQMA 3LK6A 2BXZA 1HM3A 3F03K 3U48A 2ATSA 1V0NA 2IXVA 2G5WA 2W27A 2VFFA 3ZM8A 2QKFA 2Y1HA 4RLIA 2CLMA 1I2OA 4I90A 5KZMA 1OJXA 4CU7A 4X0NA 3PNZA 1H0IA 3EX3A 4PUJA 3W2JA 4C6DA 1U1UA 2E22A 4HA3A 2C19A 2O9PA 3B9DA 3WQ5A 4AVFA 1TTIA 3NG3A 1DJIA 1R8LA 5IHRA 1NWSA 5CSSA 4JNMA 3H6OA 3OODA 3W1QA 2WK2A 2XGIA 1WE5A 1SFJA 1VCFA 3IRSA 3RX4A 3UZZA 1YX1A 3TK7A 1TRDA 2GDVA 2ZFAA 3LCGA 2FTYA 3GK0A 3W72A 2QCFA 4JKLA 1RD6A 2PGRA 4PB3A 1H62A 3K5XA 3VCRA 3NNTA 4K6AA 1TE6A 3T8QA 3S5YA 5LIUX 4XZBA 3DC8A 2Y4SA 4KCUA 3V5CA 4QJ1A 4UMBA 1GOIA 1IF2A 2AL2A 4O18A 4DRSA 4KRUA 1A80A 1A5CA 3WMCA 3BMVA 2ISDA 3ES7A 1KBLA 2YB1A 4PBFA 4TVUA 3N2BA 3BAWA 1XKJA 4CN4A 4EXBA 3MBDA 4WHBA 3UWUA 3DGBA 5IDZA 3W85A 2OZTA 2FDMA 2Q09A 1TX2A 4H2HA 1ZENA 3D47A 4LAOA 4AAJA 4GNJA 3AIRA 3PS7A 3UPMA 3GU1A 5TAOA 1R2TA 1JCNA 5FAGA 2ON3A 1HJXA 1XUUA 2OKOA 4JS3A 3EKGA 3FJLA 4GLEA 3UG3A 3KP1A 1X1ZA 3OGSA 4GI8A 3DG3A 2GDQA 4XZ9A 2E09A 3REQB 1RW9A 5HR6A 1W3JA 3M5XA 3W1NA 2BV9A 2OQYA 1VPXA 1KD0A 2CLHA 2JE8A 3V5FA 1JXKA 3HURA 3UXDA 3HMJG 3CAWA 4QRNA 1Q4WA 3W6MA 4J27A 4L5ZA 2EPKX 2V82A 3T55A 4MY9A 4O1EA 2CLEA 3H24A 4I8YA 4Z08A 4LCSA 4S3BA 3LS9A 4LB3A 5F4XA 2FZMA 2I14A 2IKGA 3JW7A 3LCFA 1W56A 4M82A 3HG4A 3AALA 2WXDM 3GZ3A 1PIIA 1TTJA 1VJIA 4KRZA 2YZ5A 4AEOA 4Z2LA 4RNJA 3QVQA 3GDLA 2V5KA 3OIHA 4JZ5A 1J5SA 5JIWA 5FKYA 2D2OA 2QF8A 1P6WA 2W62A 3BOFA 3MZ2A 5CKSA 3W28A 3VD7A 4WXYA 1ZP4A 2PD5A 4ATDA 2OKTA 3BLKA 1WQ5A 1GZGA 4AD5A 3EWCA 4X9YA 1G4PA 3FSTA 4GHRA 3W7GA 1I4NA 1IT8A 4WDUA 2QUTA 3LHYA 3CIWA 3HB9A 3N4EA 5DF0A 2ZZ2A 5I7GA 6XIAA 2TMDA 4XAFA 2PDMA 3C6CA 1DJZA 3W1RA 1SSGA 3GG7A 5IFPA 2D20A 1R6WA 1LUCB 2YDRA 3ITCA 1OFQA 1DHPA 5CJ5A 2G0WA 3DH7A 1XFBA 3TWBA 4URIA 5D9MA 3VTRA 4RDZA 1IWAA 2CHRA 1YDYA 2C15A 1MZRA 3CB8A 2YCEA 3UR5A 1A5KC 2J6VA 2VENA 3GD6A 1M7OA 3UGVA 3PQIA 1H2JA 4FO4A 3W71A 2NT1A 2WSQA 5IBXA 2JALA 1F8MA 2IMRA 3NQ7A 4AUBA 2VYOA 3HJZA 3OG3A 5KSWA 1LLOA 4BI5A 2VFGA 2J7BA 2V9DA 2VFEA 4H7ZA 4ZEPA 3UESA 1TTQA 3W9ZA 1OG6A 3PBMA 3L4TA 4OU1A 4LAZA 5A8PA 1XRFA 2YBVA 1DQWA 3W6YA 2FPYA 4LANA 4DO7A 5C8BB 1SJBA 4PYSA 3QY7A 3WUFA 1FWAC 1MQQA 4M0XA 2OG9A 4JTIA 4OVXA 1K4HA 3SECA 1H7RA 1CIUA 2DSKA 2WVSA 4Q4SA 2P53A 3W70A 1VYSX 4LB4A 3L0GA 3U57A 3WLNA 1LXKA 2ODOA 4FXJA 2W79A 3LBOA 4ADSA 2J7EA 3W1XA 1RA0A 3CEUA 5I2UA 3R0UA 3B8UA 1ZBCA 1PUDA 4X63A 5FA5A 3M5ZA 3EOUA 2ZKMX 3CZEA 4CLMA 1MYRA 1WX0A 4QAIA 3FGCA 1HO4A 2QHAA 4G2DA 4UTJA 1PKMA 2EEXA 4LUTA 2PDPA 1JR1A 3O05A 3QC3A 2X7WA 3MUIA 1O1HA 1U30A 1S38A 3AROA 4L1GA 3KHDA 4YCPA 3RUBL 3BL3A 1NY1A 3EWDA 3WLMA 4QGCA 2EG6A 1B2YA 1OX5A 1SW3A 3N6QA 2DZBA 1V0MA 4BQ5A 3S2LA 3IK2A 3L12A 3QLLA 4FXSA 3FAWA 3LG3A 4GK8A 3COTA 2DT2A 1ZCOA 2OB3A 2WVUA 3PZQA 5DO8A 4OOUA 3VIHA 2GGGA 1EL3A 1JZ7A 3DZ1A 3VMNA 4UTTA 1O60A 1S2WA 4LBRA 5AZ1A 3WKZA 4RZ6A 1XH0A 1Q3NA 3IIXA 3EBVA 1MNSA 3PBGA 3OYXA 2XINA 4DZAA 3H4GA 4YVVA 1AH3A 4A35A 4GUIA 1XLMA 3WF2A 2VKZG 1EGUA 4I7UA 4JN8A 3SIMA 4HNCA 1HNYA 3QSTA 4FSAA 1EEPA 3LGDA 4RXGA 3ABRA 4LCQA 4IFRA 2BY3A 4QDPA 3WH5A 4M6UA 2ZA1A 3DG7A 4GY0A 3TFXA 3CXOA 4YL2A 3K1DA 4JIIX 1GZJA 1IHIA 4TMBA 1W1IE 1MWOA 4MUPA 4B2DA 3OQ8A 3PJWA 3R8GA 1CECA 2QCDA 3CQ0A 4M6VA 1TJ1A 3A5FA 3T2QA 4B5SA 5BOFA 4J7RA 1GK8A 3N1AA 3DBNA 4XB3A 3GXTA 2IXUA 5HUPA 2XH4A 1HKMA 1R9XA 4M7SA 1W5NA 4WY0B 4NYUA 1OCBA 4F3HA 2FB2A 3H53A 2GDUA 1OFRA 4ZQOA 4UQBA 3QGVA 2C14A 2OZ8A 3CT2A 4FX6M 2XIOA 3PANA 1XF0A 3QW3A 4L9YA 5FAJA 3BXWA 3OU8A 1UASA 2OWCA 1EQCA 3MC5A 4ZSTA 1LT8A 3NUKA 1T6MA 1WPCA 1ME8A 1RP9A 4AW7A 5AC8A 3KL3A 1K02A 3T05A 2YXOA 3NQGA 4K7VA 5CPOA 1CXKA 2VZSA 3TXZA 1LOLA 1JYVA 5BCAA 4PCSA 4C5YA 3STEA 1Q6DA 4G9PA 4PTVA 1OFOA 2IKIA 3TW7A 3MDWA 4GZEA 2XVPA 4Q8PA 5CC6A 3BJTA 4DEFA 3V35A 3SDOA 3U2CA 4UCFA 3U2EA 5HNRA 1HJUA 4IOTA 1OJNA 1NJJA 5D9NA 3IVUA 1H7XA 1ZFJA 4REQA 4HSHA 3E96A 2XM1A 3NQFA 3E49A 3MT1A 2G96A 1KQYA 3TTSA 5LYRA 2CBJA 5U4NA 4F48A 3VMOA 3VVGA 3AC0A 1RV8A 2QJJA 5JMUA 3HJEA 4ZQMA 1Q6OA 2QGHA 4LVAA 1QASA 3CV7A 1E1CA 4HD5A 3SCQA 4NSBA 3KVKA 3AIUA 1ELSA 1UMYA 1FDJA 3IT4B 3CB3A 3HG3A 3AUOA 4E3TA 2D2HA 1P6CA 4CD8A 5EB8A 3B0XA 1FTXA 3KBVA 4R9OA 2A3HA 3AU2A 4HK5A 1V0LA 3G77A 4LY4A 4Z1YA 1K1DA 4GUFA 5SWUA 1RWAA 4DUOA 5FSEC 1UWAA 3TW9A 4GISA 1BWLA 1E3ZA 4GG9A 3JZEA 3QM3A 2X40A 5ECUA 2BSLA 2CFFA 1VHCA 4WXZA 2XVGA 1KRMA 1GG0A 4XKYA 4CCZA 1QOQA 1XPYA 4EE9A 5FF2A 3NCOA 2JGYA 2RDXA 2DH3A 4QBXA 3QXBA 3G6LA 4PFHA 4PTMA 3CL8A 1YRRA 4GPNA 3TZFA 4ZE4A 1XGZA 5EGRA 5A3HA 3OLIA 3AMGA 4RR4A 3CV6A 1XYAA 2V5JA 3NQCA 3WQ8A 1V51A 1KGWA 5TQLA 1FHUA 4LRSA 4U28A 5BOOA 5LNUA 5FF7A 2H8ZA 2DUZA 2XFRA 1ODZA 3SO7A 2DT0A 2PMQA 4PUEA 1WUFA 2PA6A 4QX4A 3I4KA 2BS9A 4PN2A 1FY6A 4Q6XA 1UR9A 4V27A 3VIGA 2Y24A 2V3GA 3FVDA 4DQWA 4E4PA 4PUDA 1U1JA 3TTYA 4BFAA 4TVCA 3I7RA 3OO2A 1QTWA 3DG6A 4XVDA 3FVMA 1UKPA 4ZGYA 5CJNA 2DZAA 1GOQA 4H7CA 2J75A 2J13A 4L65A 3GBDA 3CPUA 3DOPA 1J4EA 2D73A 4LAUA 3TTOA 1SM9A 1TYGA 4QE4A 3F4VA 1CI1A 2FZDA 4HMCA 2I5QA 4LFYA 1MDLA 1TQXA 3WCZA 4UTHA 2B4GA 1XV8A 1XYZA 1D9EA 3BLIA 4BI7A 2Z1WA 3VE7A 3URQA 3LNPA 1UZ1A 1W0MA 3UY7A 4QNWA 3GU2A 3HU7A 2PLCA 4QHRA 1QJWA 3NXFA 4M8UA 3AZRA 4B3LA 1N7PA 4OBSA 3P80A 3AJXA 4O0ZA 3HIJA 1OF8A 1KM4A 5AC5A 4IWWA 1TFVA 2GSEA 3QZEA 4C6FA 1DWGM 3VIFA 2O55A 4EF9A 2OOGA 1GQLA 3UR8A 1KGXA 3O07A 1FFRA 4EVZA 3CGTA 3GTIA 3SUWA 1BD0A 2PDIA 1KXHA 1TVLA 1AH4A 3CIXA 2VD8A 2A2IA 2Q01A 3THCA 1C92A 2OX1A 3AXMA 3Q65A 1EHNA 2VDHA 3PZGA 4M6PA 1OQFA 1H49A 4DUVA 1JYXA 2XSBA 2PGEA 1GKPA 3WK2A 1WAWA 2ZZ1A 3B0UX 1JRCA 2RKXA 3TN4A 1SZFA 3CQHA 4S2BA 3S2CA 2QJHA 3AWOA 2WCSA 1OT2A 3P8JA 3UJFA 1YYAA 3WLKX 3KWSA 3IJQA 5HULA 4DB7A 3CEPA 2HBXA 1SFTA 2DEPA 5IXEA 1TR9A 4Q8NA 2WZIA 1Z32X 4ZA0A 3K8MA 1JYNA 1CTNA 4GCAA 4XIMA 3A22A 3GHRA 2WKJA 3LI1A 3CYJA 3EX2A 1ISXA 1KFBA 2O4MA 2ASHA 2E0PA 4GGHA 3LX9A 4OFCA 1N7NA 4HNLA 1GPWA 5B7ZA 1GQJA 2D2GA 4YVPA 2J7GA 4GYKA 1JCMP 3HV8A 3CIVA 3OP2A 3DFNA 3PBUA 1WZAA 2EGZA 3RX2A 5EMJA 2XH2A 4LSBA 1EJTC 2INZA 4M1BA 4FNTA 1G7VA 4XBSA 1MI3A 2ZX7A 4XBJA 1UBSA 4ZOEA 2WYSA 3WL1A 2PZNA 3SEPA 1IEVA 3HA1A 2ZRYA 3W22A 4K7YA 3UWYA 4DXXA 1YKWA 1UD5A 2GJPA 4JNZA 2WJDA 1RWFA 3NL5A 1U83A 3LD5A 2XIJA 4EPBC 4JXCA 5CLTA 4W8BA 4IPIA 1F6PA 1WXYA 3SN1A 4NIRA 1VQTA 4GXWA 4DLQA 2BRVX 4XX6A 2QT3A 3OTRA 1Q6RA 5C9XA 2V2DA 3LU2A 1LL6A 1H09A 3U3HA 3N2OA 5E09A 5AYXA 4C91A 4FNPA 4OZOA 3APTA 1V8EA 3QBUA 3NYDA 1WKDA 1BQGA 4GC4A 4XAPA 5FEXA 4PL1A 1J2WA 2WM1A 4HJWA 5A6AA 3TW6A 1R30A 2DY3A 5C7VA 3BTNA 2QPSA 3M0HA 4Z42C 3VGDA 5LXEA 1A5BA 3ZJ8A 1XLIA 2RJGA 3NPWA 3JVAA 1I1WA 1P0KA 3HBLA 3O15A 1BXNA 4TO8A 5HMDA 1YNPA 4CD6A 3AZSA 2YCIX 4GBUA 3PZIA 1UZHA 4IIHA 3RO8A 2HS8A 2E24A 1VBHA 5C2XA 2ZWYA 4AYGA 2WJFA 3M0JA 4AZIA 1VCGA 1NH6A 3W2NA 4E2OA 2PP3A 3LZ3A 1ICSA 2XVKA 2ZX6A 3ITTA 3M7SA 4ZB0A 2J7DA 5JU6A 4NZJA 4TIMA 2BRWA 2BVDA 3UBPC 5REQB 1WOAA 1Z41A 3ARXA 2PDCA 2C0HA 4LC8A 3OLDA 3TTQA 3SJNA 4O50A 1E9YB 3S1WA 4JIHA 3RU6A 3G24A 3MJMA 3TV8A 2X2GA 2G3FA 4FF7A 1T0OA 3NZ1A 3L0KA 3FHAA 2EO7A 5D32A 3TWAA 1Z6KA 2EPMX 4E4UA 3UZWA 3VMPA 2C0AA 2PF8A 3APYA 3DAQA 3HN3A 1HX0A 4J1OA 3KOFA 1CLKA 3C86A 5G4EA 3VZZA 4G1NA 2NQHA 1E15A 1JRBA 1S2UA 1QFEA 2PDYA 1V6XA 5GJMA 4R7JA 2YIHA 1ZRQA 5BRQA 3IJLA 2WC3A 4HP5A 4REQB 2GQ3A 3L21A 3VNLA 3KS6A 3PWIA 3IS4A 3W2MA 1F6YA 1RY0A 1RLCL 4LALA 1R3WA 3KLLA 5J5DA 4P7RA 3KCLA 3HO8A 1T8QA 3LUTA 1C7TA 1VYRA 4JYEA 1OYBA 3RCNA 2BY0A 1E1CB 3WD1A 3UXAA 3DXIA 4Y9PA 2INFA 2V6AA 4UQDA 5HWNA 3M41A 3MSGA 2NXHA 4JOMA 5LNWA 1EOMA 1KW1A 2PGWA 1RZMA 3MYPA 1XRTA 3U6WA 3S6OA 3PSVA 3MB9A 2Z1XA 3G1XA 4IXXA 4NF7A 2VZVA 4BR1A 1GHSA 4B2DD 1DIDA 4UUIA 3GW3A 3EKLA 1H41A 4Z0JA 3R79A 2ZA2A 4E8GA 3OJGA 3B3DA 3PTKA 4D6IA 5AC4A 4JYFA 1XDMA 4DYJA 5EL1A 3WD4A 4GX9A 3LV6A 4LS1A 1VIZA 1G01A 1KBJA 2J79A 3UFYA 3GVVA 2OU4A 1SO5A 1E70M 5K2ZA 4QE1A 1RJQA 2A7PA 2AKZA 1J0JA 1ITXA 2NUWA 2XIQA 3DENA 3RX3A 4HOZA 1WKFA 4DF0A 4F9JA 1Q66A 4QG8A 2I5IA 3B8WA 3PTMA 4WLCA 4D71A 2FJUB 4M19A 3WMBA 1V3MA 3TFCA 3GC5A 4Q6JA 2DQWA 3S6DA 1BG9A 1QNVA 2PDWA 1BG4A 3LM7A 1OGSA 4K3ZA 5CH9A 3SY8A 3BC9A 1I6NA 1NU5A 4R7WA 3GNOA 2Z7KA 5G2IA 4AIOA 2VZTA 1A50A 4FIRA 4LU0A 3A9BA 3NDZA 1NAL1 3TAOA 2F6KA 2HJPA 3MI3A 3VO0A 4XD6A 1Q7ZA 4WF7A 3AMLA 1OX4A 1OK6A 3OHMB 4ILSA 1WDRA 3O6YX 1EJWC 3K8LA 4MDOA 1W1VA 3LPPA 1XLLA 1TPB1 1J93A 3AYVA 1KKRA 5ABEA 3A13A 3GDRA 4KWVA 1FH9A 3G1HA 1OY0A 3W02A 1BYBA 3W23A 1OJOA 4IPNB 4WIWA 4UOZA 2RHGA 3T7VA 3ZSTA 1OSEA 1O95A 4B9YA 1V6VA 3RM9A 3ZJ7A 5CPSA 4UOQA 4GX8A 1H51A 1GJPA 1W32A 4EF8A 1VJSA 2P8BA 3I6RA 5M3WA 3M0XA 1P7TA 1V7AA 2PWDA 2E77A 4Y2WA 4KT2A 2CLOA 1J0NA 3N2CA 1US3A 2CCRA 5EFFA 1EGMA 1XYCA 1KTCA 1ICQA 3OBAA 4DJDC 3AXKA 5C2CA 1XLKA 3KEHA 1OFAA 4LOCA 5DY2A 4O1DA 4AD0A 3W7DA 1RBLA 1F9CA 3OVGA 3W24A 4D1IA 1S5VA 2IUZA 4MB1A 4UNLA 2QDGA 5G1TA 2WOQA 2OVLA 3D46A 5CGQA 3WL0A 1U33A 1YADA 3CU2A 4LWWA 4C6MA 1FWGC 4RE2A 1PPIA 1K7XA 4FR6A 5L6UA 1ZJHA 1FCBA 3TVAA 3B8IA 4IM4A 3K30A 1XD0A 2WCAA 3AMCA 3CZ8A 4NZFA 1QVBA 3WENA 5ECVA 1PKLA 2DVUA 1A4MA 2BHYA 2YKKA 2EPHA 4LVBA 4QLJA 3N12A 1LRQA 4GH3A 4Q22A 2QZRA 3N2MA 1W3KA 4YHEA 1ZJAA 2BASA 3CTLA 3N3TA 3H7RA 2WWDA 4JL2A 1DP0A 3TJIA 3FW6A 1X98A 4XZNX 3CT7A 3ARQA 4A2SA 4CVUA 4LF1A 4KEMA 3TQPA 2NWRA 1DJQA 4XZLX 5AVNA 3HPXA 3L5MA 4CQDA 1E6PA 1LRTA 4MF4A 1XLJA 2J4GA 1G69A 2V3DA 3V3WA 1O1ZA 2I56A 1L6WA 3CV2A 4D6GA 1HZYA 4C6EA 1FWTA 2QCGA 1V5XA 2C1IA 1CLVA 4PTNA 1POKA 4AF0A 4LUSB 4GVHA 3BAYA 4OGZA 4UQEA 4D6JA 1NP0A 2QLYA 3G1FA 2GJXA 2W0UA 2WMIA 5E6ZA 2VX5A 3GXDA 4I9AA 1YMYA 4BS0A 3ISIX 4F79A 2YPIA 1SSDA 1WDPA 2AGTA 2ZBTA 1F5ZA 4GOAA 4ZODA 2A85A 4UZUA 1UPPA 3BURA 1YE6A 4FALA 4YYFA 3JR2A 4ES4A 1U5JA 2BGQA 4DAIA 5A6SA 5D9PA 2OWWA 3GHSA 3GBEA 2J8GA 2DT1A 1KM6A 3N18A 3RLUA 3VD5A 3W25A 3VC6A 6REQA 4CNSA 2NXIA 5LXXA 2E68A 1AJZA 3JZUA 3WMSA 5AECA 1QHPA 2G3NA 3G3MA 2WWCA 4H9XA 4B92A 3TSMA 3H7VA 2BODX 3RMJA 2AAAA 2JEPA 2R6OA 1JUBA 4XUGA 4HVXA 3PZTA 3OLEA 5E9AA 4UXDA 4Q8TA 4UZSA 2VHLA 4MIMA 4OECA 4AZ7A 4QSHA 3E5PA 1J5TA 2WPGA 5D9OA 2O9RA 4OV4A 4YJ5A 2P8CA 1E40A 1TPEA 2NWSA 4MDPA 1TPVA 4MUZA 4EAMA 5DT5A 3GVGA 1UH4A 2CZEA 5B7YA 2DSWA 2J6XA 1BTCA 2A7RA 3SQSA 2E6DA 4HIBA 5TF0A 4HHHA 1LTDA 4NAEA 3MKCA 4O1CA 1Q4NX 5IDIA 1AH0A 2HCVA 4DJFC 3E38A 1LWIA 4X9SA 4GACA 4PA8A 2P5NA 4GQBA 4PB4A 4DO4A 1C29A 4QQ3A 4MJ4A 3TYBA 4YTQA 5DELA 1ISYA 4ERGA 4I9MA 4NXKA 1QI0A 1UCWA 1JD7A 3R58A 4K36A 4E5TA 2VGFA 3H54A 1H4PA 1JI2A 2EHHA 1H7WA 3Q2DA 1W17A 4RUBA 1C8QA 3PPGA 4MNKA 2Q6ZA 1TV8A 3VNIA 3GM8A 2RAGA 3OZMA 2P3EA 3M0KA 1UQZA 2Q8ZA 4J3WA 3L4XA 1F61A 3CMFA 3OB8A 5I03A 1ICPA 1XDLA 1XICA 2J62A 5CG0A 1XSKA 1QNQA 1JYWA 1OGBA 1Z69A 2QUUA 2V2CA 2Y62A 2QCMA 1Z9AA 4LY8A 1IWPA 1UB3A 1E43A 1RCXB 2PDNA 3WQ4A 4K8HA 5E93A 4RPQA 3ZQ9A 1SYTA 1JDEA 1AL7A 1C93A 5HA7A 3UR7A 4CNNA 4B5XA 3L9CA 3QOMA 2EKGA 1QW9A 2R24A 3MSDA 3NEVA 5BU6A 3T0TA 4XQ6A 2DUXA 1O5RA 2G50A 4CNTA 4AD1A 5AHFA 1WO2A 2A5HA 3ZIZA 4UTMA 4LH8A 2E3ZA 4BWLC 1ZALA 3LNMA 1H1ZA 4LCRA 3UA4A 4JIPA 3QR1A 4DBWA 1S5NA 1QPNA 3W4RA 2XN2A 4YXGA 2POTA 3M4HA 1CXEA 4H8VA 1JNEA 3UJ2A 1VIWA 3BSGA 5JUVA 4NP7A 1NFGA 1NQKA 3N29A 2WQDA 2MANA 4E2VA 2FGZA 2CESA 4MFEA 4LPCA 1R7AA 3T9PA 1WZMA 4AIEA 1PO9A 2GGIA 3GXNA 3VNMA 3AUJA 4BQ4A 2B0MA 1R87A 1BPLB 3MANA 3IAPA 1J0HA 3MUAA 3C5QA 1OFPA 5T91A 5C71A 4US6A 2Y5SA 3NL3A 1PX8A 3SJ3A 3IJDA 3L67A 1UD3A 4LNYA 4PB5A 2WZTA 2A4AA 1QXLA 3DFYA 2J88A 3FCPA 4BQ3A 4CUCA 3XISA 3W27A 5FF0A 3MUXA 4JIRA 4C1KA 2R1MA 3EDFA 2Z0IA 3GYCA 1KM2A 2H3BA 1VFLA 4U4MA 2A6LA 2ALDA 1TV3A 1LQ2A 3ANYA 1PV8A 3QOKA 2XYLA 3DIPA 1E0WA 3PG8A 2YSWA 3QQ0A 1NQ6A 4JTEA 5C9UA 3SSJA 3NGJA 3UZJA 3P5ZA 4M24A 1ZSXA 3RPTA 3S5SA 3PVFA 1GOOA 3GDTA 2PDBA 1JJKA 4ATWA 2R1KA 2FZBA 3KFTA 3TJ4A 3VZYA 1NARA 3RRXA 3W1AA 1OZQA 1P7TB 2HXTA 3AHVA 5IHSA 3EX1A 1AG1O 3T08A 2P0IA 3HFTA 1WKEA 1Z7AA 2EG7A 3QHMA 1XDJA 3I3EA 3R7MA 4B3ZA 4QJ5B 5M2FX 1V3JA 1JPIA 1BVNP 3ANUA 2A3BA 2YXGA 3OGVA 3GZAA 2OZ3A 4E8DA 4UTUA 3O8AA 1X6LA 3KOWA 1B0IA 2ZXAA 3KZPA 1KRAC 2E1WA 5FEWA 5F2IA 1TPDA 1VP5A 3OQEA 3LHTA 3FSUA 1K9DA 3DFHA 4NVTA 3AZTA 2E6FA 3RLGA 4NZ5A 1JPKA 4IQLA 1FCVA 1XIHA 2JK2A 5A6TC 3TCEA 5HWMA 1S5WA 5G1YA 3TMLA 1IEQA 1A5NC 5A94A 2IQTA 1IE7C 1QMLA 3ARRA 4F0HA 2PTZA 3O06A 4KWWA 2GSJA 3GVQA 3VCCA 3VGHA 4IHCA 3TC3A 4IH3A 2PDKA 5E0CA 1OCQA 2Y63A 4N6EA 3MW7A 3ICJA 2PLMA 2FVMA 1H7OA 1M7JA 2OWXA 1TELA 3CZGA 3QLDA 1K7FA 3VNDA 2V63A 1KFJA 4ZSUA 3PP7A 3TU9A 3C61A 3UZXA 4NJKA 3POHA 4HA4A 3CL7A 4A2RA 1MZHA 4JBRA 3M5YA 4IMCA 4RDWA 2OTDA 3QZAA 7REQA 2QV4A 4Q8VA 1ECQA 1VBRA 6CGTA 1US2A 4Y90A 3W00A 1PIGA 3AIEA 3A3HA 1TPH1 4E6MA 1FFQA 3MS8A 1AFSA 2ZUTA 1MRQA 2VR5A 3C0LA 5G4HC 5BZAA 1V79A 4AF0B 1XLDA 1O6IA 2PWVA 3MCMA 3QGAC 2GJXB 3N15A 2WMIB 3AHXA 3NURA 4G1KA 1KO0A 3NXLA 5A6KA 5T9BG 3N3MA 1GYNA 5GJNA 4E0CA 5D2XA 1LORA 3IUDA 3WFZA 1UD4A 5FSDC 1A5UA 1G67A 2J24A 4JFSA 5FJJA 1OHLA 1RH9A 1TMQA 1XSIA 3JUGA 4D8OA 4AD4A 4HN8A 1X97A 1E0XA 2YBUA 1UKSA 5BWFA 1YDVA 4JTTA 2DUAA 2PSNA 2XUCA 3WF3A 2VWTA 4K37A 3QFWA 3S1VA 3CASA 3TYCA 5D2VA 6REQB 2J74A 1ZBVA 3DDMA 4H9TA 3VOCA 4IFKB 3MKVA 2YL5A 4MOZA 5CSUA 4HPNA 2R82A 3KP0A 4PSRA 4FB7A 7ODCA 1AODA 3V0TA 3SGGA 4V33A 3B0YA 3EGJA 1GZ1A 4ORMA 3N2XA 2PP1A 3PNUA 4GNKB 3CZJA 4OHQA 4IMGA 4IXHA 2I7GA 4MLRA 1QNRA 4XG1A 3UCDA 3TP4A 4HYWA 1GOMA 1I2QA 1E1EA 1P5BA 1QI2A 3II1A 2CBIA 1UP0A 2YJQA 3C2EA 2E5DA 5KZ6A 1J10A 3QW4B 3MQTA 2JQXA 1V6YA 3L5LA 3NYZA 5LA2A 4K8GA 4TU1A 2Y61A 3SSZA 2INEA 5E0KA 3AQUA 1UR2A 4ZO9A 3AMKA 1GJWA 4AXKA 4LAKA 4LV4A 4KWSA 4CCEA 4CVWA 4GD0A 4J3XA 3BWWA 4JTCA 4M6QA 1NWUA 1TTPA 2AQOA 1O68A 2QAPA 3FK4A 3HTWA 3ZLFA 4WX2A 3PUDA 1XLHA 2GL5A 1VEOA 1YDNA 2GUYA 1DV7A 2NVCA 1QPQA 4JHMA 1KCXA 3FXYA 4K8EA 1GQNA 3BGJA 5A69A 4HA0A 1HXJA 1E6SM 2PWHA 4IIDA 2XN0A 3KUMA 4W9TA 1ZU8A 1KB3A 3LRLA 3WBYA 2PBGA 1MEIA 3QSRA 1K8YA 3MMTA 3EOSA 3IJ8A 4KERA 4MPKA 1X96A 1BGGA 4NZCA 4MNLA 1MFVA 1M1BA 4F0SA 2XISA 4BF5A 3VNKA 1JDCA 2VOTA 4JX4A 3N19B 3RO6A 3W01A 1SZGA 5AYYA 1IGSA 3GQYA 4Q7NA 1OJMA 2NQJA 4V2XA 3PZNA 5BMXA 1XRVA 2X8RA 5ABHA 4KIEA 4S3AA 4UCGA 3AS3A 3D3FA 2F8QA 2VX4A 3EB2A 4MZYA 4AEFA 4QLLA 2F7FA 4MM1A 3ABXA 3UVIA 2WSYA 1HGYA 1Y7VA 5H2ZA 3R89A 5HK4A 1SW7A 1W37A 4PGLA 3VD4A 1MEWA 4MAZA 2WZMA 2PLKA 1REQB 2DGAA 1NDZA 4V1YA 1X1IA 3W7HA 4XISA 3VKKA 1F1SA 3HGOA 4RL3A 4MNMA 2VVNA 3TSBA 2YLAA 3M43A 1FVPA 2NSOA 4FLOA 2YEPB 1OCNA 4XAYA 4S38A 3G2GA 4GI6A 3I6TA 4ZTYA 2DSUA 3SY5A 5CJMA 3E2RA 3FYOA 4PUWA 5M1TA 3SRFA 5K3VA 1HP4A 5J04A 3VUSA 3NQMA 5ABTA 4U2YA 1MQPA 3PBVA 1TCDA 1UWIA 2FHCA 3C3UA 3MCNA 4JQAA 1WOBA 3NM1A 2VDGA 2DZWA 2FLIA 4K1WA 2EJAA 3UGRA 1UZDA 3TN6A 4GC3A 3RLVA 1LJYA 1BWKA 1VS1A 5H6HA 3PN8A 5JXQA 2NX9A 4O57A 2OOFA 3VNJA 5D8WA 2CERA 2O56A 2ZC1A 4I6KA 1SJAA 3G8RA 4S3JA 1V6WA 2DFAA 1W1ZA 3SRDA 3B03A 1R47A 2QW5A 4DIAA 1J01A 2X1TA 4JEQA 3O9NA 2Y7EA 2XGZA 4OBRA 4AFYA 2X1SA 1ITUA 1F07A 1MSSA 2FFCA 1W31A 4RE4A 1A5AA 3S5OA 1DIEA 3LCWA 3VIJA 4DJDA 5AYZA 1DJYA 4MB3A 2VR4A 3ABOA 3V0SA 1OC6A 3UWVA 5HNUA 5DX7A 4F2BA 5CBBA 4UMCA 4MPQA 4YWIA 1X1JA 4UQ9A 1C9DA 4D6HA 1K9TA 2ZZ6A 4EACA 1XC6A 3OOQA 4F0RA 1BWVA 1J8VA 2GVEA 3TQKA 2A0NA 3WH8A 3L4VA 3P8IA 2OX4A 4AD2A 1S5TA 3LSCA 3S3GA 2VP8A 3WDJA 3W6LA 1OABA 1O12A 4GVFA 2XGBA 4UBPC 3SN0A 1R2RA 1WA3A 3IVTA 5A6BA 3T09A 1XCXA 4H9VA 3NO3A 3TONA 1L9WA 4AY1A 5K4XA 3VDAA 3CNYA 1GPFA 2GQAA 3PUGA 2H3DA 5CBIA 1MXGA 1BGAA 3S2MA 3S0CA 3WH6A 4CD5A 3SCTA 3BARA 5E70A 4LVGA 3QPEA 2BVYA 3EXRA 3UERA 1XW8A 3VINA 3BMXA 2VX7A 1DTUA 2ISFA 1YXCA 3PZMA 2ZXDA 5C7HA 3WQPA 1LXMA 3W37A 3WD3A 1TO3A 1LG1A 3F2BA 1V6UA 4H9UA 1UR4A 1E1FA 4Z2IA 4WVXA 1NDWA 2OT1A 4JX5A 1GKQA 1GQKA 3HG5A 4C7DA 1XKYA 2XDFA 5K4ZA 1EIBA 3Q94A 1RPKA 3EDDA 1QAPA 1EXBA 3PZUA 2X03A 2VVSA 4DI8A 2QJGA 3IEBA 3HPZA 3EPMA 3QTGA 3SRHA 3NAVA 3VI2A 4IIEA 4MB5A 1ZJIA 1P48A 4RDVA 3U4FA 7REQB 1M65A 1RXOB 5EBAA 4GYPC 1FXPA 4TMCA 3ZR4A 4OBTA 1O5XA 1YBQA 3DBPA 2GJNA 2P88A 2RJHA 2WJEA 4HMDA 3FIGA 3LGEA 4DVOA 2OLAA 1IXOA 4AY7A 4YN5A 1OBAA 4JTKA 3LHWA 1AJ2A 4YCOA 4U10A 5U7SA 1HKVA 1E55A 3GXMA 5A2BA 4P8WA 4WUIA 1DIOA 2VX6A 1XJBA 4MZ8A 3LBMA 3C2RA 2Q71A 3WK3A 2I57A 3AWNA 2A21A 3LB0A 1TJ2A 3T0DA 3NVTA 4Q7IA 2R91A 4YHGA 1EQPA 5C54A 3TYEA 2Z28A 3NQ8A 5BRPA 4D6DA 2BP1A 2PODA 2G3MA 1DTNA 2FTWA 1QDSA 1RVGA 3GY1A 3SCOA 1U1HA 1CGYA 1SVDA 4Z1CA 1U5HA 1ZAJA 3CV1A 5A2AA 1O5QA 3T40A 3SGUA 1IXQA 4I9TA 1XWYA 3BUVA 2DZSA 1AVAA 2V3EA 5CZTA 3AIBA 2PDQA 3EDEA 4E2DA 3BLFA 3VIMA 2YA2A 3OHIA 1TV2A 5KINA 4S3FA 5GNXA 8TIMA 3BW2A 1C82A 3W7LA 1V08A 4K1GA 1V02A 1XD1A 2ZRVA 4O1FA 1TJ0A 4O13A 1IZJA 1XSJA 1DYSA 4DJFA 2CWXA 1DXEA 3H55A 3S9YA 1UH2A 2YLLA 3RJYA 3WBXA 1HN0A 3ITYA 1KLYA 2Y8KA 3RDKA 3A4XA 3CQIA 2GWGA 5HR7A 2WMFA 4KCWA 1TWSA 1GOXA 4O16A 1HJVA 1MRAA 2WSKA 2OGJA 1JF5A 2QDDA 1DL3A 3W1MA 3TR2A 2QMKA 2YYTA 1GVIA 2QF7A 4OV9A 5J5RA 2HK1A 4PRRA 4JR5A 3H2NA 4A29A 3AO0A 1T5AA 3RM8A 2WMJA 4H8UA 2QNEA 4Q8UA 5KMYA 1EFZA 3B9OA 1W5OA 2OYKA 4YLWA 4CEXC 2BNJA 3GB6A 2VM8A 3EA2A 1I2NA 4TTGA 3ZT7A 1IR2A 3UW6A 5D37A 1Q5MA 3I3DA 3UCQA 3CZLA 2TSYA 2Z1SA 2HV5A 1R3YA 4QSFA 4QDMA 2Y5EA 4WDXA 2C16A 3UPBA 4PODA 1ZQ5A 4N9BA 2LLEA 3OVQA 3AXXA 1ODUA 3CPRA 2OR2A 1P4CA 3IT6B 3BG9A 4W93A 4D72A 3UU0A 3KBTC 4FOUA 4AHPA 3LDVA 1AQHA 4MMWA 1S2CA 3CYVA 1UBPC 4DF2A 1A3HA 1KBBA 1TQJA 5ABFA 1FDZA 4AY8A 5D02A 4GMEA 1IEXA 2G4FA 2VEPA 3N17A 3TYAA 4JQ4A 4BWLA 3DX5A 5A1AA 4L6DA 5C2GA 4CGTA 2Q8XA 3WUBA 1K03A 1VHNA 1IT7A 4V15A 1QBAA 3FLUA 3G0SA 4YNGA 2WHKA 3UD2A 1SJCA 2TODA 3UD1A 2X30A 4JTGA 4UTFA 4HU4A 3WLIA 1PS9A 3DYOA 3VNZA 4MLJA 1RCQA 2CBVA 1EC8A 4CN6A 1W9XA 3GHUA 4YTTA 5F1VA 3IV8A 4W4QA 4GINA 4MWAE 2DV0A 1CB8A 4FR1A 2JBMA 2W5FA 1HW6A 1GUVA 4A4AA 2ZC8A 1XL9A 3M7WA 4LS2A 1XI3A 5HPCA 3POCA 2XSAA 4FXFA 1D8CA 1ZBKA 5LHFA 2BX7A 3S1XA 1VYPX 2FYMA 4JIEA 3QQWA 1UWUA 1AD4A 2X7VA 3R25A 4PMOA 4AZ6A 1GTHA 3KRUA 3TN5A 4LTSA 3VILA 4J40A 3H23A 1YPXA 4O12A 2QPUA 2PTXA 3GLCA 1UJQA 1RJPA 3GG0A 3VPLA 2I17A 3L2IA 4TOQA 3UNTA 4AIBA 2DPEA 5LGZA 3FA4A 1SZRA 1KXQA 4UB9A 1W3HA 3PFMA 5KZDA 4GQRA 3ATYA 3QY8A 4JTSA 2Y7DA 4ZL1A 4HSOA 4NAFB 2Z7GA 2NQLA 1RD5A 1WYIA 4UNIA 4B90A 2XH7A 1NVMA 1RQBA 2VI0A 1M41A 3W76A 1OX6A 4RKAA 1ONEA 3O6AA 1SR0A 4HTYA 3LXBA 2QUVA 3QV6A 3EWUA 3MVTA 3RN6A 4P8XA 3VDGA 2VEIA 1P0NA 2EJ1A 5HPOA 1RWCA 3CTTA 2Y8UA 2JEQA 1G1YA 3KM8A 2R94A 1D3HA 1PZ0A 3RHGA 4F40A 5XINA 4DJEC 1LOQA 3VUPA 1RBOB 3G22A 4QNEA 4AVOA 4B5UA 2R1LA 3OLGA 3BVJA 3T6CA 1ZAHA 3L4WA 1FCUA 3TR9A 4EXAA 3MPGA 1HJQA 2OQLA 4D8AA 4NASA 1GVFA 4AZCB 2VCCA 2QIIA 3CS2A 4NNBA 4AISA 4JCLA 2VNCA 2ALRA 4O52A 1DWAM 4M80A 3M5VA 1SPQA 3QF0A 1RVKA 1UD8A 1MW0A 3DUGA 4J2MA 3MSYA 1I0BA 1OVDA 3V16A 1JZ3A 1QWGA 4AXNA 4I8DA 3BJFA 3FYPA 3KE0A 3P7YA 1HVQA 3P84A 2E9BA 4WSJA 2P50A 4NT0A 1JGMA 2GGHA 2G37A 4HB7A 3A21A 5JVLA 3LCIA 3OA5A 4UTKA 3UJSA 4Q4PA 3MTWA 1FX6A 1R38A 2OYMA 1VF8A 1ZB5A 4ZBCA 3BOLA 2V30A 3BLPX 5F2GA 3WQVA 2VEKA 3TKFA 3ONCA 3KZSA 1GTEA 5DMMA 4IL2A 4MYXA 2CNCA 3WBWA 4FK9A 4KCVA 3THDA 3DU0A 1DPMA 1V3KA 4BZYA 3T2PA 2VEMA 5HATA 5F1UA 2GGJA 4DBUA 4DJDD 3ITGA 4HNVA 4OT7A 1E6QM 1W91A 1MW2A 4WDWA 2QAFA 3LTYA 4TUFA 3TH6A 4EXQA 4A3RA 3MUZ1 4JDYA 4S3KA 2J78A 2QJMA 1TVPA 3CUIA 3BW3A 5I0DA 1YNYA 1YBQB 4GKTA 1PX3A 4MZ1A 4GUHA 3AIQA 1UR0A 3O0KA 3W0KA 4Q8WA 4FF5A 3ARPA 1SO6A 3PHAA 5DANA 3MA8A 2VZKB 4AYSA 5DRCA 2QPXA 3NZRA 2BG5A 1A53A 2A79A 4L64A 3P61A 3M6YA 1RJRA 4X2PA 3PPHA 4DZHA 5A6BD 2ZX5A 3W26A 4PMVA 4XKMA 1EBHA 5DRIA 3ZR6A 3P62A 1JGIA 5MHBA 1J0IA 1TREA 3P3BA 3C2VA 3ANVA 1R9ZA 4B16A 1HKKA 3CUZA 3ALFA 1OC7A 3W1LA 3PZ9A 4HBKA 1TE1A 3NZPA 3LLXA 3AXHA 3M64A 4UQAA 4QCFA 4FP1A 1FWHC 4HJFA 1YQ2A 4HK6A 2WNWA 1UUMA 1WUEA 1W9BM 4UWMA 1T8XA 2W92A 3HQ1A 1EZ2A 1J6OA 3H2AA 1B9BA 2HVMA 1VFHA 2AAMA 1EP3A 1PTGA 3S1GA 2ZVRA 2PRHA 4JEJA 2UY3A 3P14A 4GUGA 1BAGA 1XLAA 3MWAA 3F4CA 2VDIA 1EBGA 2ZUVA 4KEZA 3NOYA 5LIYX 3BV7A 4C6OA 2WMHA 2XFFA 4AZGA 2OODA 2VCBA 2JFEX 1UWTA 2R9RA 1X7FA 3ES8A 3TNBA 4NNCA 1YDOA 4LEQA 1JZ2A 2HE5A 1Q6EA 2AKMA 2ABAA 3IAQA 3SR7A 2QVHA 3INPA 5C5YA 4R3UA 2DZUA 3L4UA 2VELA 3M1ZA 1GVOA 5JBFA 1DXIA 2VZKD 4LW7A 3MUY1 1XYMA 1S5MA 4J3ZA 4O28A 4MADA 2CW6A 1XLFA 4OUIA 4D8ZA 4W5ZA 3NVDA 4HMNA 3F4WA 3HMCA 4C6KA 3LI0A 5E5CA 1RWGA 2ICSA 2CU0A 1L2QA 3AMDA 2CHOA 1WBHA 4P7LA 4GZJA 2Y88A 4MG4A 1LLZA 1N7OA 5CPTA 1PHQA 4Q8MA 1Q13A 1XIFA 1TA3A 3L5AA 3W7KA 4PRTA 2MUCA 3FJ4A 4ICCX 3UWQA 2WHMA 3AS1A 3LN3A 2EAWA 1UKTA 1SO4A 2P3ZA 4V28A 5ABFB 1MNZA 4DM1A 1CCWB 2VMFA 2GK1B 1HKIA 4IIFA 1LF1A 1W3TA 4RK8A 4RDYA 5H8UA 4C6NA 1I75A 3IJ9A 2X41A 3N14A 3H2EA 2CIPA 1XUZA 1XPGA 3KVJA 4N6FA 4WRHA 1IWBA 4DELA 4DUXA 1DVJA 4DWDA 5FL0A 4I5RA 4JHZA 2EXOA 3O6CA 5CZSA 1JDFA 1TCMA 4MJ2A 1D3CA 1MW1A 2WVVB 4KKXA 2VUYA 4YS1A 3P81A 1K8XA 1E6RA 2JF7A 5I07A 1XC4A 4O4WA 3QR0A 3QC0A 4DJFD 1SU5A 1K8CA 1ZS2A 1DJGA 2D23A 4EWJA 2Z6JA 2ZDRA 4IPPA 2WKLA 5I3FA 1DWIM 1YW1A 3MHUA 3V4BA 4H9ZA 4JL1A 2X2YA 2XHYA 3MSRA 4FLQA 2Z2AA 2YOCA 4DYKA 1GEHA 1ECEA 3R6IA 2JKEA 3FHQA 4B9ZA 3IACA 1LLWA 1C91A 1Y5XA 1VFFA 2Z00A 3PJTA 2GFTA 3G1AA 4EPKA 4KGJA 3WMLA 3LERA 4GFSA 2DIJA 4H41A 4PCFA 4PEEA 4ADUA 1K9EA 4U5IA 5FEZA 2XVLA 2X1IA 2Q3RA 2J9ZA 2HPIA 3LSBA 3NWRA 1PZ2A 2OPJA 5BXRA 1W5MA 2NW0A 2BY1A 1ITQA 4J3SA 3MP4A 4WDTA 3AICA 2XWDA 1XISA 5LNVA 4HCDA 4MB4A 4XO7A 1NOFA 5I06A 1E0VA 5EYWA 1NTHA 2DT3A 4D8LA 2C91A 4EP8C 2XH0A 2ZIDA 3EOLA 1R86A 2GOUA 5EMYA 1A47A 3GXPA 3AISA 1LBLA 5FJUA 4JKMA 3THUA 4PBGA 2W91A 5CPQA 2B7PA 4IGSA 2EG8A 5CC7A 2DP3A 2E7FA 1CXFA 4XSLA 5HBFA 5FACA 4HKPA 1W3LA 3KBMA 5CZ0A 3TA6A 3W73A 2WKGA 4ZQCA 4ALDA 2FDSA 4PFMA 1SQ7A 4TTUA 1EJRC 1MXDA 1FWEC 3QJAA 3HQPA 2ZCGA 1CGVA 2H8XA 3VKBA 4UR8A 3BG5A 2WLZA 1CGUA 3WLLA 3A23A 2AMXA 3BICA 1EGVA 4JYDA 3HG2A 1QI5A 4S3EA 3LTSA 3W86A 3Q37A 5A8QA 5REQA 1F7BA 3LRKA 4HHLA 3KOXA 1XP3A 3HFYA 3VD3A 2IPFA 2Z1KA 4BY3A 3ZLHA