4D6HA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 1 blood group a-tetrasaccharide (e558a x02 mutant)
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
587
structure length
587
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTASYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 219
structure length 587
sequence length 587
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6hA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6hA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6hA02
3VGBA 4D6IA 1Q6CA 5DFAA 1A47A 3ZSTA 4AD4A 2X09A 1ZJBA 4OKDA 4MJ2A 4W89A 2VRQA 1VIWA 1XSIA 3FAWA 4PTWA 4AD2A 5D9OA 3RO8A 2PB1A 1EA9C 4NZCA 1F4AA 2YIHA 1H09A 1CGYA 1EQPA 1UQZA 1HN1A 2HVMA 2ZX7A 4EK7A 1O6IA 5A6MA 1G9HA 3WDHA 4J3TA 3ZJ7A 1B31A 2GVYA 3ZM8A 1R7OA 4V28A 2B31A 5I2UA 5CXPA 2XSBA 1LF1A 3KE0A 1SFSA 5C71A 3ARSA 2FDMA 4FF5A 3ZT7A 1TA3A 2JEPA 1S46A 5A6KA 2A3CA 3WDPP 4JAWA 2RGMA 5JBFA 1JYNA 3WENA 1LG2A 4W8AA 1KR1A 2ZX6A 3AXIA 2PWFA 3RCNA 4YN5A 1XH0A 4H7VA 3AFBA 4URIA 1OIFA 2WWCA 4N42A 1MXGA 4JL1A 1V6YA 2XWDA 4NI3A 4FMVA 4AD3A 4AZCB 2YLAA 4B9ZA 3VUPA 3T0BA 3VDAA 1VFOA 1WPCA 3U5UA 2FGZA 4MPKA 2WKGA 4P7RA 1GOWA 3F5LA 3NUKA 2YLLA 1QI3A 4AZBA 5GNZA 2XWEA 3U7BA 2YL5A 1HMUA 4H8VA 1LG1A 1DP0A 2WZHA 2YA1A 1DWAM 1XD0A 4KRUA 4WJXA 1PX8A 3BAXA 4PBGA 5A2CA 2EXOA 3WNOA 2D3LA 1AQ0A 1HJVA 1LL4A 2ZX5A 4MNMA 1CGVA 4WLCA 3OA5A 3F4VA 4HA4A 4ACZA 1W91A 1V3IA 4PTVA 3WUFA 2FHBA 3QOMA 2WC4A 5FD0A 1RWAA 1DWJM 3WF4A 2WCOA 3NSXA 4JKKA 4MTVA 3FHAA 2PBGA 3WDQA 1NP0A 3T0DA 2E22A 2PWEA 3ARZA 5HBFA 4FK9A 4W84A 1J12A 3GM8A 2FHFA 3WUGA 1C7TA 3TA9A 2JF6A 3ZT5A 2J7FA 3WFLA 3I3EA 1TFVA 4DWSD 3KL3A 4B3LA 3AS3A 1V3HA 2J8FA 1FFQA 3BH4A 2YBTA 1ZL1A 1GW1A 3ZMRA 1JXKA 2FH8A 1MQPA 4BCEA 2X1IA 4AIOA 1H2JA 2EEXA 2J7HA 1UR0A 1PZ3A 1OJPA 3VNYA 3DYOA 4HOZA 3SEPA 5JIWA 1X1JA 5ABFB 5A8QA 5HNNA 2W62A 3ZJKA 1WAWA 1XSKA 4BQ3A 1QHZA 4UQCA 2VRJA 4KGJA 3NIYA 4ZXLA 1DWHM 5M03A 3VNZA 2AAAA 2ZX9A 3SCNA 1GJWA 1UR1A 2JIWA 2XUCA 2DH3A 4GINA 1BTCA 1WZLA 2GDUA 4AISA 2J7BA 2XFYA 3MMWA 4ATLA 2RGLA 4D72A 2D22A 1JG9A 4K68A 2EO7A 3APGA 4D1JA 4QCFA 1BGAA 1E6NA 4F9JA 5I79A 2OSYA 4A4AA 1QNOA 1UR4A 2XVPA 1B2YA 2VUYA 5DO8A 4LPCA 3UERA 3SUVA 1GZJA 2J47A 1HMWA 3WMBA 1ZBCA 3WD0A 1ISVA 1VF8A 3S2CA 1ZB5A 5HOSA 3CH9A 2W63A 4LX4A 4GXPA 1CBGA 2FGLA 3RJYA 1BAGA 2BXYA 2NT0A 5CG0A 1WDRA 1RWCA 2FHCA 1WNOA 2VZOA 2HISA 1NOFA 3AIQA 4GI9A 4D6FA 1I1WA 2GDVA 3ARPA 4KWUA 4W86A 1JZ8A 2WSPA 1XSJA 1UZ1A 3AHZA 3N04A 1E6ZA 1EQCA 3GH4A 3BGAA 3N17A 3N11A 3FW6A 2VL4A 1J0ZA 3BAYA 3PZ9A 1TCMA 2XYLA 1W1PA 4B16A 2VQUA 1ISZA 1JF5A 1XV8A 1DHKA 3W82A 2DEPA 2WC3A 2A3HA 3AMCA 2WHMA 1E5NA 1KB3A 1XCWA 3WNLA 1WDQA 3AHTA 1WP6A 3GBDA 2D0HA 2J4GA 2IXUA 3ZSSA 4C7DA 2BRWA 5A2BA 2VCBA 5ECUA 1D3CA 3BLKA 3VVGA 1QNRA 1A3HA 3CHCA 1HM3A 3GXFA 3VD9A 1TMQA 3VPLA 1R87A 1KBKA 1EOMA 1C92A 5DMYA 2DIJA 3AIRA 1C8QA 1F1SA 4ZFMA 1HNYA 1NH6A 3AOFA 4TX8A 2G4FA 3PZOA 3MV01 1QPKA 1E1EA 4PCTA 1PEZA 3T0AA 1BVNP 3M46A 1V6XA 5HPOA 4UR9A 3WF3A 1J18A 4XZBA 1UR9A 5A6BD 1VAHA 2ZE0A 3AYSA 5I23A 3VGFA 1U2YA 3CHEA 3AS0A 2XJ7A 4Z2JA 3UR7A 4BQ2A 1MYRA 3AIUA 1GHSA 3PZMA 2DSKA 2XPKA 4CD7A 2DH2A 3EDKA 1DWGM 1CDGA 5HXMA 3OBAA 3TTQA 1SMAA 2CITA 1CIUA 1HT6A 3PZNA 1Q6EA 1W32A 2BNJA 4D71A 2EQDA 1BGGA 2DSUA 2DIEA 4Z2HA 4OOZA 5A6SA 1ITXA 3CMJA 3GTNA 2E8ZA 4LXFA 1W3YA 1XGZA 3BSGA 2G3IA 3CUHA 4WK9A 1UH2A 3CIVA 5BXRA 3WQ6A 5AC4A 3WQ8A 2W61A 3E1F1 3JUGA 1J0JA 4HTYA 2NT1A 8A3HA 3GNPA 4U3CA 4PN2A 4J3WA 1FH9A 1U33A 2WVSA 1ECEA 1EO5A 3OGVA 2E24A 1EIBA 4TX6A 2WHJA 1EOKA 3PZIA 4QCEA 3L4XA 1BHGA 2WM0A 1CXEA 5BRQA 1NWUA 4PCSA 1OCQA 1M7XA 1QHOA 4Z2LA 2WMIB 3L4WA 3QHNA 1FOBA 3WF2A 4V2XA 4HP5A 1G1YA 4BF7A 1N7NA 1C93A 4DWSA 1UHVA 4JCLA 1LWJA 3VIMA 3AICA 1F9GA 2WVUA 1PIFA 5M5DA 4Z2GA 1XHGA 1HP4A 4QLJA 5LA2A 1CYGA 5BXTA 4TUFA 3HMCA 4UQAA 3WDIA 1EDQA 4NSBA 3NJ3A 1VFMA 3WBEA 3WDRA 1H5VA 1O7AA 2CBVA 1JZ2A 4H2CA 4HOXA 4CN6A 3FHQA 1HIZA 1W9BM 4MNKA 2EPKX 3II1A 4WIWA 2PWDA 3PZQA 4D6HA 4EAMA 3TTYA 1J10A 3FAXA 2OYKA 1UWIA 4UQ9A 2J8GA 4JFSA 1GHRA 1NOUA 3T08A 4CU6A 2PC8A 3WUEA 3WEMA 1BLIA 1JDDA 1CNVA 4MB5A 2GJRA 2CKRA 2E9BA 1G94A 1AMYA 3T2OA 3A4AA 4GO9A 1CENA 1WE5A 3BCDA 3ECQA 4UCFA 3WL0A 3UETA 4GI6A 3UEQA 2IXVA 4P8UA 2XFRA 3GH5A 2WVTA 1W1VA 3B9DA 4J27A 3LPGA 3VTRA 2MANA 5CPTA 2WVVB 1VBUA 3BSHA 3GNRA 4PMQA 2V38A 1Q6FA 1R8LA 1QBAA 1ODZA 2OSWA 2XM2A 2D23A 2PI6A 1BYAA 2BHYA 2J7EA 4PMDA 3AMKA 4U5KA 3WBAA 4BQ5A 1YQ2A 2J75A 4DUVA 2ZWYA 1JAKA 4OOUA 3VDHA 4JIEA 3G6MA 2CEQA 1HVQA 2E8YA 1GNXA 3D3AA 2CKSA 2NSXA 5FIPA 1B30A 3VGGA 1VENA 1MW1A 3OLEA 2CXGA 3UESA 3ZJ8A 1V6VA 2GK1A 5LYRA 5I77A 1L0PA 4J3XA 8CGTA 1H0IA 2CBIA 1Q4NX 3VIFA 1RWHA 3SUWA 2BV9A 4KGLA 5C70A 3WKZA 5GNXA 1UWRA 1ZBKA 3CUIA 1K9DA 3DECA 3FY1A 2XTKA 3FNDA 3K1DA 2BVDA 4HMDA 2YBUA 1M53A 1CXHA 2WLYA 3MANA 4V27A 5IHSA 4J3SA 1UKQA 1KGXA 2F8QA 1OT2A 1EH9A 5D8ZA 4EANA 1H3GA 4KH2A 4D6EA 4DWSC 4S3KA 4W93A 1EO7A 4PMYA 1W3JA 1CEOA 2G3NA 3L4VA 3W38A 3WSUA 1I8QA 1X6LA 7A3HA 1KQZA 1J0MA 5A95A 5A6BA 1KCKA 2XIBA 4TVDA 3GH7A 2VCCA 3HJEA 1BF2A 4OIFA 3AROA 3AHVA 3VD4A 1E4NA 1UD4A 2VR5A 3NSMA 4CKQA 1IT0A 2XM1A 2CYGA 4P7LA 1KCLA 4UQBA 4TTUA 5TD4A 1QI4A 1Z32X 3THDA 2C8NA 1JAEA 1BVZA 3KZSA 4Z2IA 5CQ1A 3AXXA 4LGXA 1PJ9A 2WBKA 1QI0A 1W1YA 2G3MA 5JBEA 2Z1SA 1C90A 1RP9A 1F4HA 5IDIA 3RMEA 1UD6A 3PTQA 3N9KA 2VX6A 4E4PA 3SURA 1G01A 1EXPA 3K4DA 3BMWA 3U7VA 2X03A 3WQWA 3N15A 4M56A 3M07A 2W4XA 2Y5EA 3ARWA 3AHYA 4JZ5A 5A69A 2QPUA 4AXNA 2Z1KA 3WMSA 2J25A 4M24A 1CGXA 2VJXA 2BRPA 3WQ5A 2WBGA 5AYBA 4UFLA 4TOQA 3MMUA 5BXSA 2E40A 3WF1A 2DDXA 1W3HA 1BQCA 4PMOA 4AZCA 1KGWA 3WNPA 4UNIA 3UG3A 4B15A 1OSEA 3M6DA 4KRTA 1CLXA 2ZUTA 5E0FA 1OINA 3EDFA 4RL3A 3A47A 1E43A 1JFHA 3BAWA 4AZ5A 1GORA 4GKLA 3GNOA 2CBJA 1GQKA 2AMGA 3OB8A 1XRVA 3WNNA 4DUWA 1JGIA 2A3EA 3AI0A 1W9DM 1X1NA 1FP8A 2E4TA 2EJ1A 1B3VA 3ARYA 4JKMA 2UY2A 2UY5A 1YHTA 1B90A 1GJUA 3CZJA 1WB0A 1ESWA 2X2YA 2ZUVA 1BYDA 1UWQA 1JNEA 3SCOA 2DGAA 3A4WA 1B3YA 5E0CA 1W9UA 2X0HA 2BVTA 4F66A 4AD5A 3CMGA 3LPOA 1JDCA 1C82A 1ISYA 4AW7A 5A1AA 1NARA 1W2VA 5BCAA 5IXEA 3NDYA 2W66A 1AQHA 4NRRA 3ALFA 1W9XA 4UQDA 2D2OA 2EPLX 3AS1A 4MADA 1UH4A 3GXDA 3O2LA 2BRVX 1TE1A 1FP9A 3WDJA 3W27A 2OYLA 5E9AA 2O9RA 4LYRA 1E1FA 1ITCA 2WCAA 1UWSA 4X0NA 4MB3A 1P6WA 3N13A 1LWHA 1E6SM 3LPFA 1E4MM 3PZVA 2VT0A 5HDRA 1IZJA 2W67A 4YHEA 3CPUA 3VDBA 1WDPA 3K46A 1QI2A 1XYFA 1OIMA 4B9YA 2DT0A 3MUZ1 2BXZA 5DT5A 5D9NA 2Y4SA 2ZWZA 4PEEA 1W9PA 4LYQA 4ZE5A 2CETA 3ZOAA 1KQYA 5EMYA 5A3HA 3ZIZA 3BLPX 4J3UA 1AQMA 4A3YA 3OIHA 4CCDA 5BROA 1R85A 3VKKA 3SCUA 3T2QA 1E0XA 2VURA 1JYWA 4GI8A 1HM2A 4W85A 2J78A 5BXPA 4W7UA 4WSJA 1E6PA 4CVWA 2XGIA 3DC0A 1GOMA 1FHLA 3DYPA 4L4PA 2CNCA 3POCA 2GUYA 2ESCA 4ACYA 4H8UA 4TVUA 2WMKA 1EHAA 1GOOA 2BY1A 4U33A 1GQJA 1ZBVA 5A8NA 2PF0A 5ABHA 4CN1A 2WHKA 5EBAA 5GQBA 2CCRA 2J7DA 4GQQA 3VIIA 2O9TA 1GUVA 4AD0A 1HX0A 3M7SA 2Y8KA 4RE3A 3WNKA 3L4UA 4W7WA 1MVYA 4HZ7A 3RDKA 2E9MA 4ZEPA 4D1IA 3EDEA 1EGUA 3ZR5A 4S3JA 2WDAA 4OJYA 3SUUA 3WD2A 4CD6A 1MXDA 5A8PA 2WZEA 3CUFA 1OT1A 1ZS2A 4D6GA 1UUQA 2EBNA 1XD1A 2V5CA 2WK2A 1E3XA 5D9PA 4FLQA 1IZKA 1PX3A 2ZXAA 1OBAA 3VOCA 1E56A 4AIEA 3BXWA 1HJUA 5M17A 1V3JA 1M03A 1US3A 7CGTA 4UFIA 4QAWA 4CUCA 2ZX8A 4HZ6A 4W87A 3RJXA 3OZPA 2WHLA 3NDZA 2OWWA 1GQIA 2BY2A 3N1AA 4AYSA 4W5ZA 1K6AA 2CHOA 4MAZA 1OGBA 1GONA 2ZIDA 3BAIA 3MSDA 4U2YA 2WCSA 4U31A 3W26A 3IAPA 3NSNA 2WB5A 3MKKA 1V02E 5F7UA 1KXVA 4CGTA 2F2HA 1NQ6A 2QLYA 3F5JA 3IJ7A 1E40A 5E70A 1V0KA 4HPGA 4WSKA 2WXDM 4HMEA 5FOOA 1BPLB 3CO4A 5IFTA 1JI2A 1CGWA 2VNCA 4H41A 4UFJA 2YJQA 3AHXA 4PRWA 3MUIA 4AY1A 2X05A 4FLSA 2WANA 4BS0A 3PBGA 1V0NA 4PUEA 3L2MA 4PYSA 3CHFA 5DEZA 4U5IA 2VZVA 5D9MA 3CGTA 4GZEA 1RWFA 4YPJA 1H4PA 2CIPA 1HJQA 4PMNA 4E8CA 1HN0A 2YA0A 2W5FA 5LA0A 1ZU8A 3PTKA 5CSUA 2XFFA 3TTSA 1V3KA 4TXEA 1MWOA 3CBWA 1GQLA 1XYZA 4IISA 5I5RA 3QR3A 1FH7A 2VOTA 1E71M 1HF6A 1UR8A 1HP5A 4UFHA 3ARQA 3K8LA 4HA1A 1B0IA 1N7QA 2E0PA 3OG2A 4JHZA 4OZOA 4EE9A 1E15A 1M01A 5ABEA 1QW8A 4R27A 3OLIA 5A94A 2BHUA 1CTNA 5ABGA 4UFMA 1LL6A 3MUAA 4OBSA 5FL0A 3A3HA 2DQXA 1B1YA 1GPFA 1J0YA 4M1RA 1JZ5A 1R7AA 1QI5A 1I1XA 4X9YA 4UFKA 1IV8A 3F5KA 2CBUA 1EHNA 2C7FA 5A6AA 3KEHA 5CPQA 4IPNB 4AZ6A 1V02A 4OUEA 4P7QA 1UKTA 1E4IA 4XB3A 4AC1X 1E5JA 1I75A 2NW0A 2GJXA 1CWYA 1V6WA 3CZGA 4E2OA 1US2A 3QOKA 2WMIA 4J28A 2WCGA 3BAKA 2Q8XA 4MB1A 2YA2A 1JI1A 4HOWA 4H8HA 1WKYA 4TTGA 4D6DA 4JKLA 7TAAA 1KBBA 4JHOA 1X1IA 2VZUA 2JALA 3PHAA 3ARVA 4W5UA 2EPMX 3TP4A 1N7PA 3DYMA 5EFDA 3SCVA 1W1TA 3CTTA 3DHUA 4PTMA 2BHZA 5BRPA 1E6XM 1B9ZA 2WLZA 2WMHA 4JFVA 3VX0A 2G3JA 4JL2A 3AMGA 5AYIA 4JFUA 3A4XA 3VMNA 2WMJA 1PZ2A 1XCXA 1LLOA 1UOKA 4F8XA 1FHDA 4CD4A 2XVKA 3IAQA 1K9TA 2WYSA 2OYMA 2VMFA 4LQ1A 5FKYA 5D8WA 1UD8A 1D2KA 4LYPA 3RILA 3W28A 4C7FA 1UQYA 4DM1A 4CU7A 1E3ZA 2QF8A 3UCQA 2J7GA 9CGTA 5E6YA 1E0WA 2BVYA 5CGTA 3L4TA 3WF0A 1HKMA 2GFTA 3CUGA 3EMZA 3S6TA 1LXMA 3WH8A 3ALGA 1H11A 2CPUA 2CHNA 4MDPA 2WAGA 2GK1B 3VMPA 5I0DA 4PMZA 2QPSA 3B9EA 3IANA 3VIKA 2ZXQA 2JF7A 3EBVA 2Y2WA 4AIUA 1UWTA 2WC7A 3SCRA 4U3AA 3AISA 2ZXBA 1BSIA 1N82A 2ZUMA 4FLOA 2YDRA 3QHOA 3VIJA 2V5DA 1C7SA 2JEQA 2OWXA 2XVGA 5GNYA 3HU7A 1CGTA 2GSJA 3K8MA 1E6RA 2CESA 3GDBA 3VIPA 3HN3A 2QMJA 2Y8VA 4N0RA 4W8LA 3FN9A 3CUJA 2AOSA 2ZUWA 5D4YA 3AYRA 5GPRA 1B3ZA 2DSZA 1RWGA 4XZWA 4Q22A 4M81A 4PSPA 3W0KA 3VIGA 4RE4A 2EPOA 1J0KA 3U5YA 3KL5A 1HJSA 1NP2A 3ZQ9A 4M82A 3WQ4A 1TA3B 1TR1A 1GVYA 4Q7NA 2YL6A 2ZUSA 1KXHA 1W2PA 1OJOA 1MFUA 3WEOA 1KGUA 4AZIA 3TTOA 5CLWA 5HPCA 3LMYA 3EDJA 1H49A 2JIEA 3PTMA 3O9NA 1LQ0A 1J11A 4FLRA 4AWEA 1MW0A 1JL8A 3K4AA 2YL8A 3ZJ6A 1UH3A 1QBBA 1KXQA 3AIBA 2F61A 1WZKA 2TAAA 4P8XA 1JZ3A 3VU2A 1UYQA 4PMUA 4HU0A 2VRKA 4M80A 3SCSA 5I6SA 3AMDA 2V3GA 4J7RA 3VM7A 4AD1A 2QV4A 1KWKA 2BS9A 2XIIA 5JIPA 2J79A 3VDCA 1MW2A 2VZTA 1RD6A 2JE8A 4AMCA 3VIOA 4WKAA 4AEFA 1B3XA 1ZBWA 2XG9A 3CZEA 4HZ8A 1JFXA 1JZ4A 5BWFA 2UWFA 2DSVA 5EFFA 3WH9A 3GBEA 3MO4A 1BG4A 3CLWA 3UG4A 3BC9A 1OD8A 1H1NA 1QW9A 3VINA 1WDSA 2JFEX 4CD8A 3W4RA 3EMQA 1NWTA 1UD3A 1UA7A 2Y24A 1JZ7A 4ACZB 6TAAA 6A3HA 2PBOA 2V3EA 2YDSA 4P7OA 1J0IA 3WMCA 3WFZA 5A2AA 3SCPA 3WN6A 1WZMA 2D0FA 5C8BB 2X0YA 1JDAA 4P8VA 1R86A 3RM4A 6CGTA 1SMDA 3RIKA 3VILA 2QMKA 3BCFA 3VO0A 3NYDA 5KEZA 4L4OA 2C0HA 1C91A 2VQTA 3GZAA 4QFUA 2W91A 1VB9A 5A8MA 1JD7A 1BYBA 1C3FA 3WIJA 1VFFA 1DWFM 3W24A 2A3AA 2VI0A 4MDOA 3PZTA 4HPHA 1WCGA 1CXIA 1W3LA 2VR4A 2VTFA 3J7HA 1E55A 4F79A 5CSYA 1OGSA 1HVXA 5AY7A 1V3MA 3A6OA 4PMRA 1B3WA 3AZRA 4WKFA 2BY0A 1X6NA 5JBDA 1VBRA 2VX7A 2WPGA 2VO5A 1HJXA 4MNLA 5FL1A 2XVNA 1ODUA 4AZ7A 4DM2A 4HMCA 4R5EA 3TONA 4W8BA 4MB4A 1FH8A 4E8DA 2IUZA 3IJ8A 5E09A 3AS2A 3KWXA 3DHPA 4ATDA 3MSGA 4MNJA 1CXFA 1K9EA 2ZICA 4H04A 3WEZA 3GXIA 4M8UA 5ABFA 1JIBA 1UWUA 4BQ4A 1UD2A 3WH7A 3W81A 5DT7A 3PZGA 1MQRA 2J7CA 3RM8A 2G8ZA 4YHGA 1NWSA 2D24A 2YL9A 1VEPA 4BA0A 2G41A 1V6UA 2ZXDA 4IPLA 1CPUA 3VGHA 3B9AA 1N7RA 2XHYA 3N12A 3W25A 5FCZA 1RP8A 1V03A 1CB8A 1LXKA 3W6MA 3ZO9A 1HL9A 2D0GA 2WWDA 4GZIA 4MAVA 2VC9A 2XSAA 4PMXA 1J0HA 1MFVA 1G5AA 1OM0A 2O9PA 4CVUA 2VCAA 1AVAA 4UOJA 3BMVA 1KWGA 1W9VA 1N7OA 4D6JA 1J01A 1OWQA 3WNMA 2D20A 3SCQA 5I3DA 1UG6A 3SIMA 4D6CA 4XX6A 5KZ6A 1OJNA 4XUYA 1EDTA 4GZJA 3U57A 5A6LA 1E0VA 2WNWA 2VX5A 4X0VA 3WD3A 1E72M 4B3KA 1LL7A 2E9LA 3PN8A 1KFWA 1LOHA 3VGDA 1UKOA 5CPSA 1WO2A 4HA3A 1PX4A 1V3LA 3POHA 3VM5A 1GOKA 1H41A 1HKIA 1Q6DA 1HKJA 3WD1A 1Q6GA 4Z2KA 4XV0A 5I24A 4A3HA 1BFNA 1V08A 1HL8A 1DEDA 3CZ8A 1RH9A 3VD3A 2X8RA 2WZIA 1JD9A 3W53A 1Y7VA 4AEEA 4P8WA 3GYCA 1EDGA 1E9LA 1QNSA 4QLLA 5LA1A 3ZT6A 4UZSA 3LPPA 3SCTA 1MW3A 1VJZA 3MUY1 3VGEA 1U30A 1RPKA 4GIAA 1OB0A 3OLDA 1NOWA 4PSRA 3KL0A 2PWGA 3AJ7A 1G0CA 3ARXA 4GQRA 1TVPA 1GCYA 3CZKA 1HKKA 2V3DA 1QVBA 1ISWA 3AIWA 2BY3A 4WF7A 3D5HA 5DF0A 1TVNA 2DT3A 2PWHA 4JCMA 3OGRA 2DSWA 5JUVA 4NF7A 2OWCA 2BFGA 4TVCA 1UKPA 1E73M 1SYTA 2EPNA 1FA2A 3T09A 5E6ZA 1NWRA 1JXJA 3RM9A 5M3WA 1PPIA 1JYVA 1E70M 4F9DA 4PMVA 4AZGA 3MV11 3VD5A 4CN4A 4KMQA 2W92A 4AZHA 1VJSA 1CLVA 3I3BA 4M29A 4ML4A 2O9OA 1E4LA 4PUDA 5CZKA 1ZJAA 3ARTA 3CHDA 4EKJA 4OBRA 2UY3A 1J9YA 1CXLA 3AMLA 3AXHA 2O92A 2UY4A 4Y7EA 1C8XA 3MU7A 3QGVA 4J3VA 1DWIM 1OD0A 1VEMA 3FXYA 3PZUA 5EB8A 3L4ZA 5CGMA 2FH6A 2DT1A 3TOPA 1D7FA 1L8NA 4GPNA 4DUXA 4JFTA 2VVNA 2VX4A 3OGSA 4DWSB 2OLHA 3THCA 2VVSA 3W37A 2V3FA 3NCOA 4CU8A 4ZE4A 1WZAA 2GJXB 1JF6A 5BYWA 4PTXA 5A6JA 1QNPA 1OGGA 5CLTA 3VD7A 3AIEA 1XC6A 2ZUUA 3IK2A 3MS8A 2XVLA 3ARRA 4QDMA 2D1ZA 4MJ4A 3ZR6A 1VFUA 3VX1A 3EYPA 1M04A 3EDDA 2WW5A 1UR2A 3UG5A 2WSKA 1ISXA 3GXMA 1UA3A 2XGBA 3L4YA 3W6LA 4JFWA 4C7GA 3N18A 3SUSA 2J62A 4QP0A 1X1HA 1GOIA 1GVIA 1W3KA 3WELA 1DTUA 1K9FA 2YOCA 2YDQA 3AIVA 3AZTA 2ZUNA 1VRXA 1H0GA 3K8KA 1MQQA 1BYCA 1HJWA 3G6LA 1PIGA 3W29A 5IFPA 3WQVA 4UZUA 3UR8A 2QHAA 3L2LA 1PBGA 2WMFA 3OLGA 3O6AA 5IHRA 5A8OA 1TZ7A 1QOXA 4WKHA 1QHPA 3OZOA 3ARUA 3WY1A 4UQEA 2ZOXA 1OJMA 1NM9A 4CD5A 1JYXA 3EMCA 1TG7A 1JNDA 1E6QM 3WH6A 2Q1FA 2WMGA 3SUTA 1CZ1A 5I78A 1V0MA 4CCCA 4W7VA 3I3DA 3B8SA 3QHMA 1UD5A 1J0NA 1RW9A 2WKLA 3VMOA 4NRSA 4IUGA 2OSXA 1UZ4A 1QNQA 3AZSA 2WVVA 2D3NA 5AC5A 1TUXA 1PAMA 1UKSA 3MMDA 3WH5A 1C8YA 3RPMA 3AQUA 2J77A 3VIHA 4BZYA 4ZENA 4ATWA 4U2ZA 1SR0A 2CERA 3WD4A 2DT2A 1HXJA 4RE2A 1JZ6A 3IJ9A 1CECA 1XH2A 1KXTA 4IM4A 3WL1A 2J74A 1XH1A 1V0LA 4QLKA 2DPEA 3BAJA 4CCEA 1KR0A 1CGUA 4W88A 3SCWA 4ZXOA 3T2PA 4P7NA 4UTFA 1CXKA 1GOQA 5CJ5A 2A3BA 1EGZA 1VEOA 1LJYA 4UOZA 4GO8A 2E3ZA 3WUBA 4UOQA 1BG9A 2YKKA 1FFRA 3CZLA 4HU8A 2VZSA 2GJPA
chains in the Genus database with same CATH superfamily
3UU0A 1B54A 3FFSA 4AD4A 2AL1A 2X09A 2VRQA 3KX6A 1VIWA 3NZ1A 4AHOA 2PB1A 4C6OA 4QIUA 3CXOA 3NXLA 4JX6A 1XBVA 2ZX7A 3CAVA 1N7KA 3EOEA 4J3TA 4PODA 2GVYA 1SPQA 3ZM8A 1DJNA 1H7PA 3MI3A 5I2UA 2XSBA 3KE0A 3VE7A 1SFSA 3ARSA 2FDMA 1UWAA 4FF5A 1KO0A 4C1NB 3PPHA 3WJSA 3TMQA 4DUOA 4US5A 3UG8A 3E3HA 3G0SA 1Z44A 1R3YA 1UMLA 1TPUA 5HUPA 1YTDA 4W8AA 1KR1A 1VCVA 3G0UA 4C5ZA 1XISA 3O7UA 4JTTA 3O06A 1V6YA 2OU4A 3AU2A 4B9ZA 3T0BA 2NQJA 1VFOA 1WPCA 2FTWA 3S1VA 3MI6A 2WKGA 1FTXA 1XLHA 1Y5XA 2ACRA 4JQ1A 1A53A 4O1BA 1ZHAA 4XZLX 4KFOA 4QE4A 5LKYA 5GNZA 2XWEA 1UPMB 1VJIA 2FYMA 2Z2AA 4H8VA 2I56A 3QC0A 3BLFA 4N7QA 3CWOX 4WJ8A 1KNWA 3EOLA 4WJXA 2PCQA 1PX8A 3CL7A 5A2CA 9XIMA 3WNOA 1XUZA 2D3LA 4ZSTA 1KM3A 1LL4A 4MNMA 4IUOA 4PULA 3G3DA 3EA2A 2CWXA 4ACZA 3N14A 4KW2A 3WZ0E 1V3IA 1UZHA 3MZNA 3WUFA 4O1FA 3LTSA 5REQA 2HE5A 1RWAA 1Y65A 5H2ZA 4JKKA 2PBGA 1NP0A 4QHRA 3T0DA 2ZA1A 4DJFC 4G2DA 5HBFA 3HGRA 1UIOA 4B2DD 3SN1A 1J12A 3GM8A 2FHFA 1UMYA 2JF6A 2J7FA 3A9BA 1YPXA 2HNEA 3GG0A 3RR1A 5LNRA 1WYIA 2YBTA 2PAJA 4Q6XA 5FA5A 4Q8TA 2X1IA 1K8ZA 1VGAA 4JQ2A 4A6GA 1MRAA 2Z0IA 4XTIA 1UR0A 1PZ3A 6PTDA 2OG9A 5ABFB 5HNNA 4C6KA 3ZJKA 4GY7A 2NSOA 4KGJA 1TX2A 3H23A 4U4MA 5M03A 2ZX9A 3TJ4A 1WDWA 4AVOA 4GWEA 1GJWA 2XUCA 1EP3A 2DH3A 2H3DA 2I57A 3R79A 4C6LA 4ATLA 5T9CE 2RGLA 2NV9A 3S2MA 2D22A 2DZPA 3MWCA 1XXXA 3A24A 3HGJA 1ECQA 3WCZA 3GNXA 4F9JA 5I79A 4JEQA 4EVZA 1XM3A 1PKMA 4A4AA 1QNOA 3KRSA 1DYSA 1J5SA 3ABZA 1OX4B 1B2YA 5DO8A 1GKRA 3UPMA 5K9DA 3H2AA 2OEJA 1ZBCA 1RZMA 4QM1A 1HKWA 1QPRA 5HOSA 1A49A 5FI8A 1CBGA 1QW7A 2FGLA 4ROQA 2BXYA 2GVLA 2Y5SA 2E68A 1T99A 5K9CA 3EOSA 3EB3A 1NOFA 4GI9A 2ZTJA 4KWUA 2GDVA 4PCNA 3QV7A 3V16A 1UZ1A 4CQBA 2PPGA 3GG8A 1DHPA 3TWAA 4GE8A 1S38A 3NYZA 1QK0A 4L6OA 1NF7A 1W3NA 4N4PA 4RXGA 2XYLA 3DGRA 1ISZA 3LCXA 1F73A 2WC3A 2A3HA 2V4IB 4I9TA 2ISWA 4I3GA 2NVAA 3NFUA 3CL6A 1XCWA 3WNLA 1KKRA 2ZE3A 1Y5VA 3ZSSA 1WBJA 1VC4A 5ECUA 1Z8AA 1QRQA 3BLKA 1QNRA 4GIYA 3RFAA 1C92A 1C8QA 4TX8A 1XINA 2G4FA 1QPKA 1BVNP 2RDWA 1FCQA 3TCEA 1M5WA 1EFZA 5A6BD 2ZE0A 5I23A 1E1CB 2WNZA 2GGIA 3AS0A 4QSHA 1VCFA 4D8ZA 2F2KA 3AIUA 2DSKA 5AYXA 1DWGM 3S2NA 1ZCCA 1HT6A 1Q6EA 4H2HA 2EQDA 2FJUB 4XO6A 2DSUA 3NQEA 2DIEA 1TWDA 3M0KA 4IL2A 1LLQA 1EKOA 3ANUA 5JVLA 4LXFA 1W3YA 2G3IA 4LAOA 3EB2A 4NZ4A 2CLOA 3WQ6A 5AC4A 3GIPA 3NQDA 5D37A 2NT1A 8A3HA 1PKYA 2YCEA 1HKVA 4S39A 1ECEA 1EO5A 5CCZA 1XIFA 4J5NA 4BHYA 4LUSB 3T78A 3DBPA 2XH7A 4MZYA 4N6EA 3AU6A 5BRQA 2P8CA 3RX2A 1W3IA 4I6KA 4N9CA 4PCSA 5E5CA 3S42A 3L4WA 3LK6A 1PIIA 1GVFA 6ENLA 1OFDA 2VGIA 1DXEA 4V2XA 1N7NA 1C93A 4DWSA 2G3FA 3AICA 2WVUA 4HK5A 1QCWA 2HXTA 2XIOA 3NEHA 4G7FA 1IWBA 1FXPA 1XHGA 5G5IA 4DBWA 5PTDA 4GUGA 1H5VA 3TAKA 5I3GA 1S5MA 1W9BM 5ABTA 5C6MA 4MNKA 3MP3A 3PG8A 2PWDA 4WIWA 3PZQA 1ALDA 2GL5A 2ZZ5A 4EAMA 3NQFA 5I07A 3EWUA 1IIHA 2FFCA 4EF8A 3U4AA 1GHRA 4MUPA 3T08A 1S5WA 4CU6A 1AD1A 3TKFA 4LS0A 3WUEA 3WEMA 4C65A 3W71A 1J2BA 2OTDA 1QOQA 3NO3A 2ZRZA 3C56A 3EKGA 1UP2A 3ECQA 1B9BA 3UETA 4P8UA 2WVTA 3B9DA 1C9DA 1JCMP 4J27A 4BY3A 2MANA 3MMTA 4YJ5A 1IWPA 4PMQA 2YCLA 3LGDA 1KFBA 1XWYA 1F8MA 2OSWA 2GJNA 3LBOA 2D23A 4O28A 4PMDA 2BOEX 3E49A 3PSWA 5CEWA 4MWAD 1IT8A 5G4HC 1YQ2A 3T42A 5D2XA 2ZWYA 3VDHA 3WK1A 3CV6A 4LALA 5FACA 3O0FA 3W3OA 3MVTA 2VUNA 4NQ1A 1GNXA 2CKSA 1K6WA 2NSXA 5FIPA 1B30A 3UESA 2E5CA 4L80A 4LOCA 3OJGA 3A5FA 1H0IA 2CBIA 3PUOA 5CH9A 3FEMA 1RWHA 4KGLA 1YKWA 2PD9A 1QTWA 4N02A 3DIPA 1UWRA 4FO4A 1TV4A 4NZJA 3K30A 1EIXA 1K9DA 2HBXA 4TMCA 1BRLA 3M5YA 3FNDA 3QR1A 5TBOA 1W8GA 1NTHA 2BVDA 1HW6A 4MJMA 3P67A 4MKNA 2WLYA 2BWGA 3W2KA 2Z1BA 2V5BA 1KGXA 1OT2A 4L5ZA 1XLBA 5A8GA 4DWSC 2DZWA 4S3KA 3UGRA 1EO7A 3L4VA 3S46A 1I8QA 4EXAA 2JKAA 5A95A 4Y9AA 4TVDA 5AN7A 1YX1A 4YTUA 4LYKA 2YXXA 3AHVA 3R4IA 1G69A 3VD4A 1E4NA 4H01A 4M6QA 3W2NA 2XH2A 3NSMA 4CKQA 1IT0A 2OZ3A 4LC8A 1SW3A 3GG1A 3WG6A 4IMAA 4TV6A 3SJ3A 4DEFA 4ADUA 1QI4A 2FPYA 5F4WA 1GKQA 3TZFA 1JAEA 4GC4A 3AXXA 1AJ2A 4LBRA 4JTIA 4PUUA 3SIZA 5JBEA 1HZYA 4HYVA 4PB5A 1SZNA 3EX1A 1WX0A 4O0QA 3TW7A 2P88A 4D2JA 3PTQA 4Y9NA 4C1NA 1B4EA 3F03K 3U7VA 3M07A 4HSNA 4O17A 1I9CB 3FX4A 4NL1A 3HURA 5HJXA 1H50A 3GY1A 4LAUA 4LY8A 1EYEA 1Z48A 1CGXA 3USZA 3SW6A 4PZVA 2O56A 3UZZA 1BXNA 2R14A 3MDUA 3U3HA 4MWAE 1A5NC 5HMSA 2OCZA 4MYXA 3WNPA 4UNIA 1P43A 1YE4A 2CXEA 2HROA 5E0FA 1YTEA 5LXEA 1OINA 1GVQA 1SJAA 1YNPA 4JGDA 3H21A 4UTKA 5D32A 1GYMA 1GQKA 2AMGA 3OB8A 5EMJA 5AHLA 3FA5A 1M1BA 2HMCA 3ZVHB 3U6WA 1FP8A 1IXQA 3QH2A 3HV8A 4GC3A 1UW9A 2EJ1A 1Y0EA 2UY5A 1KM4A 4S3DA 2PGWA 1ESWA 2ISVA 1GVSA 2WJFA 1FWEC 1JNEA 3SCOA 1B3YA 4F66A 3LPOA 1JDCA 4NU7A 5A1AA 2ZVIA 4MJZA 2V0TA 3NDYA 1AQHA 5DX7A 3ALFA 1FRBA 3P0XA 2VZKB 4FPSA 1OK6A 3R58A 4HZMA 3WDJA 3APYA 3W27A 2OYLA 1QPNA 1Q13A 4WRHA 5G4EA 2NX9A 1ITCA 2ABBA 1UWSA 2WQPA 2QCLA 3LPFA 2VT0A 3VDBA 3NQ2A 1A5CA 1WDPA 4ZB5A 3S1WA 1X96A 2A7RA 1YPFA 3FDKA 5D9NA 3URNA 2PGFA 4ERAA 3F1QA 3LHYA 4PEEA 4GJJA 1RQBA 1PB0A 1KQYA 3MZ2A 5A3HA 3JRKA 2P50A 3CQIA 3VKKA 3ENLA 6REQB 3SCUA 3T2QA 3W07A 4L61A 1W3TA 1MXSA 1SFTA 3C8NA 4W85A 2QVHA 1H63A 5BXPA 1KLZA 4WSJA 3DC0A 3O0KA 3QMTA 4TVUA 1EHAA 1GQJA 1ZBVA 4GH3A 2PF0A 3QF0A 1ZJHA 2C3ZA 3N19B 2O9TA 4AD0A 1HX0A 2IS7A 3L4UA 4W7WA 4IPIA 3S5OA 4Y9MA 2F6XA 1EJ7L 3EDEA 4Y9PA 4IJCA 3ZR5A 2EG6A 1ZP4A 3SUUA 3WD2A 4JIRA 4DO6A 3CUFA 2PFHA 1XLAA 4D6GA 3DN5A 1XD1A 5F4XA 4FLQA 1OBAA 2V69A 1YEYA 3W2JA 5G2HA 1DVJA 4MLJA 4QAWA 4HZ6A 3DFPA 2E28A 3OVQA 4AYSA 3STFA 2CHOA 2MNRA 4MAZA 1O66A 1Z42A 2RDTA 4HSHA 3VYLA 3VNIA 3WBWA 3W26A 2WB5A 3UD1A 4FNTA 2BBFA 2V5LA 1XRTA 1VLIA 1KXVA 4QJ4B 4MKVA 2BODX 2PZNA 3VOJA 1IGSA 1NQ6A 3GDMA 4TIMA 5E70A 5TIMA 1OCNA 1A50A 4HMEA 2TRSA 1JI2A 4FXSA 1EGVA 4H41A 1AK5A 4R7OA 1CB7B 4AY1A 3TNOA 3OA3A 4OGZA 3PBGA 3ITLA 2FMNA 1WKDA 5F2GA 3CHFA 2VXNA 2PRMA 3S3GA 3E0FA 1A4LA 1RWFA 1E1CA 1QXLA 4B92A 3OVRA 4RZ6A 1TJ2A 3S9YA 5CSUA 1Q6LA 4NKCA 1V3KA 1EBHA 4DLMA 1MWOA 1DPMA 1GQLA 4IISA 4KT2A 2QCMA 5I5RA 1FH7A 1L8PA 1CW2A 1HP5A 3ARQA 1TQJA 3FGCB 2E25A 4JHZA 4OZOA 1M65A 1E15A 3CB8A 1MEWA 5BU9A 2YYTA 2DQXA 2ZRYA 3W9ZA 1G7VA 4CQ9A 4DZIA 3T7VA 1QI5A 2QCFA 3HG4A 3ZVIA 1ONWA 3W2UA 1K77A 2C7FA 1XUUA 2EG8A 5CPQA 3HTWA 4HSOA 4OUEA 1UKTA 1ME8A 1E5JA 4G6CA 2NW0A 2IKGA 4KCVA 1US2A 3H4XA 3BAKA 3C2VA 3GVGA 1DE5A 2C19A 4D6DA 3M1ZA 3UXAA 1KBBA 3ZYZA 2JALA 4GJ1A 3PHAA 3DFSA 1R30A 1N7PA 5AC8A 3FKRA 4WUIA 3IT4B 3DHUA 2CLHA 3W75A 3P5YA 3NM1A 5EY5A 1B9ZA 3M0LA 3UJFA 3LXBA 1F6YA 4JL2A 3AMGA 3SGGA 3A4XA 4YVPA 1PZ2A 4DO5A 3S47A 1UOKA 5D38A 3EB4A 2YR1A 4CD4A 3D47A 4IIFA 1K9TA 2WYSA 2OYMA 2G5WA 5D8WA 1JPHA 1D2KA 3ABQA 4B90A 3VAVA 2KZHA 3PUDA 2XN2A 5F2IA 5HNUA 4UTTA 1F3XA 1E3ZA 1U5HA 3TTEA 3VNLA 3SN4A 3BANA 3GU9A 3IRDA 3B8IA 3L4TA 3BO9A 1Z69A 1E51A 4QNEA 3IJLA 4MDPA 3MT1A 2EKGA 2Q8ZA 2V2DA 4LANA 1XJBA 4M6PA 3B9EA 3KOFA 4DHGA 3LU2A 3IANA 1K8XA 3TQVA 3R1ZA 1RV8A 1AJ0A 4Q8VA 1N82A 1UOZA 3W7EA 3NDOA 4FLOA 4DBEA 4FXJA 2OFJA 3BQ5A 3JS3A 3WMLA 3Q65A 1D8CA 3HU7A 3GX9A 3K8MA 3P14A 3UXDA 4N0RA 3KBUC 4KESA 1WXYA 1LOLA 3EOOA 4FR6A 3AYRA 5D33A 4AX7A 1EZWA 3FS2A 4A8LA 1BD0A 4ZO9A 5E93A 1RWGA 4XZWA 1O5XA 4M7TA 4Q22A 2CU0A 4PSPA 3GVQA 3U5YA 1ML1A 1NP2A 2D2HA 5TAOA 4M82A 1TA3B 1R38A 1TR1A 4BEQA 1KLYA 2PD5A 3E5BA 2A2IA 2Z28A 4M7SA 4ZB2A 5DELA 1PXGA 5CLWA 3EDJA 3H7VA 1H49A 1A5MC 4EACA 2YZ5A 4ZCWA 1ME7A 1J11A 4AWEA 3QJAA 3ZJ6A 1UH3A 2ZDRA 1XYBA 2ICSA 2F61A 2TAAA 4P8XA 4PMUA 1ZUAX 3B0XA 4PH6A 1V79A 3T8QA 3KS6A 5I6SA 3UW6A 4QNWA 2W27A 1OADA 3MTWA 3QV8A 2ONEA 2VZTA 4AMCA 1ICQA 4WKAA 1ZBWA 2XG9A 4HZ8A 3RRAA 2IPJA 5BWFA 4NJIA 1W5QA 4HJFA 3TOYA 4UTTC 1S3HA 4S3EA 3VINA 1WDSA 1JUKA 3BG3A 3B8TA 1UA7A 4XKYA 3K13A 3FJ6A 2V3EA 3B97A 3P82A 3WFZA 3WN6A 3CV2A 2X0YA 3GZ3A 1R86A 3RM4A 4HBKA 2QMKA 3GG7A 1EP2A 3E0IA 3VO0A 3KOZA 3KCJA 3SY8A 1H7NA 1A3XA 4QFUA 3C2YA 4F40A 3GC5A 1C3FA 3FEQA 4S23A 3WIJA 4GNKB 3PBWA 1Y5WA 2A3AA 3XINA 3UJ2A 3P74A 4G1NA 4JYEA 3KOWA 4O12A 5CSYA 1OGSA 5AY7A 3TJXA 3TLLA 1I0BA 2QCGA 1B3WA 3I65A 5I06A 5JU6A 2BY0A 1X6NA 4GFIA 1VBRA 3UBPC 1ADOA 2DVXA 1TIWA 4DPPA 3W1PA 3PPGA 4HYWA 4HMCA 3TONA 3T6CA 4DO4A 3ABRA 3NO1A 4MB4A 1FH8A 1SQ7A 4NNBA 1VIZA 4ICNA 3KWXA 2A7NA 5GJNA 8XIMA 1ADDA 3UR5A 3MSGA 4MNJA 3GVRA 1YDNA 3DGBA 3O3RA 4HHMA 2VC7A 3GXIA 3NZRA 4Z08A 1XQLA 1JIBA 2YXOA 4BQ4A 5DT7A 3PZGA 2PDIA 4O14A 1XBZA 4QX4A 4O50A 4M0XA 4YHGA 1TJ0A 2D24A 4H6EA 3UJRA 1LLWA 3MBFA 1XICA 1NFBA 1F3WA 4ZTYA 2PLCA 5FCZA 3H2EA 4G8TA 1V03A 1LXKA 5CC6A 2AQOA 4DY1A 1HL9A 5BOEA 2D0GA 2WWDA 3IV8A 3OW1A 4O16A 1MFVA 2ZRXA 3H7RA 2O9PA 4QSFA 2H6RA 4IX0A 3BLDA 4UOJA 1FDJA 4WJEA 1J01A 1OWQA 1FWDC 4CQAA 3T9PA 2Y61A 2HEJA 3DERA 5I3DA 2GWGA 4XX6A 3W23A 5KZ6A 4XUYA 6REQA 4JX5A 4DYJA 2YFNA 5A6LA 2WNWA 4X0VA 4C6QA 3PN8A 1CLKA 1LROA 3LQLA 1Q2SA 1LBFA 3VGDA 3TN4A 3BDKA 4IICA 1WO2A 4KWOA 4IMDA 4HA3A 1X6UA 4DNMA 4I5XA 1V3LA 1TZ9A 2ZKMX 1YNQA 2C91A 4Q3MA 1GOKA 1O68A 1MI3A 4RLIA 4OQVA 5LNSA 2ATSA 4XZMX 1Q6GA 4XV0A 3S8HA 1A5AA 2VDGA 4F0MA 4A3RA 5HR6A 2QQ6A 1J6OA 1BFNA 4OECA 4HD5A 1RH9A 2OLSA 1I45A 3R0UA 3LBMA 2Z6JA 1SFJA 1E9LA 1IE7C 2X42A 3E96A 4LF2A 3SCTA 2DJLA 1VJZA 1TVLA 2DQWA 3VGEA 1U30A 4LNCA 2H8ZA 3BLOA 1OB0A 3H4WA 2IKIA 4QEHA 3KL0A 7XIMA 2FTYA 3ARXA 1VBGA 1M41A 3W00A 3S1XA 2HK1A 3PFRA 3BLLA 2BY3A 3QMRA 3KTCA 4OE7A 3E9AA 1DJYA 4GACA 2DT3A 2PWHA 2GQAA 3TX9A 3AUOA 2DZBA 4NF7A 2BFGA 1UKPA 1SYTA 3H2NA 1R3VA 4RZ4A 4DXVA 1NWRA 1JYVA 1NFPA 3UZYA 4WDWA 5FJUA 4M51A 3LBCA 1Z6KA 3G3MA 3V1PA 1T40A 4LVFA 3IUHA 4MWAC 4AZHA 1TV5A 2CZFA 1XGDA 3E2VA 4ML4A 4IF2A 1RJRA 1LRQA 1NDZA 3CHDA 4KQNA 2QNEA 3QR0A 1J9YA 3AMLA 2BOFX 3B8VA 3AXHA 3HJZA 4GXMA 3LSCA 3KBMA 4Y7EA 5EB8A 2IW0A 3C2EA 1PV8A 2A5HA 4GPNA 2VENA 1O0SA 4DUXA 2VVNA 1GEHA 1KM2A 3OGSA 5HWMA 4Y6GA 3BGGA 3CK5A 3KRZA 3SGZA 4H6QA 3FGCA 3RGTA 3UY7A 3K2GA 4CU8A 4IIBA 4H9YA 1QNPA 5BMWA 4UTLA 1XC6A 2DVUA 3IK2A 5CPMA 1LOSA 2G95A 4G9PA 4AX6A 3G1VA 4QDMA 3LOTA 2D1ZA 3C2FA 3ISIX 3LSBA 3ZR6A 1VFUA 3BOXA 4WOZA 3EDDA 3UG5A 3BCJA 1UA3A 2Z1VA 3L68A 4C7GA 3FOKA 3SUSA 4KCUA 3OBKA 4GYKA 2VFDA 3NPVA 1EEXA 5AHEA 3E38A 4FNQA 3NQ7A 2NXHA 2YOCA 4IZGA 2OLAA 2YDQA 3AIVA 4GY0A 1D7KA 3O6CA 3LCIA 4QJ5B 3O16A 4JNMA 3DEQA 4EF9A 3W7MA 3TN6A 1PDYA 4O1AA 3WJWA 4XZ9A 3UD2A 2HE8A 3OLGA 2QCCA 3A3XA 3KXQA 2PDHA 3WY1A 5D2VA 1V6TA 4CD5A 4FXRA 4EPDC 4REQB 3EMCA 1JNDA 1W56A 3WH6A 5FEZA 2WMGA 1BWLA 2P1FA 3B8SA 2ZZ2A 2OT1A 1RK6A 1ZNNA 4HPXA 2OSXA 2V8ZA 3AZSA 1XPYA 1RJQA 2WVVA 3TC3A 5AC5A 3O15A 2A4AA 2Y7GA 3R10A 1C8YA 3LHUA 2PU0A 4AWSA 1QWKA 4PRTA 1XF0A 3FA4A 2QUMA 3KTXA 3DKLA 1J8VA 4BZYA 5C5YA 3ANYA 3W1UA 2CERA 4ILSA 2DT2A 4HHLA 2INFA 2YB4A 1JZ6A 3IJ9A 1YXCA 1CECA 1XH2A 3OZMA 4BWLA 2QVNA 2NVDA 3WL1A 1A80A 4GABA 3F4WA 2WNQA 2V63A 3BICA 1CGUA 4O1DA 3KBWA 1VFTA 3GAYA 4FZIA 1MUCA 1TB3A 4UTFA 2GGEA 4XIAA 1EGZA 3P3BA 4N9BA 4GO8A 1D8WA 5I09A 3B9NA 4UOQA 4JYFA 5EKYA 1R9YA 1XIEA 3TA6A 3JVAA 3R7MA 1IEWA 5FAJA 1SO5A 1ZJBA 4OKDA 4RNIA 3U8GA 3PP7A 3NL3A 4PTWA 5T8GA 5D9OA 3RO8A 1WXZA 3B8WA 3TAOA 1OQFA 1EA9C 1IQ8A 1F4AA 2YIHA 3PFMA 1HN1A 2INZA 4JTEA 4XWUA 3H12A 2OODA 2GLKA 3WDHA 1E0TA 4Z1BA 5KITA 1R7OA 4V28A 2B31A 3CQKA 5CXPA 2BASA 3NZQA 3TYZA 4O8AA 1W5NA 2J88A 3ZT7A 4DVOA 4ZB0A 3S83A 3PK7A 4BF5A 1NFGA 1TA3A 2GSEA 2JEPA 1S46A 4R53A 4K37A 5A6KA 3WDPP 4DWDA 2QCNA 3NPUA 3VZZA 1LG2A 3B3DA 1PS9A 2PURA 4KETA 4KPLA 2PWFA 4IPJA 5C9RA 3UWYA 4YN5A 1XH0A 2D2JA 1EX5A 3EPNA 4JL1A 1Q5MA 4NI3A 4K1GA 1LLZA 3IGXA 4AZCB 3D0CA 4I7WA 4JTDA 3RK8A 3LX9A 5GJPA 5EA9A 3RU8X 4G7EB 4O53A 3GE7A 3F5LA 1DTNA 1ZJIA 2YLLA 3U7BA 4QAIA 1LRNA 2XGZA 3W7NA 3S1UA 4L1WA 1XD0A 4KRUA 5HWNA 4XD3A 3C8FA 4ZGYA 3QY8A 3SJNA 5DLCA 3BAXA 1GZ1A 1A0DA 3S5ZA 2EXOA 4ZQNA 2B7OA 3KHJA 2ZX5A 2R94A 2OELA 2G4JA 4HQVA 4OWGA 5AHMA 5EBUA 4F0HA 3ORWA 5CGQA 4AHQA 1W91A 4BWLC 4GCAA 2FHBA 3V3WA 3TW9A 4E5TA 1BXBA 5FD0A 4B5NA 3QRHA 1DWJM 4HPJA 2WCOA 3NSXA 3GNNA 2BGQA 3ITXA 3FHAA 4MTVA 2VEKA 2E22A 3H2OA 3G1SA 4Y8EA 2VDHA 2OQYA 1LP6A 3WLTA 4W84A 4C6MA 3M16A 1C7TA 2AGTA 2QR6A 3ZT5A 3E0WA 4GX8A 3PWAA 1E0UA 1XFBA 3G1AA 3R8GA 2J8FA 1FFQA 3BH4A 3CT2A 1GW1A 1ONRA 1YDOA 2J8TA 3HFYA 4AIOA 5HWJA 1OX6A 3SEPA 4Q4OA 5JIWA 1X1JA 2Q02A 3NQVA 1V4YA 3V5OA 1XSKA 1VZWA 2VRJA 1DJHA 3UT0A 1DWHM 3T0TA 2AAAA 5DRCA 3SCNA 3R12A 4W9TA 2DUXA 3N6JA 1UR1A 1H51A 2VD8A 3HQNA 3MY9A 3EWYA 3MMWA 1FDYA 2W79A 3CHVA 1Q7QA 2BLEA 4D1JA 1G4PA 2EO7A 1E6NA 3GU1A 1SVDA 4O0KA 4FB7A 1UR4A 2XVPA 1RY8A 4LVDA 3W7IA 3SUVA 1GZJA 2J47A 5CZTA 4P5UA 3WD0A 1SSGA 1LORA 2YGYA 2GYIA 1QOPA 1H5YA 3CH9A 1KFEA 4LX4A 3L5LA 5LGZA 3PF3A 4IIEA 1BAGA 2NT0A 3W7HA 3DDMA 2VZOA 3LTPA 3TYBA 3AIQA 3C3NA 3NXFA 1FY6A 1I1WA 3ARPA 4W86A 3RCYA 1ZSXA 3M0JA 5DY3A 3KUMA 4X9SA 4A3QA 2TMDA 3GH4A 2X0SA 3N17A 3N11A 3FW6A 3PZ9A 1W1PA 3VA8A 3IS4A 1M3UA 1RBLA 4B5TA 2PDMA 3LD5A 2B81A 4TMBA 2WHMA 1E5NA 4LJ3A 3QSTA 4GQGA 1WDQA 3IV3A 3V0TA 4B4HA 2D0HA 2CLEA 4FX8A 2AKZA 3PBYA 3UWQA 1PHQA 3CASA 2YCIX 3GXFA 1HM3A 4K38A 2ZQ0A 2R1MA 4P61A 3VD9A 1TMQA 3M0XA 3RO6A 3LHZA 3VZXA 4C6EA 5DMYA 4O1EA 3AIRA 4ZFMA 1NH6A 3AOFA 3H24A 4X60A 5JH2A 3CB3A 2QEZA 1V6XA 1A0CA 2E6FA 3B04A 3KOYA 4GA8A 3WF3A 4S3AA 4O11A 4OU1A 4PUMA 3AYSA 4JXCA 3BW3A 4JTQA 3W7PA 5C55A 1NDYA 4LFYA 4XZHA 3EPOA 4BQ2A 4ZSUA 1PTAA 1H1YA 2XPKA 4CD7A 3EDKA 2XINA 5HXMA 1OFQA 3S5SA 1FWWA 3TTQA 3KOXA 1CIUA 3PAJA 4IFRA 1XYMA 1HGWA 2IQ0A 3O07A 2F38A 3A21A 4Z2HA 1JUEA 5A6SA 1ITXA 3QQ0A 4E3TA 4E38A 2CLMA 3KRUA 3CUHA 1TPDA 1FDZA 1YADA 1VFLA 2Y7FA 1IEQA 2ZA2A 1L9WA 4FIRA 3JUGA 1J0JA 4HTYA 2GPTA 3CEPA 4HK7A 1ZCOA 4PN2A 1KA9F 4DPQA 1I2OA 2E5DA 2WVSA 3W1XA 3LN3A 2E24A 4JPGA 2Q71A 2WHJA 3K5XA 2G50A 1N8WA 4EXBA 1CXEA 3KZPA 1NWUA 4Z2LA 1RHCA 2QJNA 3NQ6A 3MWAA 2Z2BA 2FJKA 1XLEA 4HP5A 3WX7A 4JCLA 3VIMA 1F9GA 4NXKA 3VNJA 1PIFA 5CJNA 4Z2GA 1VFSA 5BNKA 5LA2A 1V51A 4UQAA 4NSBA 3LY0A 3WBEA 4LVAA 3WDRA 2YCJA 1O7AA 1KTBA 2Z6IA 4DZ5A 3LG3A 4DIAA 2DJXA 2FVLA 3II1A 5BRBA 4L6DA 1JCLA 2EGZA 1IYXA 2P0IA 1K7EA 3GRIA 2VHLA 3FAXA 4A22A 1RK5A 2J8GA 1B57A 1J2WA 1NOUA 2XZ7A 5LNWA 4L9XA 3H26A 1BLIA 4C6NA 4MB5A 2GJRA 1XGEA 3H4GA 1TPVA 2E9BA 1IR1A 1IXNA 4UWMA 3T2OA 4A21A 4GO9A 1CENA 3BCDA 2PU1A 3WL0A 4E4FA 4GI6A 1K1DA 1XLMA 3P84A 4ZO7A 4KWWA 4NX5A 1W1VA 3LPGA 2XIQA 3BSHA 3K4WA 3GNRA 3AC0A 2V38A 3NQ8A 3ID7A 1Q6FA 1R8LA 1ZQ5A 1ODZA 3OZYA 3WJXA 1PCKA 3N3MA 2FQIA 1A5OC 4H9UA 4REQA 4ZL1A 4IGHA 3A5VA 1JAKA 2VWTA 4DF1A 4JIEA 5GJMA 2VC5A 3M43A 1SFLA 3VGGA 1VENA 1MW1A 3OLEA 3ZJ8A 5G1TA 3SBFA 2GK1A 3URBA 4NUWA 2RJGA 4KEVA 4IFKB 4LB4A 4LCSA 1M7PA 1Q4NX 3VIFA 4QROA 5C70A 4R34A 5GNXA 2DFAA 3BURA 1R2TA 3EX4A 3FY1A 2QCHA 4BI5A 3K1DA 3T07A 3FVDA 3CWNA 3FVMA 1LRTA 5IHSA 3SI9A 2F8QA 3D46A 3WJYA 5LIWX 2YDAA 5D8ZA 3BJFA 4EANA 3FJNA 2PDPA 4D6EA 4KH2A 1AL8A 3T4WA 4ES4A 5C2CA 1W3JA 3E12A 3W38A 3SR7A 1X6LA 7A3HA 2FB2A 2Z25A 5CC3A 1J0MA 2B0MA 1TJRA 1IXPA 1KCKA 1LBLA 1S3TC 2XIBA 1CX9A 3GH7A 1XYAA 3HJEA 1BF2A 3TZNA 4CNTA 1RAKA 1RA0A 1Q8AA 1LDCA 1EC9A 4UTJA 2VR5A 3UCDA 3EPMA 4AU0A 2TYSA 3ONBA 3C52A 1VPXA 4ZTXA 3HPFA 2X2GA 5TD4A 1GEQA 3THDA 5DY2A 4AG0A 3CO8A 3QLDA 4G5DA 3SO7A 3E6EA 3TEVA 1W1YA 2G3MA 2Z1SA 3NOEA 1L6SA 3U2EA 1RP9A 2PTZA 3DCPA 4G1KA 5IDIA 1UJQA 3RMEA 5K7JA 3N9KA 3T8LA 4DX3A 4E4PA 3SURA 3CJPA 1G01A 1EXPA 4JIIX 1J4EA 2RJHA 3CV1A 3DH7A 1VRAB 1U83A 4M56A 3PPFA 3GTHA 2Y5EA 3AHYA 3GKFA 2Y88A 4Q4SA 4WD0A 2QPUA 2QT3A 3GWQA 1GYLA 3LRMA 4M24A 2VJXA 4ICMA 2WBGA 4IMCA 1J93A 4S2CA 1GTHA 1IEXA 3MMUA 3GU2A 1OFEA 2DDXA 1W3HA 1OF8A 4PMOA 4AZCA 2HXUA 3UG3A 5AB3A 2YYUA 4G7EA 3GC2A 4KRTA 2ZUTA 3BZJA 3OOQA 1PSCA 1X7FA 1OC7A 3EDFA 3A47A 2XH0A 1Z41A 1E43A 1JFHA 4AZ5A 7ODCA 1XRVA 5CC5A 4WSHA 4F0SA 4DUWA 1W9DM 3M41A 3GR8A 2E4TA 1QR7A 4S3FA 1B3VA 2UY2A 3CLMA 5H1WA 1B90A 3CZJA 1WB0A 1ZTVA 2X2YA 2ZUVA 4LCQA 2DGAA 3A4WA 3O8AA 5E0CA 1YXDA 1TCDA 2ZZ3A 4WDXA 2BVTA 1IWAA 2X1SA 3VKAA 4PBEA 4JNZA 1NARA 1L6FA 1FWBC 3Q67A 2W66A 4RZ5A 1OF6A 1W9XA 2D2OA 1LM1A 3AS1A 4MADA 3GXDA 3O2LA 4XISA 2JKEA 5TF0A 1QK2A 1FBAA 4K36A 4ROPA 1YW1A 3QPZA 4R7JA 3EWCA 1E1FA 4LYRA 2WCAA 4X0NA 5C54A 2IKJA 2V82A 1E6SM 1XG3A 3GS6A 3PZVA 1RLCL 3N9SA 3THAA 2W67A 4YHEA 1ELSA 1DIOA 1U22A 1GOXA 3UWEA 4GXWA 2VEMA 2Y4SA 4GYPA 4JTJA 5DN1A 3RX3A 1W9PA 3C0JA 4ZE5A 5EMYA 3ZIZA 1ONEA 3OIHA 4CCDA 1DOSA 4GUFA 2ZTKA 3QM3A 1E0XA 2VURA 5JXQA 4YCOA 3RYSA 4M6UA 4CVWA 4WXZA 3UA3A 2CNCA 3POCA 1JDFA 2GUYA 4XKMA 4H8UA 1Q7ZA 2WMKA 4U33A 4CN1A 4AWTA 4OVXA 2WHKA 5EBAA 5GQBA 3G22A 3M7SA 2Q6ZA 2Y8KA 4FX6M 4RE3A 4AB4A 1W17A 5DBUA 3RDKA 1P0KA 3ITGA 1K02A 3FIGA 4ZEPA 4KWSA 4S3JA 2WDAA 3DG3A 1AD4A 2WZEA 1EL3A 4J2PA 3N4FA 5A8PA 4UTUA 4DJED 1ZS2A 2EBNA 2V5CA 1E3XA 1PX3A 4KIRA 3WBYA 4AIEA 1US3A 3LLDA 2MUCA 4UFIA 5K4ZA 2ZX8A 3OZPA 4KRZA 2WHLA 3W72A 3GFZA 3M0MA 3MKCA 3DHFA 4AUBA 4S3CA 2BY2A 4W5ZA 1K6AA 3A22A 2PLKA 3W70A 4IIHA 3MSDA 4ZVJA 5M2FX 1T6MA 5F7UA 2P5NA 2OEKA 4WCJA 3KCLA 2F2HA 2QLYA 3F5JA 4IH3A 2P3ZA 1V0KA 4B91A 2FFIA 2WXDM 5FOOA 1JEZA 1BPLB 4K8HA 3CO4A 5IFTA 4H6KA 5HMDA 6XIAA 1CGWA 2VNCA 1EJTC 1BWKA 4UFJA 4PRWA 1QPOA 4TQTA 2QUTA 3SY1A 4GFSA 3HGSA 4BS0A 4I90A 4Q32A 4BFAA 3L2MA 5KZEA 2RAGA 5DEZA 4MZ1A 4U5IA 4H9VA 4GZEA 3B4UA 4LUIA 1SZFA 2CIPA 4GK8A 4Q6JA 5LIXX 3TR9A 2W5FA 2WNNA 3LCGA 5LA0A 4C90A 4DYKA 4GYPC 5FEXA 1WXJA 1P1MA 1UR8A 5T9BG 2CHRA 1XIHA 1JPKA 1HO4A 1B0IA 5ABEA 4FALA 5DCBA 5A94A 4E2DA 2DZXA 2BHUA 3WO8A 3EX2A 5ABGA 4R9OA 1LL6A 1H62A 1QWGA 3A3HA 1B1YA 1GPFA 1M9HA 1J0YA 3EWXA 1NDWA 2PDYA 1JJKA 4LAKA 5A6AA 1UP3A 1X38A 5CSSA 4E0CA 1MZHA 2Q8LA 1F8IA 1DXFA 1V02A 3H2CA 1GGOA 3IIXA 4AC1X 1VYPX 1M6JA 2GJXA 4DI8A 2NX1A 3U2OA 4K6AA 3WK0A 4HNLA 3QOKA 4Q4QA 4J28A 1U1UA 3VXGA 1SZGA 2QZRA 4LVBA 1JI1A 2OJPA 4TTGA 1YLVA 4AXKA 3QYSA 4JHOA 3MP5A 2EPMX 3BG9A 3M5XA 3UR2A 3TWBA 3BW4A 4Q4KA 1W1TA 2I17A 1XDMA 4AFYA 5BRPA 4INFA 3EWBX 2WLZA 2WMHA 1EA0A 4JFVA 3RHGA 2G3JA 4IMEA 3EOUA 3KBTC 2V5KA 3WQOA 4OT7A 1XCXA 4J1OA 1FHDA 4AC7C 2XVKA 4TU1A 3H2FA 3PQIA 1UD8A 4LYPA 5HJLA 3M47A 3BV7A 4ZQOA 4C7FA 3EGJA 2GQ3A 5I3FA 4DLQA 1UC5A 5ENLA 2QF8A 3UCQA 2J7GA 2NV1A 2WSRA 1O4UA 4XAGA 3E0LA 2V6AA 1XIBA 2ZRUA 2BB0A 2BVYA 5HQLA 5E9XA 4KCTA 1LTDA 2ZRVA 3S6TA 1LXMA 2HRWA 4JN6A 1OG6A 2CHNA 3CUZA 4PMZA 2JK2A 3ITCA 5C2XA 5CBBA 3N3TA 1MEHA 3SRKA 4B5WA 3ZLGA 3EBVA 2Y2WA 3GB6A 4AIUA 1UWTA 4LT9A 2FVMA 4U3AA 3AISA 3IGSA 4WDUA 1BSIA 2DVTA 4LUJA 4NY2A 2YDRA 2E6AA 3QHOA 3SY5A 1TZZA 1C7SA 2OWXA 2XVGA 4PBFA 4UNKA 5GNYA 1CGTA 2GSJA 1E6RA 5FESA 2VR2A 3R0DA 1SSDA 3MQTA 2VFEA 4M1BA 4YNGA 4DJFA 4Z17A 3P81A 4IIGA 2RKXA 2VKZG 3LHVA 5D4YA 5AHNA 3DC8A 1B3ZA 4DLFA 4A3UA 3TNBA 4JICA 3APTA 4S3BA 1K8YA 3B0VC 2NLYA 1H1ZA 4HU3A 2RDXA 1A5KC 3KL5A 3A23A 3OEXA 3ZQ9A 1F6PA 1NF0A 1YBQB 1YDYA 3VKDA 3TN5A 2FDSA 1NSJA 1KXHA 1W2PA 2ZUSA 1OCBA 2PWUA 1MMFA 1KGUA 4AZIA 3KVMA 3LMYA 3NGFA 4NZ1A 1O12A 3O9NA 1LQ0A 3VC6A 1MW0A 3K4AA 5AC6A 1TE6A 1QBBA 1KXQA 3WLRA 1Q2RA 1WZKA 4JN8A 3LXCA 2VRKA 2C14A 5C7VA 3S2JA 2IQTA 2V3GA 1W54A 4L6HA 5EMLA 4HCHA 4AD1A 5H8UA 4ML9A 1KWKA 1SUXA 2XIIA 5JIPA 1MW2A 4IIDA 1RD6A 1RPXA 2JE8A 4NYYA 3T44A 3L66A 4AEFA 1JFXA 4GIRA 5A6TC 4HNOA 2PEVA 4D8LA 2HS6A 5EFFA 1T8XA 3M0YA 4ERIA 5FEWA 3WLPA 3ANVA 3BC9A 1AL7A 3GIYA 3IJDA 3GDLA 2Q3RA 4K7YA 5AHFA 3RXZA 8TIMA 4LV4A 2YDSA 5FF7A 4HNVA 1JGMA 3SCPA 1QPQA 3TROA 3T05A 1PKNA 3RIKA 2R1NA 4AY8A 1VS1A 1T5AA 5KEZA 4L4OA 5FJIA 2C0HA 1C91A 2WPBA 3GZAA 3PM6A 1VB9A 3G1DA 4Z42C 3R94A 1DWFM 3W24A 1XDJA 2BOGX 2FIQA 1CXIA 3HG3A 1TX0A 2Q01A 3AO0A 3WK2A 2VR4A 3WLJA 2ZC1A 1V3MA 1EJXC 3P0WA 4AWUA 1IEVA 4PMRA 4IWWA 4I7UA 3V0SA 1JPIA 4IL0A 4WKFA 3T4CA 1UIPA 5JBDA 4IQLA 2WPGA 2VO5A 1HJXA 1EGMA 2A1YA 1HGYA 6ALDA 3QV6A 4DJDA 4AZ7A 3NL5A 1I2NA 2PCEA 3FK4A 3G0XA 4R5EA 4DM2A 3SDOA 4W8BA 3HFTA 4GVHA 2GSHA 5CPOA 3HM7A 1R3TA 5C7HA 3TQ0A 5AFDA 1D3GA 1WBHA 3OQ8A 3R6IA 1Q85A 3E02A 4ATDA 3BPWA 5K4XA 4M6VA 5M1TA 2X1UA 1K9EA 3V0UA 2ZICA 3IJIA 2OO6A 2BSLA 4DZHA 1TPFA 3IT6B 1MQRA 5MHBA 1NWSA 2YL9A 1XLGA 1V6UA 2ZXDA 4IPLA 4ORMA 3VGHA 3B9AA 3F4DA 1ZP3A 1HG3A 2X1TA 1FWAC 4MGGA 4GGHA 3VZYA 4JOMA 1QJWA 3EXRA 2XSAA 3A9IA 1J0HA 4FNRA 1VRDA 4GVIA 3BMVA 4GBDA 1ZLPA 3WNMA 2D20A 1XLLA 3B4YA 1F3TA 1JPDX 4LBSA 2XN0A 3IVSA 5MKGB 3GO2A 1EDTA 3LTYA 4GZJA 5G2WA 2VX5A 3C0SA 3PJXA 1NY1A 1LL7A 5C2GA 1KFLA 4JTFA 4UR7A 4DO7A 3CQ0A 4HIBA 3O05A 1VD6A 3POHA 4LV9A 3THUA 1H41A 1HKIA 2ZC8A 1R5YA 3WD1A 3G1YA 2X40A 5I24A 3LV5A 2E6YA 1PZ0A 5BZAA 3GHTA 4NNCA 4K3ZA 2OGJA 4GI4A 3W53A 3KWSA 2BP1A 4ERGA 1Y7VA 3EX6A 4P8WA 1SW0A 3PBMA 4QLLA 5LA1A 4UZSA 3CPRA 5L6UA 1GKPA 1FX6A 4Y2WA 5I3IA 1TPEA 1PDZA 1J5TA 4UR8A 1M68A 2BX7A 3EKLA 5LNUA 1P0NA 4GQRA 2Y63A 1XLKA 1GCYA 3CZKA 3NNTA 2V3DA 4DJDC 1QVBA 1W1IE 3RX4A 5IRPA 1V5XA 3D5HA 5DF0A 3TXZA 5DXYA 1P6CA 1E73M 3I10A 1XRFA 3T09A 3CV7A 2YB1A 4XAYA 1JXJA 5M3WA 1QU4A 4PMVA 3W86A 3WLMA 4CN4A 4HT3A 1VBHA 2PF8A 4WHBA 3NQCA 4Q4PA 2O9OA 1R0MA 1E4LA 4PUDA 1ZJAA 2C0AA 3ARTA 4RW5A 4R3UA 4O57A 3VNMA 1W31A 3FYOA 1CXLA 2HV5A 1FUYA 3Q45A 3ZWTA 3QGVA 3MU7A 4J3VA 1OD0A 5CGMA 2FH6A 2DT1A 4A2SA 1D7FA 1QUMA 1L8NA 3TQKA 1ZPTA 3CUXA 3NQMA 1GWJA 4FEZA 5D09A 2WJZA 2VX4A 4AVFA 4GNVA 3OVPA 3PTDA 3THCA 1QO5A 4GGBA 2FVKA 3KFTA 4Z1YA 3M4HA 1EYWA 4ZE4A 1WZAA 5BYWA 4PTXA 4Q4RA 1OGGA 4MF4A 4I7VA 3AIEA 2VM8A 2R6OA 2ZUUA 1US0A 2OEMA 3ARRA 4MJ4A 4H19A 3QVQA 3KM8A 1UR2A 1ISXA 2WSQA 5LIKX 4B4FA 4IT1A 1NEYA 4Q8NA 2XGBA 2BXVA 3MW7A 4TO8A 2ZBTA 3TIMA 1X1HA 2OOFA 3HPSA 1GOIA 1JRBA 3RUBL 4YIWA 2BVWA 3KAOA 1P48A 4U10A 2ZADA 3EA1A 1V7YA 1EX1A 1VRXA 3HPAA 3K8KA 1MQQA 1BYCA 2QJMA 2QPXA 4NJHA 3WQVA 2X7WA 4AYGA 4M3PA 4UZUA 3UR8A 3L2LA 4YU1A 1PBGA 4AHPA 4GZ7A 5HNTA 5IHRA 1FCVA 5A8OA 4WKHA 1XLIA 3UQNA 1QHPA 1FHUA 2CLLA 3ARUA 3UJSA 2VP8A 4UQEA 4A8IA 1L2QA 1S2CA 4YVVA 3RPDA 1NM9A 4YYFA 1JYXA 1NQKA 2J9ZA 4XD5A 3OP2A 2PDNA 5I3KA 2Y7EA 2Y0FA 3UVAA 2E7FA 4IXHA 4QG6A 5I78A 4CCCA 4KFPA 1ZZMA 3VMOA 3N2BA 4XZIA 4NRSA 4IUGA 3FSTA 1UZ4A 1W0MA 4PB4A 4IQDA 2D3NA 1OK4A 4NHVA 1O95A 2P76A 1TUXA 4R88A 3MMDA 1TRDA 3UGVA 4A8NA 1KRBC 4POCA 1PE1A 3UPBA 2J77A 3VIHA 2GZXA 1AW1A 4Y96A 3CQJA 4RE2A 3TFXA 1FKWA 4EPKA 4YCPA 1V0LA 1R2RA 1KR0A 3SCWA 3MC5A 4ZXOA 5TNVA 3G1RA 5HAOA 3AXKA 4UXDA 1CXKA 3T1GA 2A3BA 4PL1A 4C6JA 5FSDC 1VEOA 1LJYA 3RN6A 2E3ZA 4O1CA 3WUBA 5BOOA 2ZZ7A 2A7PA 1P1XA 3B0UX 4JQ3A 2YZRA 1FFRA 3CZLA 4H7ZA 4HU8A 1T41A 2GJPA 4L9YA 4D6IA 1Q6CA 5DFAA 3ZSTA 1PTGA 1F2JA 4MJ2A 4W89A 2HTMA 1LT7A 3VK5A 2PSNA 4LH8A 4AD2A 2ATMA 1EF3A 4GNJA 4NZCA 5BWAA 2QUVA 1CGYA 4YTTA 2VGGA 3R25A 2VEIA 4Q7BA 2VGFA 4AF0A 1O6IA 1P0BA 3ES7A 4M19A 3L23A 1B31A 3ZJ7A 4C6BA 4N4QA 3TE9A 3EXSA 4EXQA 4DB7A 4YVXA 5C71A 2EG7A 4HNTA 3MI2A 3AWOA 1YBQA 1L6YA 2HCVA 2A3CA 4DELA 4JAWA 4ZBCA 3REQB 3BSMA 5B80A 3FDGA 3NTYA 5AECA 2PTXA 4GQBA 3AFBA 1OIFA 2QJHA 2WWCA 2GVEA 1YRRA 1HQTA 5GVJA 3T55A 4FMVA 1XYCA 2YLAA 1ICPA 1KV8A 3NPWA 4XKYB 5B7ZA 2REQA 2HVNA 4B5XA 3URAA 2OT0A 3NUKA 4RV3A 1EJRC 1QI3A 1S2UA 4KIEA 1SW7A 2NQZA 1LG1A 1DP0A 3KLLA 2WZHA 1A4MA 1GG1A 2ACSA 1DWAM 4UNLA 2A21A 3LHTA 3HBLA 5D03A 3R2GA 4PBGA 4DJEC 1N55A 1AQ0A 2I9UA 1HJVA 4PRRA 1CGVA 4WLCA 3OA5A 4ICCX 4PGLA 1Q8JA 4FNSA 2AAMA 3MA8A 4PTVA 2OXNA 2FZ9A 4IP4A 4M5PA 1XRSA 2WC4A 3WF4A 4JIQA 3WDQA 1S1RA 3WQCA 5D2TA 3S6DA 2NX3A 5KINA 2PWEA 3ARZA 5D2YA 1ENUA 1T96A 4FK9A 1OYBA 3TA9A 4GOAA 3BE7A 4KEZA 4NVTA 2Z29A 3HA1A 4HCDA 4XK2A 3SZ8A 1ZENA 4DWSD 2FLIA 3KL3A 3AS3A 1V3HA 3TLQA 2FH8A 4JQ4A 4BCEA 1HL2A 1AZ1A 1H2JA 4LF1A 2J7HA 3WQGA 1T8QA 3VNYA 5A8QA 4NZ3A 1WAWA 4BQ3A 3W7LA 1QHZA 3GXPA 4K7VA 4MWAB 1PKLA 4UBPC 3VNZA 2A85A 1IZCA 1JQVA 3GLCA 4GINA 4GMEA 1BTCA 4AISA 2IMRA 3UWVA 2J7BA 2XFYA 2Y7DA 4MM1A 3W02A 3ATYA 4H4IA 1AW5A 4LUTA 1JG9A 3CIWA 3L5AA 4O0ZA 1U5JA 4QCFA 1FWTA 2OSYA 1Q63A 3KVLA 1TV8A 6TIMA 3DI1A 2VUYA 3L12A 3TYUA 1MNZA 1KM6A 3RMJA 4MFEA 1ISVA 4MG4A 1MDRA 1VF8A 3S2CA 1ICSA 1ZB5A 3UYCA 3SFWA 2W63A 2V30A 4GXPA 1NELA 4YTSA 4C1KA 3RJYA 4XVDA 3QN3A 1WDRA 2W3ZA 2HISA 4H9MA 1DE6A 1JZ8A 1X98A 5DMMA 1XSJA 5MKGA 2C1HA 3AHZA 4NT0A 4B5VA 1EQCA 2NVCA 4ZQRA 3BGAA 3BAYA 4JY8A 2VQUA 1H7WA 4O52A 2B7PA 3W82A 1DHKA 5G1MA 3NG3A 5KETA 4YWIA 3AMCA 1KB3A 2O4MA 4CNOA 3PANA 4H00A 3QW3A 1WP6A 2J4GA 1TMHA 2VCBA 3PBVA 3EAUA 1D3CA 3VVGA 2R8WA 3N9RA 3CHCA 1ZAHA 1R87A 1KBKA 1TELA 2DIJA 2A3LA 5K9XA 4MPQA 3LS9A 1F1SA 1FWCC 3MV01 4R85A 4PCTA 1A5BA 3T0AA 3M46A 1H7RA 4BI7A 2E1WA 3CAQA 1J18A 4XZBA 1VAHA 3I7QA 1O5KA 2R1LA 3E5PA 3ES8A 1FQ0A 1W1A1 1WKEA 3B0YA 3CAKA 1U2YA 4N9DA 2XJ7A 4Z2JA 3GD6A 2QJJA 3H54A 3UR7A 2O7QA 4PTDA 1MYRA 4YTRA 1GHSA 1BSLA 5HA7A 5HJYA 1B3OA 1CDGA 3OBAA 2BDQA 1W32A 3BMXA 4JNYA 2C79A 2W0UA 1JR1A 4OOZA 3CMJA 3GTNA 4H8NA 1V77A 1XI3A 2W6RA 3PUEA 4LEQA 1UH2A 4WY0B 4PMJA 4S3GA 4WY0F 3WQ8A 1R47A 4GUJA 4Q8PA 3KDNA 4J3WA 4HN8A 2CLPA 3OGVA 3C3UA 4A8RA 3GW3A 3LCLA 1EOKA 3PZIA 4QCEA 5H8PA 1TTPA 1BHGA 1XBYA 4PUWA 3LNPA 4XD4A 3GDKA 4GHRA 4B2DA 1M7XA 1QHOA 2WMIB 2YXGA 3QHNA 3TFCA 4L1GA 1GYNA 4BF7A 4L4LA 1UHVA 4BJHA 1LWJA 2NUXA 5M5DA 2X30A 4W4QA 3DESA 1CYGA 1F05A 1K3UA 3HMCA 3WDIA 2NUYA 3W7JA 2PUZA 3IUIA 1VFMA 1FWGC 4QJ3B 1EBGA 2CBVA 3QC3A 4PUKA 1P7TB 3JW7A 4H2CA 2JGQA 1NU5A 4CN6A 3FHQA 4HOXA 2EPKX 2POTA 3PNUA 1S2WA 2ZCGA 1QT1A 4QITA 1PUDA 3TTYA 1GQNA 3D6NA 3O63A 1J10A 1LCOA 3NM3A 3VKCA 4K2SA 3EXTA 1O5RA 1MEIA 2Z7GA 1I8JA 3YPIA 1JDDA 4Q7IA 1CNVA 1OFOA 2CKRA 1EUNA 1WA3A 1G94A 1AH3A 1WOAA 2P0OA 1AMYA 1BQGA 1FHVA 1XG4A 1WE5A 4UCFA 1TIMA 3E74A 3UEQA 3DFHA 5AZ1A 1B4KA 4J35A 1A5UA 1K70A 5FJRA 2UV8G 3ATZA 4RNFA 2NXGA 2WVVB 3QFEA 2V67A 1CI1A 3IPWA 4RW3A 2WO5A 2XM2A 1MSSA 2PI6A 1BYAA 1AFSA 4D8AA 2J7EA 2EHHA 4JD4A 4O54A 5LGXA 3B9OA 4AVNA 3N6HA 3AMKA 2PLMA 3EZ4A 3S6OA 2J75A 4CQDA 5LXXA 3TJIA 4OOUA 5U4NA 3S5NA 3FYPA 5XIAA 1HVQA 2E8YA 3D3AA 1OC5A 3S4TA 2RDUA 1TPC1 1V6VA 1YYAA 1XW8A 5LYRA 5I77A 4A29A 1L0PA 4J3XA 3P5ZA 3N2TA 4H9TA 4B5UA 2FZ8A 3L67A 1X1ZA 4LC6A 3WKZA 5CZSA 3TCSA 3NR0A 3B05A 5I3HA 3LB0A 1ZBKA 3CUIA 4UUIA 4RE0A 4JTSA 3W1MA 3FSUA 3V1HA 2XTKA 4FHAA 4HMDA 3MUXA 5C9UA 1UKQA 1EH9A 1TV7A 3KHDA 2ZA3A 1DIKA 2Y85A 4HNCA 1X39A 1F61A 2GJLA 3WSUA 1NAL1 1G4EA 1KQZA 2EAWA 2WM1A 1ZALA 1F7BA 2CZVA 4DAIA 5A6BA 3NA8A 3VUSA 1R3RA 4YMZA 1LT8A 2VCCA 1VHCA 4OIFA 3AROA 1ME9A 4X2PA 2A6NA 2OVLA 2GGJA 4GX9A 3W22A 5LHEA 4DF2A 1KCLA 3KP1A 4UQBA 4TTUA 1Z32X 5XIMA 5J04A 3GXTA 3KZSA 4Z2IA 3WLKX 4E2BA 1QI0A 2GGHA 1F4HA 5CC7A 2UBPC 3GC4A 3PC0A 3W74A 1N2VA 3MO7A 1PYFA 2PGRA 3K4DA 5B7YA 1X8CA 2VEGA 3QXBA 4IG2B 2Z26A 4JZ5A 4KERA 3REQA 4DBUA 1XBXA 4AXNA 4JTKA 4FA3A 2DZAA 2ALDA 3WMSA 3WQ5A 3FLUA 1Q65A 5AYBA 1TMLA 4TOQA 1V8EA 5BXSA 3I68A 3LA4A 1POJA 2E40A 3WF1A 3F7JA 1BQCA 3T0CA 1KGWA 1VYRA 3ITVA 4B15A 2JQXA 2ISFA 3ZXWA 3I4KA 2AQVA 1CLXA 4LBUA 4MFDA 3NQAA 4DLOA 3S2LA 4A05A 2PDXA 5FSEC 5I02A 3GNOA 2CBJA 2HWGA 2HK0A 4FNUA 1P6BA 3AI0A 3PULA 1X1NA 1I4NA 3TH6A 1VLWA 1YHTA 1GJUA 2DZUA 3LRLA 1BYDA 2OQLA 5KZDA 5E1QA 5HQMA 1W9UA 3COTA 1GTEA 3CMGA 1Q6QA 3C0LA 4AW7A 4NXSA 1W2VA 1FCUA 4GYJA 3STPA 4IJRA 4UQDA 3DFNA 3GTFA 3GXNA 1GVOA 2DZSA 1UH4A 1TE1A 1XDLA 1FP9A 3G1FA 4QTGA 4OV4A 3FKKA 1PL9A 1KFCA 2Z1XA 3C6CA 3DZ1A 5AYYA 4MB3A 1Z89A 3N13A 1SGJA 3LCHA 4HK6A 1VHNA 5HDRA 2R1PA 1IIGA 2OKTA 3MUZ1 4QJ1A 3VE9A 3F59A 2Z24A 3N34A 5DT5A 4MWAA 1TTIA 5KTLA 4GJIA 2X41A 4F3HA 4LYQA 1R6WA 4Y9OA 4NILA 4F2UA 4QDPA 4X61A 4GISA 4S1FA 4A3YA 1PWLA 1R85A 3PNZA 1MUMA 4GI8A 1HM2A 2J78A 2QAPA 3RU6A 1L6GA 4KCWA 4W7UA 5DRIA 3ICJA 4C5YA 3DYPA 1GOMA 1FHLA 4MOZA 3NL2A 3JZEA 3SADA 2ESCA 4ACYA 3TK7A 2NLIA 2P10A 5LZLA 2BY1A 4XIMA 1EF2A 5HK4A 3UZWA 3QMSA 4UMBA 2CCRA 2J7DA 4GQQA 2QW5A 1GUVA 4X22A 3UZJA 1MVYA 1H7OA 1EGUA 1GPWA 3KBNA 4O4VA 3FA3A 3AXMA 3L0GA 4OJYA 4ZMGA 4CD6A 1MXDA 4GUHA 2YCKX 1OT1A 1UUQA 3GSMA 1IZKA 1HO1A 2ZXAA 3N2MA 1A5LC 3VOCA 4Q4MA 3LYEA 3BXWA 1V3JA 7CGTA 4J3ZA 4W87A 3UXLA 3NDZA 3QTPA 1GQIA 3N1AA 2PDQA 1M7OA