4D6HA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 1 blood group a-tetrasaccharide (e558a x02 mutant)
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
587
structure length
587
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTASYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords GLYCOSIDE HYDROLASE
total genus 219
structure length 587
sequence length 587
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6hA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6hA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6hA02
3AXXA 4LYRA 2WMGA 1QW8A 3IAQA 4P8WA 3BGAA 2XG9A 1PIGA 1VJSA 1NWRA 4OOZA 5A8QA 2RGLA 4LYPA 3VDHA 2G3IA 1J0MA 2WYSA 2XGBA 1AQ0A 3L4WA 1BGGA 4Y7EA 2YKKA 3SCQA 2QMJA 1GPFA 4ATWA 2HVMA 1CB8A 3ZIZA 3DYPA 3KL5A 1VRXA 2J7BA 2NT0A 3G6LA 1E1EA 1LOHA 3ZT5A 4DUWA 3SCUA 1FP8A 2O9RA 6CGTA 1RWAA 1JGIA 5EFFA 3CUGA 3OLIA 4UFHA 1ITXA 3GXIA 4DM1A 3GH5A 1C8QA 1E6ZA 4U33A 3BMWA 3EDFA 2F2HA 3CZKA 2E8ZA 3AS2A 5M3WA 2ZXDA 5I77A 5C71A 2XUCA 1SFSA 2E9MA 5LA2A 3WNKA 4CCDA 3PZTA 5HDRA 2VCBA 1E6PA 2GJPA 4NZCA 1JZ5A 6A3HA 2DT3A 2WWCA 2WZIA 1GOKA 2JALA 4MTVA 3EBVA 1JZ7A 1B3VA 2D3NA 4B15A 3ZM8A 2X2YA 5LYRA 3WN6A 1EDQA 1FHLA 1GW1A 4AZIA 2YA1A 2PF0A 4PSPA 1M7XA 1QVBA 3AHXA 1ISYA 4L4PA 4FLSA 1FA2A 4F79A 4IISA 1J0HA 3TTYA 2X03A 4W7WA 3VU2A 1BPLB 2X8RA 2PBGA 1UKQA 4J28A 1B3WA 1HN1A 2X09A 1G9HA 5A6BD 3WDHA 1BSIA 4AD5A 1ZBWA 3AZRA 1WO2A 3SCSA 1M04A 1FFRA 4ZE4A 4N0RA 5E6YA 3DC0A 2V5DA 2GJRA 1OM0A 4AEFA 3VGGA 2YOCA 1MW0A 1V6XA 2VT0A 3EMCA 2OSYA 2ZX9A 2NW0A 1GQLA 1HMUA 3PBGA 5GQBA 3W6MA 4M29A 4C7GA 4D1IA 1J12A 1LQ0A 3AHTA 1UQYA 4W84A 4UFMA 1S46A 1K9TA 2GSJA 3TP4A 2D20A 5BXTA 3VGFA 2WZHA 3OA5A 4JFWA 1HMWA 5BRQA 4MDPA 4AD2A 1ZJBA 3QOKA 1EGUA 4UQDA 1W2VA 4CUCA 2DSWA 1EA9C 3WD1A 2QF8A 2CCRA 1QOXA 1H5VA 8A3HA 4PMYA 1TVPA 3CIVA 4XZWA 2A3HA 2CHNA 1GHSA 2DPEA 1TG7A 5A2AA 2E3ZA 1K6AA 3W53A 1BLIA 1BVNP 4DWSA 2Q1FA 4XX6A 1UKTA 3KEHA 3GDBA 2ZUUA 3PZOA 3UR8A 3VGEA 4EKJA 4PEEA 1N82A 4AIOA 2BXYA 1HX0A 1WNOA 2UY3A 4IPNB 1UQZA 2WSPA 4E8CA 3L2LA 1W1PA 4ACYA 4Z2LA 3D3AA 3FHAA 1I75A 1CIUA 2Z1KA 3VINA 2WMHA 3CPUA 3F4VA 2J7EA 3VD4A 1PBGA 4PRWA 7TAAA 3AMDA 3WFLA 5ABFB 2ZUNA 5ABFA 2BRVX 1UH3A 5E6ZA 1CGYA 2XPKA 3WEMA 1LJYA 2X05A 1KB3A 1MQQA 4P8VA 4R5EA 1XH1A 5FL1A 3WQ4A 1EIBA 1HVQA 4WIWA 3FXYA 4UFLA 2VQTA 3CO4A 1U2YA 4MB3A 3SUUA 1WZKA 1WDRA 1GOOA 1MW2A 3QHMA 2ZX6A 4FLQA 1X1JA 2V3GA 2IXUA 1E4LA 4JKKA 4J3TA 4W8BA 2EPNA 2ZOXA 1OD8A 1VEMA 4PSRA 1V0KA 3POCA 1KGXA 4U5IA 1GOIA 1UD3A 3ALGA 4CVUA 4RE4A 1JZ8A 3T0AA 4MNMA 2V3FA 1QHOA 5ABGA 3VIGA 2EBNA 2GUYA 4HMCA 1UR8A 2W67A 3JUGA 3WIJA 3ARWA 1KBBA 1KXHA 2CBJA 1E4NA 1GQIA 3BAXA 1RWHA 1HP4A 1CECA 1JDAA 2FHBA 2XFRA 5GNXA 3BSGA 2J7HA 5A2CA 1EO5A 4P7LA 2V5CA 4PTXA 1OGSA 5ECUA 2PI6A 5IFPA 1VIWA 5AY7A 1E56A 4UOJA 1UD4A 1V02A 1H41A 2FHFA 3CZJA 1PZ3A 3OGSA 1V6YA 1OGGA 4KGJA 4TOQA 1DWIM 1BAGA 1EO7A 1YQ2A 1QNPA 1V3KA 1I1WA 1V3HA 4JIEA 4Z2GA 1HKKA 2VX5A 1UWIA 2W62A 3B9DA 4B9ZA 5ABHA 3WF2A 1D3CA 1VFMA 2D2OA 3AHYA 4M81A 1UYQA 3GBEA 2W92A 3DYMA 3AIWA 1P6WA 2XGIA 3SCOA 1TVNA 3VD3A 3WH8A 3AIUA 4U3CA 4OZOA 3MV11 1HJUA 3OLEA 1RPKA 2XSBA 4AYSA 1KWGA 2GK1B 1OIFA 3SEPA 4UTFA 2ZIDA 3NJ3A 1B90A 3UCQA 5A69A 3U5YA 3CZEA 1UR9A 2VURA 4MNLA 2B31A 2VQUA 2ZUVA 3L4UA 3RM4A 3WF1A 4JCMA 2YL8A 4AZGA 4GO9A 3GXDA 3T08A 3ZJKA 1AVAA 2J4GA 1V6UA 4YHEA 5AYIA 1H3GA 3FY1A 3BH4A 1JZ6A 1TCMA 4V2XA 3EDDA 3MO4A 3UR7A 3WQVA 2DSUA 2ZXBA 3CMGA 3ZR6A 4TTUA 3CHEA 1VBUA 3NSMA 4J27A 1EHAA 1WKYA 3W25A 4ZFMA 1GJUA 4UOZA 4CGTA 2UY4A 2OWCA 1XV8A 4MADA 4Z2KA 2J8FA 4UFJA 4J7RA 4X0VA 1KR0A 3MUZ1 4MDOA 4U5KA 1VEOA 3WF0A 3GH4A 4GKLA 3VGDA 3GNOA 1KGUA 1B3ZA 3NYDA 4YHGA 3PN8A 2BHYA 3UG5A 2G41A 4AD4A 1BVZA 4CU7A 3U7BA 1WZMA 1E0XA 4W85A 1VBRA 4CD5A 1QNRA 3N12A 1W3HA 3PTQA 1OJNA 3M6DA 3SCPA 1UA3A 1XC6A 2XYLA 3ARXA 5E09A 4PMQA 4B3LA 1E0VA 3SUTA 1AQHA 1TMQA 4PMUA 1CLVA 3PZNA 1VFFA 3SUWA 4W86A 2CERA 4CU6A 4H8HA 2XIBA 3GM8A 1WZLA 4HP5A 3BCFA 2YLLA 3AMGA 5A95A 1Q6EA 3RILA 5LA1A 3BAJA 3UG3A 3TTSA 5D9MA 3ZJ8A 2PWFA 4QCEA 1AMYA 3DECA 1W32A 4ZE5A 4JL2A 1JD9A 4HZ6A 4AD0A 1A3HA 4U31A 2G8ZA 1GUVA 2WNWA 1E5JA 1JZ4A 1GNXA 1KR1A 4AZ7A 2C0HA 2YDSA 3WUBA 5A6MA 1J9YA 2W61A 1E1FA 4TUFA 2J79A 2QLYA 2EJ1A 3VNZA 1J0JA 1JNEA 2D23A 1LXKA 3UG4A 2YDRA 2XIIA 3A4AA 1US3A 1DHKA 2BY0A 5FL0A 3A3HA 3L4TA 1OGBA 1R86A 3OGVA 2IXVA 4W7UA 5JIWA 3KE0A 1LL7A 1F4HA 3EDJA 1H2JA 2J77A 1J01A 3AROA 2UY2A 3WKZA 2Y8VA 2CESA 1E0WA 3BLKA 4OIFA 2VZVA 1GHRA 4LQ1A 3BMVA 1VAHA 2WC4A 3VDCA 2EPKX 5DMYA 1M53A 2UWFA 5HOSA 6TAAA 3K8MA 2V3EA 4QLJA 2EPMX 4TVCA 3VD5A 1V6VA 3BCDA 3GYCA 1GORA 2CEQA 3OZPA 3BLPX 5IDIA 3AXHA 3OLDA 3IAPA 2XVNA 1CXLA 1DWAM 1SR0A 3WH5A 7A3HA 1CXEA 3WDQA 3VD7A 3T09A 2QMKA 3WDPP 1OCQA 1BYDA 4MPKA 2WVVB 4TVDA 3TA9A 2ZUMA 1UKSA 4QP0A 1XSIA 1V6WA 2WCGA 1NWUA 5CZKA 5FKYA 2VCCA 4H7VA 2PWDA 1GOMA 4PTWA 2WHLA 4PCSA 2D22A 3L4VA 3UESA 1VFUA 1PZ2A 1N7QA 5A6BA 1W9VA 1CGTA 1GVYA 1UG6A 4K68A 1XD0A 3OZOA 1EQCA 1F1SA 1E9LA 5I23A 2WHMA 1J0YA 1VF8A 1VENA 1E15A 1JFHA 3RJYA 3WH7A 4D71A 4HA4A 3RPMA 2UY5A 3GH7A 4Z2IA 3FNDA 3VUPA 4J3SA 1HJXA 1N7NA 2BY1A 2D3LA 1LXMA 2DSVA 1LG1A 1ZU8A 2AOSA 5CPTA 1VB9A 2J7FA 4CD8A 1HJWA 3WY1A 4GPNA 4AZHA 4CN4A 2QV4A 2O92A 3AIEA 3PZGA 3ZOAA 9CGTA 1UR1A 3MUIA 3UEQA 3BAWA 5DFAA 4PBGA 2BVYA 1QI2A 4N42A 2ZICA 1J0KA 1W1TA 1HM2A 5DF0A 3SUVA 1Q6FA 3WL0A 2JIEA 4W7VA 1ZBVA 3LPPA 3CLWA 1XRVA 1UD5A 4EANA 4GZEA 4GXPA 4HZ8A 4H8VA 2DDXA 4CD4A 3WEOA 4AZBA 2WLZA 3N18A 3VMPA 2WVVA 5IXEA 3WEZA 3CUJA 3ZQ9A 3S6TA 2DT0A 2VX4A 1CYGA 1FH8A 1CWYA 3CTTA 4UQCA 3WDRA 1QBBA 4HMEA 4JFVA 3WMCA 1E43A 4KMQA 2IUZA 1V0NA 2GVYA 5HBFA 2DIJA 1J10A 1TFVA 2BY2A 1XYFA 1LLOA 2XM1A 3A6OA 4OBSA 2CNCA 4FLRA 3CZLA 1XH0A 4PMZA 4Q7NA 1EDTA 1UKPA 1XCWA 3PZ9A 1V3IA 1BF2A 5M03A 4OKDA 3WQ8A 2WDAA 2DIEA 1Q6CA 2BVDA 4TVUA 4MB5A 1R7AA 1DWJM 2JFEX 1QI0A 3WNLA 5AC4A 3AFBA 3NDYA 1E6NA 4MAVA 4EK7A 1QHZA 1MXGA 2BRWA 3EYPA 4AD1A 4JHOA 5AC5A 1XSJA 3RO8A 1WAWA 2CITA 3M07A 1JI1A 4QAWA 2E9BA 3FW6A 1HVXA 1HKMA 4D6HA 2J78A 4F8XA 3O6AA 1H1NA 1ECEA 2J8GA 1UWQA 3PZMA 3VIJA 4BQ2A 5A6JA 5E9AA 1TR1A 4M82A 5I78A 3NSXA 4HOXA 1NM9A 2CBVA 3CHDA 4W5ZA 3VOCA 4CU8A 2E0PA 2DSKA 1GOWA 2PWHA 1DWFM 3WF3A 4D6GA 1E72M 1GQKA 1NOUA 1V03A 1W91A 1ISVA 2WC3A 2J62A 3M46A 1YHTA 4JFTA 5GNZA 3PZIA 4WSJA 3LPGA 3WQ5A 1E73M 5CLWA 1W1VA 3AS3A 4PUEA 3WD0A 4W89A 1R85A 4J3UA 2HISA 3AS0A 3AMCA 4AZ5A 5A8PA 3AIBA 1HKJA 3WQWA 3VX1A 3WNOA 4DWSC 4E4PA 3WMBA 5M5DA 1UZ1A 1HP5A 1XGZA 1V3LA 3LPFA 2GJXA 4GZJA 2DT2A 3ARQA 2VR4A 1LG2A 1WE5A 2OLHA 4YPJA 1WPCA 1EDGA 5BXRA 1L8NA 2WVSA 2VRJA 4PYSA 2W63A 2C8NA 1ISZA 4AIUA 3GNPA 2D24A 4WKAA 4QCFA 3W28A 2CBUA 3K1DA 4HPGA 4LXFA 3FHQA 1UWSA 1V3MA 3CUFA 1EOMA 3CH9A 3VIOA 1XHGA 2OYMA 3W26A 4M24A 4MAZA 4MNKA 3OG2A 2E22A 1F4AA 1QI5A 5I24A 5BCAA 1OIMA 4U2ZA 2TAAA 5A3HA 1KGWA 2BXZA 1CBGA 2DEPA 1G94A 2Y2WA 1W9BM 2BFGA 1JXKA 3CZ8A 4J3XA 3WD2A 1CGUA 3UERA 1RP9A 2OYLA 1LWJA 3WELA 5KEZA 2WC7A 1NH6A 3ZSSA 3VIPA 3CUIA 2VVSA 4D1JA 1KFWA 2D0FA 1NWTA 2J75A 5E70A 1W3KA 4HMDA 1IZJA 4JL1A 4UQEA 2XVLA 3HJEA 3RCNA 1UUQA 1B1YA 2Y5EA 3WFZA 5FCZA 2FH6A 3L4ZA 3IJ9A 1UD8A 3HN3A 2WLYA 4GIAA 1OT2A 1OWQA 2JE8A 5DO8A 1KCKA 4GZIA 4JAWA 4BA0A 1UD6A 4OJYA 2VC9A 2YL5A 2ZX8A 3MMDA 1E6RA 3N11A 3RDKA 3ARVA 1OT1A 4PCTA 1D2KA 1C90A 3M7SA 1ISWA 2EXOA 3VILA 3W6LA 2NT1A 2XWEA 1AQMA 1JG9A 1U30A 1MQPA 4H2CA 3ZJ6A 4JFSA 4XUYA 3W29A 1QI4A 3TTOA 4OOUA 4HPHA 1ODZA 3KZSA 4PMDA 1V0MA 4WKHA 4HU0A 4CN1A 1RWCA 1UH4A 1OJOA 1PPIA 2OWWA 2WBKA 4NF7A 5FD0A 3VIFA 1F9GA 1VEPA 2EPOA 2VR5A 2XFFA 1FH9A 1E40A 3SCNA 1OJPA 4D6DA 3WD4A 2WHKA 3ZR5A 1TA3A 3D5HA 1TA3B 3N15A 3N04A 3WH6A 1Z32X 3L2MA 4J3WA 1V02E 3E1F1 3SCRA 1UA7A 1CLXA 1JF6A 4ZEPA 4LYQA 1SYTA 1NWSA 1MXDA 1KXQA 3RM9A 3SCWA 4PMVA 1W2PA 3W38A 1ZJAA 3BXWA 3TTQA 1E55A 5BXPA 3AICA 4XB3A 2QHAA 1JYNA 3FN9A 2J7GA 4NRSA 2CPUA 5HXMA 3OLGA 3ECQA 1QBAA 4CD7A 4DWSB 4P8XA 3ARYA 4HOWA 1JYVA 2ESCA 5D9NA 4B9YA 2A3AA 4MB1A 8CGTA 1UWTA 1HJSA 1R8LA 2VZTA 4LGXA 1GOQA 4JCLA 1G0CA 1QNSA 4UNIA 2CHOA 4QFUA 3VPLA 5IHRA 1WDPA 1MW3A 4D6IA 1KQZA 3I3BA 5DT7A 3WNNA 3HMCA 5I0DA 1E5NA 4MJ4A 3W37A 2CETA 1EOKA 5D8WA 4ACZB 1SMDA 1M01A 3RIKA 1UD2A 3NIYA 1E70M 5CLTA 3WNMA 4DM2A 3K4DA 3W27A 1CGXA 4PUDA 4CN6A 2FGZA 4NSBA 2VRKA 3WBEA 1H11A 3MSDA 4E8DA 5DT5A 3LPOA 5C8BB 2DQXA 5A6KA 4F9DA 5F7UA 2Y8KA 2XVKA 3WUEA 1JFXA 2XTKA 1EGZA 3A47A 4C7FA 3NCOA 2XHYA 4C7DA 3PZQA 2ZWYA 5CXPA 1C91A 2J7CA 2YA2A 4D6FA 1O7AA 5BYWA 1B30A 3VO0A 5I6SA 3MSGA 1ZS2A 4CKQA 5ABEA 3ZMRA 3TONA 3MMWA 3POHA 2WANA 4W5UA 1BFNA 1K9FA 1ZBKA 2O9TA 1HJQA 5M17A 3VTRA 3VGBA 3AIQA 2WCAA 3B8SA 4MJ2A 4UFKA 2X0YA 1JDDA 1JI2A 1QI3A 5BRPA 2BHZA 4WSKA 3S2CA 3AZTA 2WVUA 1NP2A 2VJXA 1JYWA 4QLKA 5BROA 1W1YA 3KL0A 1H0IA 3DHPA 4UQ9A 3WSUA 1A47A 3A4XA 1LL4A 5A8MA 1JNDA 1V0LA 3FAXA 2QPUA 2CBIA 2WKGA 4FMVA 4W88A 1Q4NX 5A2BA 5JUVA 1L0PA 3SURA 2XVGA 4QLLA 1X1NA 4FF5A 4Z2JA 2XJ7A 2PB1A 4BS0A 1MYRA 1X6LA 1ZB5A 4EAMA 1CZ1A 2OSWA 2FGLA 3MKKA 3TOPA 1H0GA 1CXHA 2EO7A 1JF5A 1ITCA 4AC1X 5CQ1A 3EMQA 5HPOA 4PN2A 5I5RA 3EDEA 1CXFA 3CZGA 1EHNA 1TZ7A 2WKLA 3I3DA 4U2YA 3RMEA 1R87A 1W9XA 3BAIA 3N9KA 4AEEA 1SMAA 5HNNA 5E0FA 4GI6A 2VZOA 4PMNA 3PTKA 4W8AA 5A8OA 2CYGA 1HL8A 5EFDA 4WJXA 3ZSTA 1OBAA 4PTMA 1CXKA 2YJQA 5EBAA 3SCTA 1KXVA 2FDMA 4URIA 1OD0A 1LL6A 4FLOA 4Q22A 1BYAA 2VNCA 4UOQA 2CKRA 3WH9A 1RD6A 1GQJA 1G1YA 1XYZA 3IK2A 2GDVA 2PC8A 3GTNA 3EDKA 3ARZA 2WB5A 4ZXOA 1JYXA 5CPQA 2A3CA 3U5UA 3AMKA 4HU8A 4BQ5A 5JBEA 2CIPA 3GNRA 2WMIA 4AW7A 2WMJA 1C92A 3DHUA 3AIRA 4PMRA 1UKOA 4E2OA 4BQ3A 1G5AA 4XZBA 4CVWA 1B9ZA 4V28A 2J74A 1GCYA 1C8XA 4B16A 4PMOA 1WB0A 4FK9A 4F9JA 3II1A 2EPLX 5A8NA 1CTNA 4PTVA 2F61A 3VDAA 3ZO9A 2MANA 3RJXA 4GINA 2GFTA 1J11A 1H49A 1UHVA 1ESWA 5D4YA 3PHAA 3CMJA 2G3MA 1FOBA 4H41A 1MW1A 1WDQA 4WLCA 3ARSA 4D6JA 4L4OA 1HNYA 1OB0A 3J7HA 3A4WA 3AXIA 4HA1A 5AYBA 2BY3A 1JDCA 4ATLA 4JKLA 1M03A 3VMOA 1H09A 1C82A 3G6MA 1R7OA 1E4IA 2J7DA 2YBUA 3CHFA 4U3AA 2W5FA 1I8QA 1XH2A 3THCA 5DEZA 3QOMA 3MUAA 4UQBA 4X0NA 4KH2A 2J47A 2JEQA 4ACZA 2WVTA 4GI8A 3NDZA 3OBAA 2JF7A 2WMFA 1PX4A 2WBGA 2VVNA 1ODUA 4P8UA 5EB8A 5EMYA 4CCEA 1FFQA 3L4XA 3WMSA 3N13A 3VKKA 3GZAA 3VIHA 1MQRA 1W3YA 3AYRA 4TX6A 5KZ6A 2G4FA 1FH7A 2VMFA 4KRUA 1JAKA 3N17A 1UOKA 4JKMA 1ISXA 3VD9A 1B31A 2C7FA 2G3JA 3QHOA 4H8UA 1E3ZA 4RL3A 2BS9A 3OIHA 1TUXA 3MU7A 2VZSA 3B9EA 3ARTA 4UR9A 5C70A 2DH3A 3AYSA 4BQ4A 1LF1A 3GXMA 1QHPA 1HJVA 2OSXA 4WF7A 2Y24A 1XD1A 2O9PA 3CGTA 2VL4A 5BWFA 2GDUA 2PBOA 1IV8A 1VFOA 4JZ5A 2YLAA 2E9LA 4QDMA 2BVTA 3T2OA 2WAGA 3O2LA 3WENA 1CEOA 1TE1A 1OINA 2WPGA 3W4RA 1EH9A 2BHUA 3BC9A 1UWUA 3THDA 2JIWA 1HXJA 5A6AA 3PZUA 2YL6A 1KWKA 3K4AA 5FOOA 2WHJA 4B3KA 2VRQA 5CG0A 4IM4A 2CXGA 1UR4A 1E6QM 1JZ2A 1NOFA 4ML4A 4NI3A 3ZT6A 3SCVA 4M80A 3BSHA 1GZJA 3W82A 3VGHA 5D9OA 1OSEA 2JF6A 2E24A 1J0ZA 2Q8XA 4WKFA 5E0CA 4JHZA 3U7VA 1WP6A 3BAKA 3VM7A 1Q6DA 1E6XM 1QNOA 3K8KA 1O6IA 3MUY1 3VIKA 3VVGA 1HM3A 2A3EA 2WCOA 5GNYA 4MB4A 1Y7VA 1BG9A 4TX8A 1C93A 1CXIA 1HL9A 1BHGA 4KGLA 2YDQA 1NOWA 4IPLA 2ZXAA 2WW5A 1IZKA 2WK2A 1MWOA 3LMYA 4R27A 1JXJA 5IFTA 3GBDA 4DUVA 3WUGA 4HTYA 3ZT7A 1I1XA 1EXPA 2DSZA 5I2UA 2BNJA 2OWXA 1UR2A 2FHCA 1E6SM 2PWGA 4DWSD 3N1AA 1WDSA 4Z2HA 1RW9A 1MFVA 1QNQA 3MS8A 1BYBA 4J3VA 4S3KA 3K8LA 4AWEA 2VI0A 2ZXQA 5D9PA 1FP9A 2XSAA 2O9OA 4W93A 1KBKA 3WF4A 4AZCA 2WCSA 2PWEA 3MMUA 2A3BA 3NUKA 5A94A 1N7PA 2WMIB 4MNJA 3U57A 1C8YA 3VIIA 2ZX7A 4P7RA 7CGTA 4HA3A 4D72A 1HN0A 1OJMA 3AS1A 3WDIA 4AZ6A 1E3XA 1UZ4A 2VX7A 4S3JA 1C3FA 2ZUSA 1X6NA 4M56A 5GPRA 3UETA 1UH2A 1V3JA 4PMXA 1FHDA 4AZCB 1RWGA 2ZWZA 4OBRA 1W9PA 1K9DA 5A6LA 1HKIA 1X1HA 4UQAA 1CPUA 3WBAA 3HU7A 3T0DA 2D0GA 4D6CA 1DTUA 1U33A 3CUHA 4UZSA 3KL3A 1CDGA 1LWHA 2YA0A 1RP8A 1WCGA 3W24A 2WM0A 2ZUWA 3IANA 2VTFA 1B3YA 4AY1A 5A6SA 1KQYA 2XFYA 3BAYA 1UWRA 3AIVA 4KWUA 1C7SA 1W9DM 3AHZA 3DYOA 1CNVA 2VO5A 5CSUA 5LA0A 2XM2A 1DWGM 4P7OA 1GVIA 1E4MM 2F8QA 1BQCA 1RH9A 2ZE0A 2BV9A 3PTMA 4GQQA 4OUEA 3T2QA 3VM5A 4GQRA 5CPSA 1DWHM 4A3HA 2XWDA 3WUFA 1Q6GA 1B2YA 4WK9A 3VX0A 4AIEA 2QPSA 1NQ6A 3ARUA 1IT0A 3VIMA 4BZYA 4AD3A 5JBDA 3RM8A 4RE3A 1E71M 2WWDA 2BRPA 1B3XA 3WNPA 5HPCA 2E8YA 1UR0A 1JZ3A 3WDJA 2W4XA 1W3JA 1CGWA 4LPCA 2ZX5A 3AJ7A 4GI9A 4GO8A 5CSYA 3W0KA 3EMZA 3WL1A 4A3YA 1JIBA 1PX8A 3VDBA 2GJXB 4ZENA 1N7OA 1PEZA 2J25A 3K46A 3AI0A 2AAAA 4W8LA 3AOFA 1J0NA 2NSXA 2AMGA 3OB8A 1NARA 5BXSA 3QR3A 2JEPA 1X1IA 2Y4SA 1HIZA 2VX6A 1GJWA 1CENA 1PX3A 1QW9A 5CGMA 3F5JA 1K9EA 4TXEA 4EE9A 4V27A 2DH2A 4X9YA 1PAMA 4HOZA 2D1ZA 1BYCA 4KRTA 2W66A 4IUGA 1WZAA 1CGVA 3AQUA 3FAWA 4D6EA 1BG4A 4UCFA 2VCAA 3OGRA 2YIHA 1W9UA 3IJ8A 5D8ZA 1BTCA 5I79A 1EQPA 3IJ7A 1RWFA 1JAEA 2DGAA 4HZ7A 3PZVA 5FIPA 1HT6A 3ZJ7A 3MANA 3APGA 4JFUA 2V38A 4YN5A 1N7RA 1XCXA 3I3EA 2G3NA 2DT1A 3QHNA 1NP0A 2WSKA 2WZEA 5A1AA 2VUYA 3L4YA 4LX4A 3T2PA 4M8UA 1B0IA 4ZXLA 2Z1SA 3AISA 1BGAA 4P7QA 1MFUA 2ZUTA 4W87A 4TTGA 2WMKA 2RGMA 2CKSA 1MVYA 2GK1A 1KXTA 1PJ9A 2XVPA 2V3DA 4BF7A 4DUXA 3AHVA 2EEXA 3T0BA 1ZL1A 2D0HA 5IHSA 3MV01 1C7TA 3VMNA 4H04A 1V08A 2YL9A 1W3LA 4A4AA 4F66A 4UFIA 1J0IA 4XV0A 4CD6A 3GXFA 1JD7A 5CJ5A 5TD4A 1XSKA 2W91A 1ZBCA 4NRRA 4AMCA 3AZSA 3VNYA 1G01A 3QGVA 1DEDA 2X1IA 2VOTA 1H4PA 4BCEA 3WQ6A 5JBFA 2FH8A 1JL8A 3AMLA 3ALFA 3NSNA 3SIMA 2VZUA 4M1RA 3SUSA 2WXDM 4AISA 2OYKA 2YBTA 4RE2A 4UZUA 3B9AA 4ATDA 2E4TA 3CHCA 1J18A 2E40A 5I3DA 4AXNA 1US2A 3W81A 1QPKA 5CGTA 3ARPA 2EQDA 1KCLA 1PIFA 3F5LA 1DP0A 5JIPA 1GONA 4CCCA 1VJZA 2X0HA 4P7NA 3WD3A 3F5KA 1HF6A 3KWXA 3ARRA 3O9NA 3CBWA 1D7FA
chains in the Genus database with same CATH superfamily
2YPIA 4LYRA 1F8IA 1DJXA 1QW8A 5EMKA 2XG9A 5A8QA 2RGLA 4A8NA 2Y89A 1CT5A 4WOZA 2WYSA 1AQ0A 1KM5A 2IPJA 2BGSA 4X2RA 1XIMA 1VRXA 4HCHA 5C9UA 1PYFA 3ZT5A 2O9RA 1JGIA 3CUGA 3AXMA 3QSRA 3GH5A 3VABA 4DJFA 3QLLA 3PB0A 1GT8A 1E6ZA 3CWHA 2F2HA 3CZKA 2ZXDA 2R8WA 3KCJA 2XUCA 4LUJA 2XIJA 3M4HA 1SFSA 2D2GA 3O16A 4IFKB 1OY0A 1OFEA 2G50A 4NZCA 3M0LA 3R6IA 4WJEA 1JPMA 4MY9A 4J2PA 2JALA 2ZA3A 3NXLA 4DAFA 5XIMA 5LYRA 3RLUA 5EL1A 4MG4A 4AZIA 4Q8UA 2PF0A 3AHXA 1UOZA 4QQUA 4L4PA 3I6TA 4BFAA 1VHNA 4HD5A 1QRQA 4IISA 1RJRA 4LS0A 3VU2A 2PBGA 4ADUA 2ODOA 3LCIA 1D3HA 1LP6A 1B3WA 2ZRZA 4Z1CA 1G9HA 3W84A 5A6BD 3WDHA 4AD5A 1W17A 3KUMA 1PWLA 1M04A 4Y9PA 1NF7A 2V5DA 4WGHA 3NVDA 4GXWA 3A12A 2VT0A 2OSYA 3IV8A 3N3TA 4Q8PA 3IGUA 1U1HA 1VP5A 1LQ0A 3AHTA 1UQYA 4ZOCA 4PMJA 3V4BA 2G95A 2VEIA 1O0SA 3VGFA 4A6GA 3STEA 1P0BA 2NV9A 3B0YA 4MDPA 4DO6A 1REQB 3GX9A 3V5CA 4AD2A 1DXFA 3BQ5A 4H9YA 1W2VA 3DGRA 1HL2A 1EA9C 3WD1A 1LQ2A 3MDUA 2GDQA 4NAEA 2CCRA 3V7PA 4UTUA 3O7UA 4RZBA 1C9WA 1X8CA 3EWYA 3CIVA 2CHNA 1GHSA 1TG7A 4YXGA 5A2AA 2E3ZA 1DV7A 3W53A 4QEHA 1UKTA 2CHRA 3GDBA 3TTEA 2OU4A 3VGEA 4EKJA 1N82A 1P0NA 3ITXA 4AX7A 2ALRA 2UY3A 2WM1A 4IPNB 4KESA 3WFAA 4ACYA 3VINA 3CPUA 1R5YA 1IIGA 1BXCA 3AMDA 5LHEA 2ZUNA 2BRVX 1TWDA 1UH3A 4PBFA 1XXXA 1Z8AA 3QC0A 3WEMA 3WX7A 1RK6A 1KB3A 4P8VA 3GNNA 1L6FA 5FL1A 3HGJA 4LUTB 3WQ4A 1HVQA 4WIWA 3FXYA 2VHLA 2VQTA 1N8FA 1LM1A 4LUSB 1GOOA 3U3HA 3QHMA 4JTRA 2ALDA 4JKKA 3REQA 5EBUA 4XISA 3W75A 2ZOXA 3SW6A 4QJ1A 3DESA 4PSRA 3POCA 1KGXA 4U5IA 1GOIA 1GWJA 1PZ0A 4CVUA 1O94A 2X1TA 1UPPA 5D33A 4HMCA 4S23A 4XWUA 2W67A 3JUGA 2INZA 2DQWA 1KBBA 4IH3A 3UVIA 4GABA 3H4WA 2WJFA 3B0UX 1RWHA 1CECA 1H62A 3C5QA 1P6BA 4B91A 3IUIA 4R88A 1W31A 2GPTA 1IR2A 2GZXA 2J7HA 2PWVA 3GHTA 2R1MA 5A2CA 4P7LA 3L66A 5HJYA 5ECUA 2PI6A 5HANA 1MDLA 3DG7A 3TX9A 1VIWA 5F4XA 1V02A 2FHFA 4KGJA 1DWIM 4ZCWA 1A50A 1V3HA 1ZTVA 3XISA 5HWMA 1SZEA 4JTKA 3L21A 6REQA 1HKKA 2YFNA 4XG1A 2XIMA 1VFMA 2D2OA 4ADSA 4QXIA 1R9YA 3QMSA 1P6WA 2XGIA 1TVNA 4ROPA 1A80A 4MF4A 4OGZA 4JTEA 1V51A 3OLEA 4AYSA 1OIFA 3SEPA 3KRBA 4YU1A 3E0FA 1XIIA 2O0TA 1B90A 2EG7A 4CQ9A 3CZEA 3CAVA 1GVQA 2VQUA 2HPMA 2PGRA 2ZUVA 1XGEA 3WF1A 1KFJA 4JTUA 4C1LA 2TRSA 3TXZA 4HGXA 3UR7A 3WQVA 4FEZA 3TYBA 3ZR6A 4EACA 4YMZA 5K9DA 5IDZA 4TTUA 4ZOEA 2REQB 5C9ZA 2OO0A 4J27A 3RK8A 4O1FA 1LLZA 3NPWA 2OWCA 4F0MA 4Z2KA 1DIOA 3EWUA 4NJJA 1M68A 4MDOA 4CNPA 3CT2A 4GACA 3WF0A 3GDLA 3GH4A 1QO2A 1T7LA 5U7SA 3QQ1A 2QT3A 2SFPA 1B3ZA 3NYDA 4GYPA 4YHGA 3E0WA 2BHYA 2G41A 4V1YA 3FV9A 2NQLA 3D46A 3MP4A 1E0XA 3HJZA 4CD5A 4JICA 5CG7A 3PTQA 5HQLA 3SCPA 3VZZA 3LG3A 4H6RA 2XYLA 3ARXA 3LXBA 4O53A 3CL7A 4GBDA 3SUTA 2BXVA 3MTWA 4PMUA 3TQPA 1KKRA 1F6KA 2E6FA 5CSRA 1E9IA 4H6KA 1VFFA 3SUWA 2CERA 4CU6A 1A49A 4H8HA 2RHGA 1SSDA 4WGXA 3AMGA 4HA0A 3URBA 4MWAB 2HE5A 2QVNA 3NFUA 5D9MA 4MIMA 2NVCA 2DZTA 1AMYA 1XLLA 5LGXA 4JL2A 4AD0A 1JZ4A 4KCWA 2QCNA 3LX9A 4O1BA 4LF1A 2QLYA 4LY4A 1JNEA 1S39A 1UBPC 1CB7B 1LXKA 3M47A 1UW9A 2XIIA 4IFOA 4Y96A 3A4AA 1US3A 1DHKA 3NYZA 1OGBA 1ONEA 2IXVA 1LL7A 1F4HA 5J04A 3JS3A 1H2JA 2P3EA 2UZ9A 4MHBA 4A22A 2UY2A 4JTQA 2FYMA 2Y8VA 2CESA 3V0SA 1VAHA 2Q8ZA 2WC4A 3S1XA 2VGBA 3WMLA 2I5GA 3SBFA 4HNUA 2ZZ2A 2VC7A 1TPC1 2EPMX 1FKWA 2QCFA 5D04C 1V6VA 5DRCA 3GYCA 3BLPX 3MUCA 5IDIA 3AXHA 5DLCA 4ZSTA 2F84A 3IAPA 3WH5A 4C6NA 4UUIA 1SPQA 1OCQA 3QV6A 1ZENA 2IPWA 3NDOA 1I0DA 1NWUA 1H1ZA 3GU9A 5H8UA 3UP8A 4TO8A 2VCCA 4H7VA 1GOMA 4XZNX 3L4VA 3UESA 4ML9A 1IIHA 1X98A 1VFUA 3ANUA 4FXFA 3NGJA 4S2BA 1PZ2A 3PF3A 5A6BA 3UZJA 2BDQA 3LN3A 3EA1A 3M44A 5I23A 2A5HA 1VENA 3P61A 2F7FA 1YXDA 4D71A 4HA4A 3RPMA 2UY5A 2WNQA 3AO0A 4NXSA 2RJHA 1A5LC 3SQLA 2ZZ7A 3VKCA 2AOSA 4HT3A 5FF3A 4XBJA 2RKXA 4CD8A 3WLMA 4GK8A 1NIUA 4AZHA 4CN4A 1GGOA 3W1TA 3AIEA 3PZGA 5DFAA 3K30A 2BVYA 2R82A 1CLKA 2F2KA 3OU8A 4N4QA 1BWKA 3WLRA 3L5MA 4IQEA 3DAQA 1KA9F 4WD0A 4YVXA 1HM2A 3O05A 3SUVA 3VAVA 3WLLA 4A2SA 2GSHA 3GVQA 1ICSA 3CLWA 5G2WA 3QR8A 3EOSA 3EAUA 4H8VA 2DDXA 9RUBA 1W5PA 2WLZA 2J9ZA 4KT2A 2X7VA 2YYTA 4ZO7A 1ZHAA 2VM8A 3ANVA 2VX4A 5D37A 5MF5A 1CYGA 5I02A 1CWYA 3GNXA 4UQCA 4N9BA 3PC0A 5C2CA 3DG3A 4JFVA 5C9XA 5I09A 1J79A 1FWNA 2Y7DA 1XKJA 2PDHA 2BY2A 1TFVA 4HSHA 4RNHA 2Z2BA 1Y65A 1HG3A 2ZTKA 3U2ZA 4XTDA 1XH0A 3CUZA 1EDTA 5AYZA 2X41A 2WDAA 1FDYA 2DIEA 2XH4A 4GISA 4Q8MA 4YVPA 3KAOA 2H8ZA 3AFBA 1NJJA 4MAVA 3UJFA 1XM3A 3NA8A 1MEHA 3V1HA 5AC5A 4G7FA 5BNKA 1XL9A 5GJNA 1QJWA 4QAWA 4D6HA 2J78A 4F8XA 3V36A 1HGWA 1FWFC 3O6AA 3A24A 2YW3A 5D2XA 3PZMA 4ZQOA 5E9AA 3IK4A 2QCMA 5I78A 3NSXA 1NM9A 2CBVA 3PJWA 3VOCA 2Z1WA 2DIKA 4IL0A 2Y70A 1V03A 4FPSA 3C0LA 5GNZA 3PZIA 3LPGA 3GAKA 5CLWA 4XKMA 1W1VA 4PUEA 5K7JA 1MEWA 1OYBA 4G2DA 1R85A 2H6RA 4J3UA 2F38A 3C2VA 4AZ5A 4GY7A 4OHQA 3VX1A 4LUTA 3TYZA 4EF9A 3W7HA 1AH4A 5EY5A 4CEXC 3T8QA 3R25A 4DWSC 2V82A 5M5DA 3LCGA 1V3LA 1O60A 2GJXA 3ATZA 4BI7A 3BOLA 4YPJA 2ZC8A 4QISA 3ICJA 1L8NA 1SUXA 2WVSA 4MYXA 1MNZA 5AB3A 4JTLA 2X16A 4M6UA 2I1OA 2PGWA 4O12A 1JGMA 4L7ZA 2BGQA 4HK5A 4QCFA 2CLEA 1IEVA 4G8TA 3LHWA 2CBUA 4GIEA 1XG3A 1QWKA 4HPGA 4LXFA 3FHQA 3OODA 2FGBA 3HPZA 1EOMA 1EJSC 1T8XA 4QG9A 4BI6A 3G0XA 4MNKA 3W02A 4KCUA 3QJAA 1F4AA 1OIMA 3ZVHA 1S2CA 2TAAA 2BXZA 2QUVA 1FWIC 1IGWA 2Y2WA 2B4GA 1RAKA 1O12A 3TYCA 1EC7A 1MRAA 3WD2A 2OYLA 3HIJA 3WELA 3ANYA 3W01A 4LBSA 4GBUA 3BOXA 4G56A 1NH6A 3G3DA 2CLOA 3PWIA 4QITA 2ZBTA 3R89A 1KFLA 4EP8C 2WKJA 1X1OA 3WFZA 3W7KA 1B57A 1UD8A 4NYYA 2WLYA 3GFXA 4Z08A 2HSAA 5CH9A 1OT2A 1JCXA 5AECA 5G4WA 2VC9A 2QF7A 4GNKB 1BKHA 2JKEA 1UP0A 3UQNA 4R3UA 4AVNA 1D2KA 2NT1A 2XWEA 3URQA 1MQPA 2HXUA 4XUYA 2Y62A 3PPGA 4H9ZA 5CJNA 2Q01A 3AUOA 1HO1A 3TTOA 4OOUA 4HPHA 1T8QA 1ODZA 4K38A 1AUSL 1RWCA 2V5JA 1EEXA 4PTNA 3QN3A 3JVAA 3EWXA 3O07A 3PULA 4DJDC 3MSRA 4IZGA 2VENA 1OJPA 5F4SA 1QASA 1X8FA 3WD4A 3S2LA 4XBSA 3LEPA 3D5HA 2FKPA 3WH6A 1SFLA 1ADSA 3E96A 4ZQMA 4LV4A 5I3HA 4DF0A 4XKYB 3G8EA 1DJHA 3E0IA 1R3VA 4FF7A 4LYQA 3TNBA 1SYTA 2ZRXA 4B5WA 4S3DA 3TMQA 1TWSA 3KS6A 1W2PA 2QCEA 4R53A 1TWWA 1NF0A 3OBEA 1FWGC 3I7RA 1E55A 3S1UA 4DI8A 4UTHA 1KTBA 3R8GA 3CLMA 3OOQA 4XUGA 4NAFB 3EWZA 2CPUA 5HXMA 2R91A 1TE6A 4HK6A 2O4MA 4DWSB 4P8XA 4HOWA 4A35A 1TJ0A 2ESCA 4B9YA 1OFRA 4Z42C 1PDYA 5E0KA 4MB1A 1UWTA 2C6QA 2J27A 1R8LA 4C6QA 2CHOA 1H63A 3GVWA 4LRTA 1AQFA 1JRCA 3MI6A 4UXDA 5DT7A 5I0DA 2V67A 1Y5XA 2CETA 1VCGA 2ZRUA 4HU4A 4RDVA 4O1DA 4HNCA 3CMFA 1UD2A 3NIYA 4IQDA 1ITQA 4UTKA 3WNMA 2R24A 3ZVIA 4B3ZA 3W27A 4PUDA 3W83A 4CN6A 2QKFA 2G0WA 2VRKA 3WBEA 4H3DA 1H11A 5HWJA 2OELA 4IMEA 5K3VA 5C8BB 4GVHA 4MVAA 1UB3A 3R0UA 3PG8A 1GEQA 4ZO9A 1XS2A 3QZ6A 3WUEA 4MSSA 1EGZA 4Y9NA 1XLIA 4L4MA 4AHPA 2ZWYA 3T40A 2P3ZA 4CNNA 2J7CA 2GGGA 4S3AA 5I6SA 1ZS2A 3GD6A 2HK0A 3VNJA 3MMWA 2WANA 3V3WA 1K9FA 4JQ1A 3AIQA 2VP8A 4JNYA 4H8NA 4WSKA 4I9TA 4B5XA 4GH1A 2GVJA 7PTDA 1XIHA 2WSRA 6ENLA 4LEFA 1E0TA 1S2TA 4A8LA 3S47A 3WSUA 1A47A 1WBJA 1BWLA 1CX9A 1VBHA 1Y0EA 4OBTA 1PTDA 1OHLA 1C9DA 1H7PA 2E1DA 1QO5A 4GUGA 5A2BA 2OX1A 1XIFA 1DYSA 1DXEA 4Z2JA 4QDPA 1SR9A 4DLQA 3TOPA 1VBJA 1Q8JA 3LQLA 2EO7A 1JF5A 1ITCA 2NX3A 1KFBA 5HPOA 5EU9A 4WVXA 1WKDA 2Y85A 3M1ZA 5JMUA 3FIGA 4U2YA 1HKVA 3T81A 5AOUA 4AEEA 1I9CB 2VZOA 2PDPA 3S1GA 2OQYA 2PRMA 1IF2A 2B7PA 2CYGA 3HA1A 3SGUA 3SM0A 1HL8A 1R6WA 4WJXA 4WQ6A 2CC0A 3PBMA 1YX1A 2JKPA 3SCTA 1KXVA 4NVTA 4O13A 1KLYA 2OKTA 1LL6A 3WQEA 4HPNA 1RD6A 1M7JA 1G1YA 4F40A 3IK2A 2GDVA 3FGCA 3EDKA 3RPTA 4ZXOA 4UCGA 4LBUA 3U5UA 3F7JA 1VRAB 1T0OA 1R2TA 3HPXA 2CIPA 2QDEA 4Q8OA 2WMIA 2NXIA 5CZ0A 4JYEA 3DHUA 2QJGA 3AIRA 4PMRA 5FEPA 4W4QA 4E2OA 4BQ3A 3H4GA 3QY7A 1C8VA 3RLVA 4V28A 4A2RA 1J2BA 4QSFA 2HVNA 3E2VA 3M5XA 5FEWA 3VNMA 4X2PA 2EPLX 4JEQA 4PTVA 4C6BA 4LS2A 2MANA 4L65A 4GINA 1J11A 3USBA 3HM7A 1ZPTA 1J6PA 1MW1A 3B9OA 3ARSA 3W2MA 1OB0A 5AYBA 2E25A 3M0IA 5KTLA 2Y63A 3KHDA 2PDYA 1FWDC 1C82A 3G6MA 3RYSA 1R7OA 3CHFA 2W5FA 4JQ2A 1I8QA 1RBOB 3L0KA 5DEZA 3MUAA 5LXXA 1K02A 1A5KC 2I56A 2J47A 1DIEA 4GI8A 1PX4A 2WBGA 2VVNA 3TV8A 3G77A 4H9MA 4CCEA 4FNRA 4JN7A 1FFQA 2I57A 3UZXA 1LDCA 1XYBA 3WMSA 4R7OA 3VKKA 3GZAA 5FSEC 3GB6A 3HG5A 4TX6A 2G4FA 2ISWA 1YLVA 2VMFA 3E9AA 1UOKA 1B31A 1G7UA 4NNAA 2BS9A 5AFDA 4C6PA 3MU7A 3KTXA 3ARTA 3GUGA 4DI9A 4F48A 2QS8A 2DH3A 3W7LA 3AYSA 2QV5A 2NQHA 2INFA 1JDFA 3VC5A 1QHPA 2Y5JA 5D05A 2WZMA 4S3GA 2OSXA 4WF7A 1XD1A 4F4RA 2Q02A 3PUOA 4QX4A 3W86A 4JX6A 2VL4A 3T7VA 2VEFA 3GKFA 2WAGA 2YCJA 1DJNA 3S46A 3FSTA 1EWDA 3A9IA 1TE1A 3UXDA 4F0LA 1RZMA 3W4RA 1EH9A 4AG0A 2QVHA 3THDA 1TO3A 3L5AA 1HXJA 1DHPA 3PJTA 1KWKA 1AW5A 3TSDA 4DLFA 2RDTA 3BCJA 3UWZA 3MMTA 1RR2A 4NI3A 2GGIA 3SCVA 4L61A 3W82A 5D9OA 1OSEA 2DZXA 2YDAA 3NL2A 4LVFA 3OQEA 1BRLA 3VM7A 4LVBA 1E6XM 3G0SA 1O6IA 3TZNA 1XCFA 3VIKA 3VVGA 3GTHA 1HM3A 2WNZA 4BEUA 1BG9A 1C93A 3ITCA 2GLKA 3B06A 3IPWA 3EB2A 1BHGA 4KGLA 3H7VA 1KCXA 1Z3NA 1MUWA 2V5KA 1UIOA 2PDUA 4IICA 2WW5A 1IZKA 4FB7A 4UTWC 1MWOA 3P74A 4Q8TA 3TXVA 3GBDA 1JCLA 5BZAA 3SY8A 2ZE3A 1Y8BA 4DUVA 3TYAA 1B5TA 2PCEA 4BF9A 1NDZA 2Z6JA 4HTYA 3S6DA 1A3WA 1O5RA 1EXPA 2DSZA 4PR4A 1OC6A 3DI0A 2DZPA 2PWGA 3IRDA 4DWSD 2Z27A 4MGGA 4DHGA 4P2VA 4ERGA 3N1AA 1O1HA 3H23A 3IARA 4Z2HA 1RW9A 1EC8A 3QYSA 5DRIA 3K8LA 4LVDA 2XSAA 3VFLA 1G4TA 3R1ZA 5HUOA 3WF4A 2RDUA 2PWEA 2WCSA 3V5FA 3MMUA 1YDYA 4PCPA 3GTIA 1H7RA 2WMIB 4V15A 1AH3A 2Z29A 3P82A 4US5A 4ZQRA 4NKCA 3CQIA 4I7UA 1J5SA 1YTKA 1HN0A 1OJMA 2DUXA 4AZ6A 3MB9A 1UPMB 4M56A 1TJPA 4XVDA 1LOLA 2OOGA 4GMEA 3CB8A 1S2AA 4RK8A 2P0OA 1X1HA 4UQAA 1CPUA 3HU7A 2D0GA 4DXXA 3PK7A 3ITVA 2WNNA 1W3TA 4K8EA 2NV2A 1HUVA 2PDFA 3B0XA 2WM0A 1OZMA 2ZUWA 3W71A 3IANA 3OHIA 4L80A 1B3YA 4BK9A 3BAYA 3AIVA 2QUUA 3DENA 1C7SA 1W9DM 3YPIA 1CNVA 3MP3A 5AYYA 3PBWA 4Y8FA 2XM2A 1GVIA 3CV7A 3VM5A 2BV9A 1M41A 2XH0A 4GQQA 3FYPA 3L12A 4ZR8A 4ZVJA 2OJPA 5G2IA 2XWDA 1LOSA 3F4WA 4WK9A 3CQKA 2Q6ZA 3VX0A 2ZRYA 3ARUA 3Q4DA 3VIMA 5JBDA 4RE3A 2WJEA 1NAL1 5T9CE 3S83A 2ZYFA 3D6NA 1W3JA 4LPCA 3EPMA 4GI9A 4WUIA 1I4NA 1OX4A 3G8RA 3S1VA 1SW0A 1RLDA 1N7OA 2J25A 3AI0A 1ICQA 1XLGA 3O6CA 4W8LA 3AOFA 3OZYA 4RR4A 2NSXA 1ZGDA 4K36A 3U2EA 3GUWA 3QR3A 5CZSA 4OECA 4LCQA 1HIZA 2VX6A 3Q94A 3E74A 3MHGA 4C1KA 1UIPA 3HQNA 4FXSA 2BASA 3LBOA 4KBXA 4TXEA 4EE9A 4X9YA 4HOZA 4DJFD 2D1ZA 2W0UA 4H19A 4KRTA 3FDGA 2W66A 1IWAA 5FJUA 4IUGA 1XFBA 1CGVA 3AQUA 5XIAA 4D6EA 3U0HA 4Y9MA 4DIAA 2YIHA 4C5YA 3WQOA 4GUFA 4HZ7A 2OO6A 2QGYA 3DBNA 1N7RA 1R3TA 3KVLA 2QCDB 2G3NA 2DT1A 1X7FA 2WSKA 2P88A 1RA0A 1NEYA 5A1AA 3PSVA 2VC6A 5TBOA 2X30A 2V0TA 4L64A 4EXQA 3OVPA 4ZQNA 4GVGA 3N2OA 4AWSA 1ME9A 1VFHA 3FJLA 2QUNA 4W87A 3V0TA 4Z17A 2RGMA 4LSBA 2V3DA 4BF7A 4C6IA 2EEXA 1OC5A 1AZ1A 2O4QA 1IGSA 3GC2A 3VMNA 4DNMA 1OF8A 3E0LA 1K8ZA 4O0KA 1LUCA 3PBVA 1J0IA 3LHYA 4XV0A 4D8AA 4IXXA 1JD7A 5CJ5A 4JTHA 3TN6A 1TRIA 1XSKA 3P93A 3ID7A 3UJRA 1Z7AA 4RDYA 1YDOA 2ISDA 1B9BA 3PJXA 3GC5A 3VNYA 4ILSA 1KV8A 1OABA 3WQ6A 5JBFA 2FH8A 1M5WA 2BBFA 2Q3OA 2OODA 1P6CA 4FNQA 1US0A 4IG2B 1Z89A 2VEMA 4O14A 3S6OA 4I5XA 4RE2A 5AHFA 2PP1A 4UZUA 1EA0A 2D69A 2NXGA 2E40A 4XAYA 5I3DA 3BGGA 4K3ZA 4QBXA 1UJPA 3EX4A 3SJ3A 2P10A 2PTDA 2EQDA 4CLMA 3HF3A 3AU6A 1KCLA 1IT8A 1RA5A 1DP0A 1EJVC 1H61A 3V1PA 3NQFA 7REQA 2X0HA 4P7NA 4DEFA 1SZGA 4Q7IA 3KWXA 3O1NA 3MSYA 3WBWA 4TX9A 3S9YA 1VJSA 1WUFA 1NWRA 2VFFA 2BMBA 3LRLA 2XGBA 3WJZA 2YKKA 3IT4B 4M1BA 2HVMA 1CB8A 2XDFA 4RKAA 2NT0A 2I17A 4Q8NA 2ZRWA 1VQTA 4DUWA 1FP8A 3TLLA 5D30A 5U4NA 4ES4A 3OLIA 4GJ1A 1ITXA 4QS6A 4DM1A 2J6VA 3ES8A 3RO6A 4KFNA 3T1GA 2DJXA 2FTYA 3KX6A 5HK4A 3EDFA 5KZEA 1PDZA 3W1AA 5I77A 5C71A 4HHHA 2YX0A 2RUSA 5DBTA 4CCDA 3PZTA 4O15A 5CPNA 2VCBA 1E6PA 1JZ5A 2DT3A 1GOKA 2VYOA 3U48A 3W7IA 5AC8A 2PWUA 2Z2AA 1B3VA 1NU5A 3ZM8A 3CV6A 3WN6A 1KRAC 3QM3A 4GYPC 4IHCA 4K6AA 1PHQA 3BG9A 4FLSA 2FPTA 4XD4A 1FA2A 3TTYA 2X03A 1BPLB 3Q2DA 2HVOA 3C52A 1HN1A 3GE7A 4QJ5B 4F3HA 3PTDA 3UPWA 2I14A 3PM6A 1RSCA 3DC0A 3BJFA 1T40A 2Y61A 1Q7ZA 3PBYA 2GJRA 1OM0A 1MW0A 1ONWA 3W2KA 2PZ0A 2V2HA 2V81A 3UZZA 1GQLA 1HMUA 4OT7A 1QFEA 3STFA 3AC0A 3W6MA 3L2IA 4LAZA 5AYXA 2FFCA 2Y88A 2R1PA 1W5QA 4IIHA 3BG5A 4HNVA 1K9TA 2GSJA 4YLWA 3F4CA 4U10A 4IJBA 1SJBA 5BRQA 3G3MA 2YFOA 1ZJBA 4I9JA 3VE7A 4CUCA 4F0SA 2J24A 2VZKD 5JQ9A 3LB0A 1QOXA 4PMYA 1J96A 1YRRA 1PYMA 1VYRA 4XZWA 4PUJA 5CAHA 2DW6A 1JPDX 3IIPA 1K6AA 3CAWA 1I2NA 1BVNP 2Q1FA 3WQCA 4LAOA 4ZTYA 5I3KA 2ZUUA 3UR8A 4AIOA 3Q37A 1DQUA 1HX0A 1UQZA 5D2TA 3L2LA 2ACUA 4Z2LA 2PRHA 3D3AA 3FHAA 3P8IA 2Z1KA 3I68A 3F4VA 3VD4A 2R9RA 1PBGA 3UY8A 1R3RA 3C86A 5ABFA 5G4HC 1J8VA 3NQCA 1DQWA 4R5EA 3MA8A 2POTA 4YNGA 3GDKA 4UFLA 4MB3A 1WBHA 2BZNA 3OYXA 1S1RA 3LLXA 4LUSA 3LLFA 2VKZG 1IXOA 2ZX6A 2V3GA 5ABTA 1OCNA 1E4LA 4U28A 3U6WA 4J3TA 1PE1A 1JCYA 3CWNA 1GQNA 3NQMA 3T78A 1TV5A 4GQ0A 1L6YA 4MNMA 3G1SA 3LM7A 4GQGA 1QHOA 5ABGA 3C6CA 1UR8A 1A0DA 3WIJA 3ARWA 4LAMA 2CBJA 2C18A 4F2TA 5C55A 1HP4A 3W73A 2NVAA 1JDAA 2FHBA 4H00A 2QCLA 1XLKA 3BSGA 1EO5A 2YYUA 2C1IA 4J2MA 4OUIA 1OGSA 3LGDA 5IFPA 4P61A 3MCMA 1H41A 3LCFA 3CZJA 2VFHA 3GQYA 1OGGA 4TOQA 1BAGA 1I1WA 2Z1VA 4C6MA 2FZDA 2VD9A 4JIEA 5AVNA 1MZHA 2VX5A 1UWIA 4B9ZA 5ABHA 3WF2A 2NUYA 4M19A 2X42A 4M81A 1K70A 3SN4A 3AIWA 4ZB2A 2CLKA 2QJMA 1DBTA 3AIUA 1LBLA 2YXXA 3MV11 3VE9A 1HJUA 4MLJA 4AEOA 3R8RA 3QFWA 2XSBA 1R46A 3BOFA 2PODA 3NJ3A 1PTAA 5A69A 3U5YA 1F6YA 4BF5A 3UT0A 2B31A 3OVGA 3WQDA 5CC6A 3RPDA 2PRLA 4AZGA 3GXDA 4EX4A 2C1GA 3TDFA 2J4GA 4MFDA 5AYIA 4WEVX 1JZ6A 3MO4A 4QE1A 4DJFC 3T6CA 1NFPA 1Q65A 1VS1A 1J93A 1VBUA 4QJ3B 1EHAA 1WKYA 2OZ0A 2GQ8A 5TQLA 1GKPA 3N6HA 4CGTA 5FAJA 3V16A 4ORMA 1UMLA 4DLMA 4J7RA 4X0VA 1KR0A 3QVQA 3DDMA 5H91A 3M0XA 4GKLA 4FNPA 2RH9A 3GNOA 4PC8A 3BLLA 1PTGA 4AD4A 4EWND 1W8SA 1KKOA 3G1RA 4CU7A 4LW7A 3E12A 1XRTA 1VBRA 3LXCA 4MWAA 3F2BA 1W3HA 4DO5A 1JPHA 1ZCOA 3M6DA 5I06A 1ONRA 2PLCA 4NZJA 1AQHA 4TV5A 4YTTA 3L7RA 1EPXA 3G5EA 3GW3A 3C56A 3QMTA 4YJ5A 4H1ZA 1FUYA 3BCFA 4WOQA 1MDRA 1Q6EA 2NUWA 3BW4A 1EZ2A 3TTSA 3ZJ8A 2ZRVA 5MKGA 4QCEA 5DCDA 1W32A 4Q3MA 3TNOA 4ZE5A 4BR1A 1JD9A 1A3HA 2WNWA 1OYCA 1GNXA 1KR1A 4Q4RA 4LRSA 2YDSA 3CB3A 3RR4A 3GIYA 4NHVA 1L6GA 3TR9A 5A6MA 3SAZA 1E1FA 1E1CB 2J79A 4EPDC 4YTRA 2Z4GA 1J0JA 2OEKA 4HBKA 4R34A 5EKYA 4ZSUA 3CO8A 1NQKA 5DY3A 4DBWA 2BY0A 3B9NA 3ABZA 3N2XA 4Q8QA 3LK6A 4Q4SA 1FY6A 3M0HA 2PTZA 3EDJA 4O11A 2J77A 3DCPA 3EKZA 5FJOA 2Z24A 3BLKA 4OVXA 3LGEA 4OIFA 2VZVA 1G7VA 1Q63A 1GHRA 4LQ1A 3LU2A 2HPIA 3IGSA 1JCNA 4H7CA 6TAAA 2WQPA 2V3EA 1FHVA 1EJWC 3RU8X 3M64A 4QS5A 2Z00A 4HU3A 4GCXA 4GHRA 1DWAM 4PRRA 3OVQA 1SR0A 1V6TA 1CXEA 3WDQA 3VD7A 2DVUA 3N9RA 4WDWA 3GKAA 4P5UA 4TVDA 1U5HA 3H55A 1UKSA 4QP0A 1V6WA 5CZKA 3EXRA 1XX1A 4D8OA 3THQA 1YMYA 3P14A 3TROA 3LERA 3UD6A 4DBUA 1N7QA 3B97A 3SRKA 5IM51 3SRDA 1CGTA 1ZJIA 5F2MA 2VEKA 1XD0A 2JGYA 1E9LA 2PSNA 3UR2A 2WHMA 1OJXA 2Z7KA 2QR6A 5F1UA 1TVLA 3LBMA 3JW7A 4Z2IA 5F1VA 1KM2A 4J3SA 4IFRA 1VGAA 2DSVA 3RUBL 5CPTA 3INPA 1A4LA 1HJWA 5LIYX 3WY1A 1OFDA 3LXAA 4UMAA 3ZOAA 9CGTA 1UR1A 3LZ3A 2VELA 3BAWA 3UEQA 4M6VA 2DZBA 3GW0A 3PNZA 5EMJA 4HHPA 4JPGA 4GVFA 3W7DA 1PZ1A 5DXXA 5HUPA 4DZIA 3VXGA 2C16A 3G24A 2JIEA 5CZJA 4W7VA 4F2UA 1XRVA 1W6TA 3B8IA 3TN4A 1UD5A 3P62A 1B4KA 4GZEA 4LTSA 4CD4A 3WEOA 3N18A 1SZFA 5B80A 2WVVA 2PDGA 5IXEA 3CUJA 1QW7A 3TAKA 1DKWA 5KETA 2J88A 4K39A 3WDRA 3MCOA 2V2DA 1XICA 3Q45A 1TTJA 1ZAHA 4KMQA 1V0NA 2DIJA 4CQ8A 1J10A 2VC5A 1EYWA 1XPGA 1N8WA 3KLLA 1TSIA 5L9FA 5KITA 1SFJA 2QAPA 4BY3A 1P7TB 3WYZA 5M03A 1EX5A 1L6WA 1Q8AA 3ORWA 4Y2WA 1Q6CA 5AVHA 4ZB5A 2BVDA 4TVUA 1KM6A 4IL2A 2JFEX 1QI0A 3WNLA 1GG1A 3O0KA 5LIKX 4FR6A 1MXGA 4ZBCA 2BRWA 3E0VA 1YDVA 1KD0A 4AD1A 5B7ZA 2XN1A 2E09A 3RO8A 4NXKA 1WAWA 2PDWA 1JUKA 1F3XA 1H1NA 1PVNA 2J8GA 4IMAA 3W9ZA 4BQ2A 1OK4A 2Y7FA 2IKIA 2HBVA 2Y6ZA 3H2EA 4WRHA 1ELSA 4M82A 4EPBC 2ZDRA 5CEWA 4S3CA 3QXBA 4QE4A 5C5YA 3G2GA 4W5ZA 2D73A 3NEVA 2E0PA 2DSKA 4I6KA 2YEPB 1GVSA 4D6GA 3U9IA 1PO9A 9XIMA 1GQKA 1NOUA 1W91A 2J62A 2O7SA 3SN1A 4JFTA 3LSCA 3PBUA 4WSJA 3WQ5A 1E73M 4JDYA 3AS3A 4JXCA 2KXSA 2PP0A 4W89A 5H8PA 1V7AA 4C6CA 3THAA 3AMCA 2ISFA 3HG2A 5IRPA 4EPEC 5A8PA 1FCBA 3AIBA 1SZRA 2PGEA 2FIQA 3WNOA 3NOEA 4E4PA 3WMBA 1O66A 1UZ1A 1HP5A 1XGZA 4F2BA 4LUYA 2V5LA 4M3PA 2OLHA 1Z9AA 3NG3A 3OG3A 3CU2A 2OG9A 4B2DA 5JVLA 1QK2A 4WDXA 5CBJA 1NFGA 1MXSA 1TV8A 2NSOA 4IIFA 4GCAA 4QJ4B 1PSCA 3K1DA 1V3MA 3CUFA 4V1XA 1W3NA 1JVNA 3QQWA 2CLPA 2OB3A 3W26A 4M24A 2CZ5A 2OGYA 3VNIA 4MAZA 4ENLA 3M9YA 1SU5A 2E22A 3OG2A 3DFTA 1XDMA 2JGQA 3I4EA 5ENLA 5BCAA 1DJZA 4B5NA 5HMDA 1W9BM 2OX4A 4EXBA 1JXKA 2HDJA 4J3XA 4DX3A 3A3XA 1HQTA 3GG7A 4GUHA 3UERA 4ICMA 1FXPA 5C2XA 1VFSA 5KEZA 3VIPA 3CUIA 4JX5A 2VVSA 4D1JA 2RDXA 4C90A 2D0FA 5E70A 1W3KA 2V8ZA 4UB9A 1IZJA 1DL3A 1R3SA 2XVLA 3RCNA 1XYLA 1B1YA 2E1WA 1U83A 2Y5EA 3BANA 4RXFA 3W1MA 1TCDA 3IJ9A 3PFRA 3R0KA 4GIAA 3RRAA 3OVRA 1OWQA 3QW3A 3KBSA 1TZZA 4BA0A 1YE4A 3M5VA 3ABSA 2NQZA 4QTGA 4XBKA 3LS9A 3MKCA 3ARVA 1OT1A 3GVRA 4GX9A 1GKRA 1JQXA 9XIAA 4PCTA 4X60A 4FIRA 3O6DA 5KINA 3M7SA 2GOKA 2EXOA 3W6LA 5AHMA 4PUUA 1AQMA 4PB4A 1JG9A 1UWAA 4GOAA 3VZYA 1MUCA 3NURA 1QI4A 2HK1A 3BWWA 4GXMA 3KZSA 2HXTA 4HU0A 3MZ2A 1UH4A 1OJOA 5D03A 4O16A 1PPIA 2OWWA 4NF7A 4NIRA 3SY5A 5FJRA 1V77A 1F9GA 3K2GA 1VEPA 2CLMA 1Q13A 2C1HA 2XFFA 1V8EA 1U5VA 1QU4A 4A3RA 2VZKB 4D6DA 2QGHA 1WKFA 2YXOA 1TA3A 4O0ZA 1ALDA 3BK0A 1TA3B 5I7GA 4O4WA 1G6CA 1Z32X 3L2MA 3SCRA 4K2SA 3BLOA 3MDWA 1CLXA 5FEXA 1JF6A 2VFDA 1XBVA 4ZEPA 1KBLA 1NWSA 1VH7A 3AYTA 1KXQA 3RM9A 4PMVA 3W38A 1ZJAA 2A2IA 4O57A 5DELA 2FVLA 3M41A 1LT8A 1POJA 1RPXA 1V4YA 2WJDA 3ABOA 4HZMA 3RX3A 1LBFA 4NAFA 2QHAA 3LNPA 3MP5A 1JYNA 2J7GA 4NRSA 1H5YA 4IX2A 3P8JA 3BJTA 4QAIA 3KRSA 1LOQA 3GDRA 1HJSA 3V0UA 4LGXA 4JCLA 1K7EA 2DVTA 4QFUA 3TKFA 3VPLA 4FIQA 5IHRA 1MW3A 4D6IA 3WQGA 1KQZA 2ZA1A 3WNNA 3HMCA 3L23A 4MJ4A 3KBUC 3W37A 4ACZB 1W1B1 1DE6A 2DJLA 3RLHA 3SO7A 4DJDD 2ONEA 2PE4A 4NJIA 1IQ8A 2EKGA 3EA3A 3IIOA 3MSDA 2OCZA 1QOPA 3M0KA 1P48A 2BLEA 5A6KA 2KZHA 5G1MA 3DI1A 3W22A 5CJMA 2XTKA 3A47A 4FSAA 5DY2A 3NCOA 2INEA 1NVMA 3UCDA 4JOMA 5J8LA 5CC5A 4C7DA 3PZQA 3H70A 3TWAA 1B4EA 1H50A 5BYWA 1O7AA 1WOBA 3R4IA 3VO0A 1MZRA 2QJHA 4IMGA 4RNIA 4CKQA 3I4KA 3ZMRA 1C29A 1LORA 3K1GA 3POHA 4Q4QA 1P0DA 4I90A 2DUZA 1BFNA 5M17A 1XYAA 4MJ2A 4UFKA 3P0XA 3PAJA 2X0YA 3K5XA 2HS6A 3R0DA 2BHZA 5I00A 1D8CA 1NP2A 1GVEA 1WXJA 5BROA 5I03A 1TR9A 1W1YA 2BOFX 3N6JA 1H0IA 1F74A 3W1QA 3ERPA 7ODCA 1K03A 1LL4A 5A8MA 1V0LA 3FAXA 4DZAA 1BXBA 1XDJA 1KTNA 4W88A 1Q4NX 5JUVA 3SURA 2XVGA 4QLLA 1X1NA 1H51A 4KEUA 2XJ7A 4BS0A 3DKJA 1R3QA 1CZ1A 2FGLA 5EMMA 3T55A 3B4UA 2UBPC 5CQ1A 3EMQA 2PURA 3QKEA 3FK4A 4Y9AA 4N6FA 3CZGA 1EBGA 1EHNA 1LCOA 3BZJA 3MPGA 3HQPA 4X3ZA 1G4SA 3DEQA 3N9KA 3R94A 1UBSA 1SMAA 5HNNA 5E0FA 3PTKA 2PP3A 5A8OA 1VCFA 4O1CA 1H7NA 4PTMA 2YJQA 1AG1O 2FDMA 4H4IA 4JX4A 3ITTA 3GC4A 2ZTJA 1YPIA 1XLJA 4Q22A 4IP5A 4JYDA 3WH9A 4LALA 4L1WA 4JD4A 2PC8A 2I7GA 1XFCA 3TC6A 8RUCA 3LZ5A 2A3CA 3AMKA 5JBEA 3P6LA 3W1RA 1KM1A 3OIXA 4KQNA 4YCPA 4K37A 5E5CA 1AFSA 3WJYA 3QV7A 3SRFA 1GCYA 3UXAA 4PMOA 1LBMA 2XSXA 4NYUA 3CK5A 2NQJA 3B40A 2BOGX 3ZO9A 3WLJA 3FYOA 1P4CA 3RJXA 3RITA 2GFTA 1H49A 1UHVA 4KWWA 2G3MA 1FOBA 3WQPA 4ERAA 2PC4A 4DBDA 1WDQA 4WLCA 2P8CA 4D6JA 1VFTA 5H2ZA 3AXIA 4ATLA 1OX6A 1UJQA 4JKLA 3W7MA 4L9ZA 1WKEA 2DORA 3VMOA 5HNRA 2YBUA 5K4XA 2J7DA 2PDCA 2J9YA 3IV3A 3FDKA 1V5XA 4JIQA 1EYEA 4YWIA 3R8HA 1FWRA 2TMDA 4KH2A 2JEQA 2WVTA 3OBAA 2JF7A 3W00A 1EKOA 4KEZA 3TFCA 2Y1HA 4C6DA 4BI5A 4TMBA 4NT0A 3L9CA 5C6MA 1YDNA 4PCFA 3HB9A 4GA8A 3NZQA 4DO4A 5KZ6A 4QM1A 3QTGA 4AH7A 3Q67A 3KBWA 4KRUA 3VD9A 1ISXA 1NSJA 2C7FA 2G3JA 3EPNA 3TC3A 1R47A 4XZHA 1BD0A 3GIPA 4FI4A 5C70A 1W5NA 4I5RA 3PNUA 3FKKA 2ON3A 3GXMA 2VGIA 1VLIA 4MKVA 5I3GA 3MYOA 3VKAA 2Y24A 1S3HA 2O9PA 1WOAA 2V4IB 3VNDA 4IFKA 1KFEA 3UD2A 3W7NA 4JZ5A 4LC8A 3O6YX 4QDMA 4PFHA 2VGGA 3HOJA 1I6NA 3FEQA 5A5WA 2WPGA 3A3WA 2BHUA 3BC9A 1UWUA 5HR6A 4RZ4A 5A6AA 1SJAA 2YL6A 4CNTA 3K4AA 1UZHA 3IEBA 3DUGA 2WHJA 4EPKA 1KRCC 1GVFA 1ME7A 4IM4A 2CXGA 1E6QM 4J9JA 4RPQA 1SVDA 4O52A 2JF6A 2E24A 1V79A 1E0UA 1TJ1A 1VYPX 4MFEA 4CCZA 1KRMA 3NPVA 1WP6A 3BAKA 1IT7A 4K7VA 3V18A 2DW7A 3EKLA 3CASA 1Y7VA 1FTXA 3FS2A 4TX8A 2E6DA 4XAGA 1HL9A 3DFPA 1T99A 5F2GA 1Z48A 1WXYA 1UMYA 5BOEA 2D2HA 3KCLA 4PL2A 5CAKA 4DWDA 1FWHC 2WK2A 5FF7A 1JXJA 5G1TA 3MCNA 3GG0A 3W88A 3LM3A 3UWVA 4M6PA 1I1XA 3EEGA 4Z0JA 3H2OA 3LCWA 4AB4A 3KCOA 2PLJA 1UR2A 2FHCA 3TAOA 3URNA 2VUNA 3M7WA 5I3JA 1XP3A 2F6KA 1QNQA 4B5VA 1D8WA 2ZXQA 3C2FA 1DTNA 3H2FA 2O9OA 1DQXA 3W3OA 1NFBA 3LSBA 2OFJA 4RPPA 1KW1A 3HV9A 4MNJA 1VZWA 4O17A 5C7VA 1C8YA 5C2GA 2VFGA 3L0GA 1HO4A 3IJQA 2YZ5A 4LT9A 3AS1A 4FX7A 4PULA 1E3XA 1UZ4A 2XFWA 2IS7A 1ZUAX 1FDJA 1TX0A 3QW4B 3WK1A 2PDJA 3UETA 3WBXA 1XUUA 4AZCB 1XLDA 1W9PA 3TYDA 4LY8A 4D8LA 1RCQA 1BVWA 2CLLA 3BLFA 3T0DA 1O5KA 1K8XA 1XWYA 1U33A 4UZSA 3KL3A 1UC4A 1DJWA 4BJHA 2YW4A 1GKQA 1DOSA 1RP8A 1TYGA 3UWQA 2A7PA 3BSMA 4DJDA 2VTFA 3R7MA 4AY1A 1KQYA 4G5DA 1TPB1 3GZ3A 1MSSA 3UU0A 2A4AA 3LI1A 1QATA 3GRIA 3KP0A 1S5NA 2F8QA 1RH9A 3T2QA 1O5QA 4GQRA 1EJUC 5G1YA 3E2QA 3WUFA 1B2YA 2PCQA 1EP3A 4BZYA 4AD3A 4RDZA 2GUUA 1AK5A 3U8GA 1E71M 2VFIA 2WWDA 4DJEA 1S38A 2E8YA 5JH1A 1FKXA 1V7YA 4HNLA 3WL1A 1PX8A 3O8AA 2O56A 4B5UA 1OK6A 3CQJA 4LBRA 4DXKA 2OXNA 3ZLFA 1W1A1 1IEWA 1VPYA 4IJRA 1K8YA 4ZQCA 3OB8A 1NARA 1OQFA 2JEPA 3W87A 1X1IA 4GYJA 1PX3A 2FZNA 1QW9A 3KBMA 4S3BA 2AL2B 1PAMA 2RDWA 5KMYA 3BG3A 2RAGA 1WZAA 2GGJA 2XN0A 1BG4A 5F2IA 4LOCA 3GFYA 3RFAA 1IXNA 1EJRC 4Q33A 1W9UA 5IBXA 3T8LA 2GVGA 4IQLA 3IJ8A 2BTMA 5D8ZA 1BTCA 2NUXA 1EQPA 1JAEA 3ENLA 2Z1XA 2OMAA 3APGA 4UNLA 2EAWA 1XCXA 2HRWA 3I3EA 2OT0A 4HK7A 4B90A 4XZMX 3CT7A 3QHNA 3C3NA 1NP0A 3I10A 2GWNA 3T2PA 4M8UA 1QK0A 3ES7A 4XQ6A 3S5SA 2Z1SA 2Z2UA 3FXGA 4P7QA 1MFUA 3TCEA 2ZUTA 1FX6A 4X22A 2VDGA 1EBHA 3QYQA 1OFOA 4Q4MA 1YNYA 1MVYA 5I07A 3NQ8A 4DUXA 1OFPA 3T0BA 2D0HA 2I9EA 1V08A 4FALA 4PE8A 4GNJA 4RZ6A 3A23A 3CHVA 1XLFA 3LHZA 4UFIA 3TQVA 3UZWA 3HFYA 1LRNA 1PKMA 3NPXA 3UW6A 4US6A 2W91A 3C2YA 1ZBCA 4NRRA 1EPVA 1UP2A 3BV7A 5BWAA 4AMCA 4JYFA 3B05A 4RV8A 3PVFA 2VOTA 1H4PA 3N4AA 3M6YA 4Y6GA 3BDKA 5FAGA 3NSNA 3S8HA 3OHMB 3RX4A 4ALDA 3O06A 4PGLA 2ISVA 2E4TA 4AXNA 4CNSA 4CNUA 3LCHA 3TW9A 1ENUA 1Y5WA 2FMOA 5LZLA 1QPKA 5CGTA 2G5WA 3NM3A 4O10A 4PZVA 1A53A 1PHWA 3CEUA 3F5LA 4GFSA 3EWDA 3IIZA 3EA2A 4GG9A 2HROA 7REQB 3NQBA 3WD3A 4B2DD 1TJ2A 1KNWA 4M7TA 3AXXA 1GZGA 1PIIA 3GU1A 5K4ZA 2ZDSA 2WMGA 3E6EA 3U2CA 4OOZA 2YCIX 2AL2A 3VOIA 2G3IA 1J0MA 1XYCA 1XGDA 4AFYA 3L4WA 1BGGA 1F05A 2QMJA 4ATWA 4MWAE 3TW7A 3EWCA 3DYPA 4B5TA 2FB3A 3KL5A 2TYSA 3G6LA 3O0FA 1E1EA 4A8RA 1QR7A 3L65A 3SCUA 6CGTA 1RWAA 1L2UA 5EFFA 1QXLA 4UFHA 3GXIA 3QSTA 1KCZA 4C1NA 4L56A 1M7PA 3RRXA 4U33A 3BMWA 2B7QA 2FZBA 2E8ZA 3AS2A 4A21A 3OYZA 1AL8A 2E9MA 5LA2A 1EF2A 5HDRA 2GJPA 1KFCA 2QW5A 6A3HA 4N2YA 1EXBA 2WWCA 2ACQA 3TLQA 4REQB 1X6UA 2X2YA 4A05A 4GGHA 2AQVA 4M7SA 3TZFA 4POCA 3N2BA 4C6JA 1Q7QA 4UTMA 1WXZA 4F79A 3T07A 4D9PA 5HQEA 2WSYA 1UKQA 4J28A 3NQ7A 4XAPA 3HQ1A 1JULA 2X09A 3VYLA 1BSIA 3QTPA 1ZBWA 2GJNA 3AZRA 4PEKA 1QPNA 3UPBA 1FWSA 1V6XA 4ZA0A 5D09A 2ZX9A 4JIRA 2NW0A 1O5XA 1F3EA 3W7QA 4C7GA 3G22A 4G1KA 1J12A 2IPFA 1A5MC 2AKMA 4UFMA 4HVXA 4I9AA 3R12A 3REQB 1S46A 1WYIA 2D20A 4ADTA 5BXTA 1DE5A 1TPDA 3L5LA 1XBXA 5BMWA 1Q5MA 3TR2A 1XC4A 4UQDA 3QOKA 4FP1A 1VCVA 2DSWA 2W6RA 3LNMA 2C0AA 1I45A 3S9IA 4WR3A 1ICPA 1H5VA 1RCOB 1TVPA 6XIAA 1FCQA 1TPH1 3IVSA 2YGYA 4BHYA 2DPEA 4LV9A 2VXNA 1YYAA 1BLIA 3KEHA 1RQBA 2GUBA 5AKQA 3PZOA 1TRDA 4PEEA 1F07A 1E9ZB 2BXYA 1WNOA 3QPZA 2WSPA 3QFEA 4E8CA 1TV7A 1I75A 3EKGA 3NO3A 2WMHA 3QQ0A 3QY6A 2WO5A 2J7EA 1IXPA 3N2CA 7TAAA 3UVAA 2ZA2A 2VFEA 5E6ZA 3ZFHA 1CGYA 2XPKA 3TA6A 1LJYA 2X05A 1MQQA 4IJCA 1XH1A 2BWGA 3BVJA 2PDBA 2OLSA 1EIBA 3W72A 4UR7A 2P0IA 1U2YA 1VKFA 1WZKA 4KF1A 4H2HA 1J5TA 1MW2A 5H1WA 1X1JA 5DANA 1KTCA 2VEPA 3SZ8A 4J40A 4W8BA 2EPNA 1OD8A 1VEMA 3F1QA 2VOMA 1UD3A 2XZ9A 3ALGA 2P1FA 1A4MA 3IS4A 3T0AA 1F76A 1CCWB 3VZXA 4GWEA 2EBNA 2GUYA 2ICSA 2KAUC 1KXHA 4QG8A 4GE8A 5H6HA 4LUIA 3ITGA 4PTXA 1UUOA 4UOJA 1UD4A 1V6YA 3PB2A 1Q2SA 3A5FA 1ZLPA 2P50A 1GYMA 2W62A 3B9DA 4IMFA 1YBQA 2QYGA 4NQ1A 4MJZA 3IVTA 1UYQA 5D2YA 1QNVA 2W92A 3DYMA 1GVOA 3WH8A 3OEXA 4U3CA 7XIMA 3P5ZA 4BKNA 1UASA 1XKYA 3BMXA 1HGYA 1K7XA 1PUDA 3SFKA 4XIMA 2ZIDA 1MRQA 3UCQA 3TQKA 1UR9A 2VURA 4MNLA 1LTDA 3L4UA 4JCMA 2YL8A 3ZLHA 5GVJA 2AAMA 4GO9A 3T08A 3ZJKA 1AVAA 1P0KA 1V6UA 1VBGA 4YHEA 3PPCA 3FY1A 4V2XA 2OT1A 3VI2A 3NOYA 1QUMA 4CEUC 1MI3A 1R2RA 4K8GA 3EOEA 1I0BA 3QPEA 5LNSA 3W25A 4A3UA 4ZFMA 5KZDA 2UY4A 5HINA 1XV8A 3UNDA 4MADA 2EPHA 4DBSA 2J8FA 1I2RA 5LNUA 1BWVA 1VEOA 2FJKA 1XIJA 1Q6QA 3WJWA 3MBDA 1KGUA 3PN8A 3CAQA 1BVZA 4XVEA 3EX3A 2E67A 4GUIA 3U7BA 1WZMA 3H8AA 4Q6JA 1IEXA 1QTWA 1QNRA 3H54A 4YL2A 3ATYA 4S39A 2H3DA 1XC6A 5E09A 3KBTC 4IT1A 4B3LA 1E0VA 3JZEA 1R2SA 1M3UA 5DCBA 4MJMA 2QCHA 4W86A 2XIBA 3GM8A 1WZLA 4HP5A 3JU2A 3RILA 5LA1A 1RV8A 3UG3A 1M6JA 1G69A 1PKYA 2PWFA 3LQGA 3DECA 4FOUA 3W23A 2Y5SA 3C4UA 3UG8A 3QY8A 3FYYA 5L6UA 1EFZA 2NQ9A 4AZ7A 4EXAA 1LLWA 2I5QA 3WUBA 4Z1DA 2W61A 3W7OA 4GLEA 1QPQA 1K1DA 4TUFA 4QNEA 1X7IA 5BU6A 2OEJA 1BKSA 3T9PA 3VNZA 3STGA 1XBZA 2PDKA 2DZSA 2D23A 3AU2A 2FTPA 3W1NA 5FL0A 3L4TA 5T9BG 5JIWA 3KE0A 1SW3A 2A7NA 1J01A 3DXIA 3APTA 3NNTA 1XINA 3WKZA 1E0WA 1P7TA 5LNVA 2J8TA 3BMVA 4OTKA 1EC9A 3VDCA 1DVJA 2EPKX 5DMYA 5HOSA 6PTDA 1SQ7A 3VD5A 3EXTA 5G4EA 3AAMA 4DO7A 1GORA 4PUMA 3LTPA 5FJPA 5DBUA 3QF0A 3OLDA 3E38A 1YXCA 2CLFA 5T26A 3Q58A 4K1WA 5HMFA 4QG6A 7A3HA 2DVXA 4F0RA 2QMKA 1J4EA 3KRZA 3MI2A 1BYDA 2PUZA 4MPKA 1WDWA 2WVVB 3UR5A 2ZUMA 3W70A 3ZWSA 3B4YA 4IIGA 2JKAA 4AWUA 3BUVA 4MMWA 2ZKMX 3MY9A 5FKYA 4H6QA 4IGSA 4PTWA 1FDZA 3SQSA 1Q6OA 2BGNE 5FF4A 2V69A 1UR3M 1W9VA 4K68A 3OPSA 1EQCA 4JTTA 1F1SA 3CIXA 4HJWA 3LGGA 1J0YA 1AW1A 3XINA 1VF8A 2NQ5A 1ZJHA 3EPOA 2X1SA 4HCDA 4HNTA 1ZAIA 3VUPA 3RF9A 2PD9A 2BY1A 1ZRQA 2RFGA 2IKJA 4DN1A 1LG1A 2VEGA 2FZ8A 2J7FA 2B7OA 2HMCA 3QH2A 1W1IE 2E68A 4N6EA 1SO3A 4K8HA 4N9EA 4QDWA 2POZA 2VWSA 4PBGA 4NP7A 1A5OC 1QI2A 1GZ1A 2NX9A 3QLDA 2DZUA 2ZICA 5SWUA 1Q6FA 4GYFA 2DFAA 1YIXA 1Q3NA 4S3EA 4EANA 2PAJA 3FA3A 4HZ8A 2GQ9A 3GXNA 2GGEA 3VMPA 3GK0A 1AJ2A 1NDVA 3WEZA 3A5VA 1MUMA 3FEMA 3S6TA 2DT0A 1FH8A 3CTTA 1H7OA 3L68A 1QBBA 3AALA 4N9CA 1MMFA 2IUZA 3DFQA 5HBFA 3BLDA 4E0CA 1GTHA 4XAZA 1T41A 4IMCA 2XM1A 4OBSA 2CNCA 4I8YA 1S3TC 2QJIA 2G4JA 1UKPA 4NU7A 3URAA 4DRSA 1XCWA 4L9XA 1V3IA 3BLEA 4OKDA 4PL1A 3RHGA 4HYVA 4NI8A 3KVJA 2QZRA 2ABBA 4MB5A 4JBRA 1DWJM 3LHVA 2R1KA 1B3OA 1TPEA 3H53A 3UWUA 5AC4A 3NDYA 1ZSXA 1E6NA 2ABAA 3EYPA 4JHOA 1XSJA 1KV5A 3T4CA 1E1CA 1JPKA 2CITA 1YTEA 1JI1A 4MM1A 2E9BA 1JCTA 3FW6A 1HKMA 1LT7A 4PRTA 3B8WA 3MI3A 4HSOA 4E5TA 1EEPA 4IWWA 3SSJA 3IRSA 1T6MA 2YCEA 1BF6A 3CHDA 1U1UA 5TAOA 3W7RA 4G9PA 1XRFA 4CU8A 3LYEA 1GOWA 2PWHA 1DWFM 3WF3A 1PV8A 1E72M 1AJZA 4ZB0A 3GLCA 2QIWA 2WC3A 3M46A 3KXQA 3O15A 4UWMA 3IWPA 2VR2A 3PQIA 1E51A 2A6NA 1MO0A 2HISA 2Z6IA 1TWIA 4K7YA 2Z1BA 3A22A 3G18A 2PDIA 3C2EA 5AN7A 1HKJA 3OBKA 3WQWA 4FHAA 2DP3A 3LBCA 3AWNA 4Z1AA 3P5YA 3P60A 2OLAA 3S1WA 3LPFA 3GXTA 5T8GA 2VR4A 1ZNNA 4AY8A 1X39A 3A9BA 3DH7A 1A5SA 2QNEA 2VRJA 2X0SA 2RJGA 5CC3A 2W63A 4KEVA 5C9RA 5C7HA 4AIUA 1EUAA 3GNPA 1K3UA 2NZLA 2D24A 5CPOA 1THFD 3W28A 3PUDA 2UV8G 2IQTA 1BSLA 4DYJA 1DJQA 3VIOA 1SO5A 3TVAA 3SRHA 1IYXA 3ZZ1A 4L4LA 4UTTA 2ZZ6A 1ITUA 1CI1A 4QHRA 4C6FA 5I24A 3T42A 4U2ZA 4RXGA 3SDOA 1QPOA 5A3HA 2A6LA 2PGFA 5JH2A 1CBGA 3M0VA 3N29A 2OZ8A 4AXKA 1CB2A 1F61A 1CGUA 1RP9A 2AGTA 1LWJA 5LIXX 5GJPA 3ZSSA 1GOXA 3TN5A 5LIUX 1VPQA 4IF2A 5HNUA 2J75A 3GY1A 4HMDA 3HJEA 1UUQA 3S42A 2PF8A 5LXEA 2NXHA 3QV9A 4IP4A 3GFZA 2FH6A 2QJJA 3S2MA 3L4ZA 4LAKA 5E9XA 4Q4OA 2JE8A 4AMAA 1KCKA 4GZIA