4D6HA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 1 blood group a-tetrasaccharide (e558a x02 mutant)
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
587
structure length
587
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTASYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 219
structure length 587
sequence length 587
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6hA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6hA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6hA02
1DWHM 4GI6A 1ISWA 3WF4A 5JUVA 2J7CA 2EPOA 3BLKA 1WAWA 1BVZA 4F8XA 3KL5A 1JD7A 1BAGA 1H5VA 2OSWA 1GHSA 5I5RA 1W9DM 2DH3A 1EOMA 2WC7A 2WCGA 3SCRA 5M3WA 2XM2A 3AHVA 5I24A 3LPOA 3IANA 1VBRA 1UA3A 4ATDA 4JZ5A 2WWDA 1B90A 2G8ZA 3CZGA 1GOWA 4JCMA 3DHPA 1XRVA 3VD9A 4HU0A 4PMDA 3BSGA 3RDKA 2O9TA 1CGTA 1K9EA 1VB9A 1RW9A 1JZ3A 2XPKA 2X8RA 1XH0A 5FL1A 3WNPA 1IT0A 1EGZA 4AD3A 2NSXA 7CGTA 4CU8A 2EEXA 2XVGA 3ARYA 1E72M 2WCAA 1B0IA 2X0HA 5HPCA 4BQ3A 1C8QA 3VD7A 4HPHA 1E6ZA 2XFFA 1C8YA 4U33A 1E73M 1UOKA 5D9OA 2Q8XA 1R7OA 2E9MA 1XH1A 4BS0A 1HJXA 2J77A 5FD0A 1OBAA 1WZLA 2IUZA 5I79A 2X2YA 5ABGA 2ZOXA 4K68A 5E9AA 1GZJA 4HP5A 5LA2A 4MDPA 1C8XA 2JIEA 3AXXA 1LXKA 4H2CA 1NQ6A 1E4NA 3WMCA 2YL6A 4UFLA 4V2XA 4F9JA 3MMUA 1B9ZA 2XG9A 3WDRA 1EQCA 3SUVA 5A6AA 3W0KA 3PZOA 4W93A 5EB8A 2F61A 5CPSA 1Y7VA 6CGTA 1W9BM 5E0CA 1UKQA 3GNRA 3VO0A 1HF6A 3FN9A 3WN6A 4JAWA 1J12A 3JUGA 2WKLA 2ZUMA 1W91A 3BAIA 3CUGA 2W5FA 3MV11 1ZBWA 2TAAA 3EMQA 1QW9A 2XVLA 1JYVA 1XV8A 4R5EA 3CO4A 3AS3A 4TVUA 1ZU8A 4BF7A 3RIKA 4XB3A 2X09A 1PEZA 4OBSA 4AD0A 4J3TA 1L8NA 1V6XA 1JZ2A 1CGUA 5ABFA 5FKYA 3N1AA 3ALGA 1JDDA 1C91A 1S46A 4UQ9A 1FP9A 1PZ3A 1QI0A 1BVNP 3UR7A 1UQYA 4YPJA 1W1TA 3VTRA 1CLVA 2G3JA 1E71M 1Q6FA 4ZXOA 1GQKA 1GOQA 2PBGA 3PZMA 4HMDA 2UWFA 3PTQA 3WF0A 1GVYA 1V03A 1UWTA 1XD0A 4E2OA 2WDAA 2NW0A 4QCEA 2JF7A 3AMLA 4D1JA 3PZVA 2BRVX 3CHDA 3AQUA 3WD0A 3VIMA 2FH8A 2W63A 1W32A 3QR3A 3DHUA 1OT2A 1SR0A 3OLDA 3K8LA 2WCOA 1HMWA 1KBBA 5E09A 1PAMA 5AYIA 3WBEA 1MW0A 5CLWA 3TONA 1E5NA 3VDBA 5A95A 2EBNA 3L4UA 2Y2WA 1GJUA 3VIHA 1W3YA 5A6JA 2XSBA 3WBAA 5IHSA 3WQ6A 4AZ7A 1QI5A 1V3JA 1I8QA 3MU7A 3LPFA 4GI8A 1E15A 3W24A 3WQVA 1TG7A 2XIIA 2X03A 2QHAA 2UY2A 4HZ7A 3KE0A 4WSKA 1KCKA 1UKOA 2ZUNA 5A1AA 3OLEA 3AOFA 2CCRA 4W8LA 1US3A 3LMYA 1XD1A 3GNOA 4AD5A 1V3IA 1Z32X 2DT1A 4NSBA 2YLLA 4JFTA 2V5DA 3FNDA 2J7FA 2FHCA 3PN8A 3GYCA 1CWYA 3VOCA 3W27A 5IFPA 3WUEA 2VVSA 4RE2A 5ABHA 1N7OA 1UD5A 2V3FA 4CU6A 2E0PA 4F66A 4ZE5A 4IISA 4FLRA 3W37A 1JIBA 3WF3A 5ECUA 2VZUA 1NP2A 3AHYA 1HKMA 2XVKA 2J7BA 3AS2A 3DECA 1M03A 4MADA 5HDRA 2D0GA 2VI0A 1N7PA 2GJRA 3SIMA 1FP8A 3T09A 3PZQA 1LJYA 3CHFA 1QI2A 2W91A 2CESA 3IAQA 6TAAA 5GPRA 3MKKA 4GQRA 1J0IA 1R7AA 1W3JA 4MNJA 1HM2A 4RE4A 1E70M 4J27A 1J0HA 4UFJA 1VFMA 3L2MA 2ZX5A 5CSYA 3VGHA 4ATWA 1AQHA 1RWFA 2VZVA 1W1VA 1MVYA 1CGVA 4JHZA 1QHOA 4W86A 1VIWA 1EDTA 4JL1A 2WXDM 4AD1A 4J3XA 2A3HA 1OJOA 2IXVA 4BCEA 1B2YA 1OD0A 1Q6GA 1RWGA 1KQYA 3U5YA 3VMNA 4BQ2A 4WSJA 3GBEA 3UERA 2E8YA 1UR1A 1UWIA 3FHQA 1GOKA 2GK1A 4W7UA 3ECQA 3WENA 3EDFA 1QI4A 5DT7A 2ZUWA 5HNNA 2A3CA 2D20A 2WB5A 5EFDA 5CZKA 4D6JA 3ARXA 2VCAA 3A4XA 3ARUA 1KQZA 2YJQA 3ZM8A 2VCCA 3N9KA 1TVPA 1RPKA 2YL9A 4AC1X 2VR5A 1TE1A 1NH6A 1R86A 1NWUA 5FL0A 4AZCA 2YBUA 1MXGA 4CVUA 4AZGA 4MB5A 1UKPA 3B9EA 4N0RA 4QAWA 4RL3A 4U3AA 2QF8A 2OWWA 1K9TA 1BGGA 3KZSA 5E6YA 1X6NA 1EGUA 4CVWA 2DGAA 3GZAA 2EO7A 1M7XA 2VZSA 2VCBA 2CITA 3F4VA 2VX4A 2GVYA 2YL8A 1H0IA 4MJ4A 4IUGA 1W9UA 2PI6A 4JHOA 5HOSA 2JF6A 1W1PA 1ODZA 2WC3A 3ARTA 1K9FA 3O9NA 3WQWA 5ABFB 3EMCA 1LWJA 3AHTA 2DH2A 2MANA 2ZUVA 4HMCA 3WH8A 1O7AA 4IPNB 3GM8A 4CCDA 3ZJ7A 1XH2A 1UHVA 2GJPA 4S3KA 3F5KA 4XZBA 1GOMA 3GTNA 1UG6A 3BAWA 1LG1A 2VURA 3WNOA 2WKGA 2YDRA 2EXOA 3EYPA 2C0HA 3AS1A 3K8MA 4P8UA 2OSYA 1JYXA 1NWTA 4MNKA 1OJPA 4QP0A 4MB3A 3FAWA 1E6RA 3U7BA 1XSIA 3AIEA 2J7GA 2VQUA 3VVGA 2Y5EA 3UCQA 1JAEA 2D3LA 3S2CA 1J0ZA 1V3LA 1LQ0A 3MSDA 3ARZA 2YLAA 4PMNA 4B16A 1D3CA 2GDVA 1BG9A 1E43A 1HMUA 2PWGA 2PC8A 4UQEA 1X1HA 2ZUUA 5JBFA 2G3MA 5D9PA 3AHXA 2WZEA 2PB1A 2YDSA 2J8FA 1GW1A 2CBVA 2A3BA 3VIKA 4ZEPA 1OIFA 4HZ6A 1NOWA 4ZENA 3GBDA 2OYMA 3MMDA 1MW3A 1E4LA 3AZSA 4AY1A 2XSAA 1XYFA 1W9VA 1CXIA 1D7FA 1UR8A 3ZT7A 1U30A 2VX6A 2V5CA 3SCVA 4C7FA 4GZEA 3BCFA 1LWHA 1TCMA 1KXVA 1CTNA 3K4AA 5A2BA 1HT6A 3N18A 2BVDA 3D5HA 2ZIDA 1JZ5A 1HJSA 4W7VA 1KGUA 2CYGA 4PTVA 5DEZA 5A8PA 5CSUA 3PZUA 5C70A 3CZKA 1XGZA 3CZEA 1V08A 3QOKA 2ZWYA 1J0NA 1HL8A 3GH7A 1VFUA 1E0VA 4D6EA 3WEZA 1EDQA 4W5UA 3A4AA 1AMYA 2CXGA 2CEQA 4UZSA 2OWCA 3RPMA 3WD1A 1WDRA 4J3VA 4LGXA 3BXWA 3VD3A 5A3HA 4KRTA 5DT5A 4X0NA 2VT0A 4CGTA 1E56A 1JYWA 3NCOA 2IXUA 2ZWZA 4GO8A 4HTYA 4XV0A 1IV8A 1J10A 3NSNA 2CHNA 3KL3A 3VIPA 2WSKA 1CLXA 4H8HA 1HN0A 2A3AA 4GZJA 3IJ9A 4FK9A 4OUEA 4L4PA 1CXLA 4Z2GA 4JCLA 2JIWA 4P7QA 3ARVA 1QW8A 3GNPA 2RGLA 2Y8KA 4Z2KA 1EXPA 4PTWA 1UD3A 2J79A 1J0YA 1HJUA 1B3XA 1CDGA 1C3FA 4PMXA 4CCEA 2Z1KA 2GK1B 1XCWA 1RWCA 3FXYA 2XUCA 1DWAM 5A69A 1JG9A 2CBJA 3IJ7A 4B15A 4CD7A 2ZXQA 4GZIA 3A3HA 2D22A 2VX5A 1MQRA 4UOJA 1FH8A 1H49A 1TMQA 3UESA 4ACZA 4LYQA 5A6SA 1TFVA 2VTFA 1J0KA 1V0MA 4OOZA 2O9RA 1E3XA 1OIMA 1J9YA 2VQTA 1K9DA 1H0GA 4OZOA 2WLZA 1MQPA 3WUBA 4PMOA 2ZXAA 3T2QA 5DO8A 3CUIA 1VEMA 3CZLA 4FLOA 2E3ZA 3PZ9A 2PF0A 3VD4A 3ZMRA 4M82A 3T0AA 3UG5A 1UH2A 4HPGA 1UWSA 1GUVA 2EPNA 2WC4A 2XM1A 2VZTA 3UETA 3ARQA 2WVVB 5A6LA 5BYWA 3WL1A 1X1IA 2DEPA 3TP4A 3VIOA 4S3JA 3FW6A 2WM0A 2WBKA 4WLCA 3BAXA 1KXHA 2D0HA 1KWGA 4DUWA 4NZCA 2DSKA 3AYSA 1F1SA 1KGXA 2ZX7A 4PTMA 2AOSA 2O92A 3ZSSA 1V3HA 2WSPA 1B3YA 2E40A 1E0XA 4TOQA 3BCDA 2PWDA 3CUJA 1E0WA 3BGAA 3N04A 4UQBA 3B9AA 2WVSA 2WVTA 1TR1A 2XWEA 2YIHA 4TTUA 1G1YA 4PUDA 1E9LA 3HMCA 3T08A 2CKSA 3CUHA 1JDAA 1JL8A 1UZ4A 4AISA 1MFVA 1ZBKA 1YHTA 1H1NA 2XVPA 2DPEA 1FHLA 1UR0A 1HM3A 2BXZA 3NUKA 5LYRA 5TD4A 4KRUA 3WKZA 1WP6A 1B31A 1W1YA 2VMFA 5KEZA 4J3SA 3TTOA 1PZ2A 5GNZA 1LG2A 3WNKA 4UNIA 1DHKA 2YA2A 1XSKA 3OG2A 1BYBA 1G9HA 2ZXBA 1N7QA 5I77A 3U57A 3WF2A 3W82A 5BWFA 4HA3A 4UFHA 1L0PA 1I1XA 2VJXA 1PX4A 1OINA 1R87A 3BAYA 2X05A 1QNPA 5M5DA 2BV9A 3A6OA 3EBVA 4F9DA 1X1NA 4NI3A 3VKKA 3WIJA 4JKMA 5GQBA 2CBIA 4IPLA 2G3IA 1N82A 1MQQA 1ECEA 2VR4A 5M03A 1BGAA 1JF6A 2J78A 1U33A 4X0VA 3WDHA 3ARRA 4AMCA 1QBBA 4BQ4A 1JGIA 1Q6EA 2XTKA 1ISXA 3PZNA 1VF8A 3MS8A 4W84A 3IAPA 2WPGA 2BNJA 3VGBA 4EAMA 2AMGA 3BAJA 4W7WA 1TA3B 2OYKA 2OYLA 1GOIA 1ESWA 3AISA 2BHYA 4URIA 4WF7A 4WKHA 2CBUA 1VENA 1WO2A 4AIOA 4QCFA 1NARA 1WCGA 4GIAA 4AIEA 2WZHA 3GH5A 3EDJA 5C71A 1E3ZA 1CNVA 1HJWA 4OOUA 3TTQA 4DWSD 2QMKA 1KXTA 4CD8A 4W85A 1XSJA 4UFKA 2ZX8A 8A3HA 5EFFA 4D6IA 3W53A 3WH6A 1W9PA 3MMWA 3TTSA 3WDJA 4CN6A 4CD4A 2VX7A 3PTMA 2Y4SA 4P8VA 4LYRA 3SCWA 4Y7EA 1QHZA 3ZT5A 5A6KA 1MW2A 3RMEA 4W87A 2BFGA 4EK7A 5I23A 1JFXA 1FFRA 3WQ8A 3BAKA 4Z2JA 2FGLA 3AZRA 1MFUA 4HA1A 3SCNA 4UZUA 4D72A 5DMYA 1KBKA 3DYPA 4QLJA 4D1IA 4AEEA 4JFSA 4UOZA 3ALFA 4MAVA 3RJXA 1B3WA 3I3BA 3TA9A 1XHGA 4FLSA 4V27A 5FOOA 2VVNA 1XC6A 3NDZA 3WFZA 4ACZB 5JIWA 4W89A 3THCA 1JXKA 1UKSA 4PEEA 4XX6A 4IM4A 5AYBA 4J7RA 5IFTA 1IZKA 4OKDA 3WF1A 4TXEA 3M7SA 4UCFA 1LLOA 1VFFA 1TVNA 3VM7A 3VU2A 3OGVA 4XZWA 4GKLA 1VJSA 3L4YA 5I2UA 3HU7A 1X6LA 2DDXA 3GXIA 4CKQA 3FAXA 2YBTA 4LYPA 4HZ8A 1R85A 2E9BA 1PBGA 2PWEA 3U5UA 1V3MA 1PIFA 4TX6A 1HIZA 4Z2IA 3G6MA 1UH3A 1QPKA 1QOXA 2DSVA 1JFHA 3IJ8A 1JZ6A 4QFUA 1W3LA 1EH9A 2O9OA 4M1RA 5C8BB 1UD4A 2WMKA 2XFRA 3AXHA 2WMHA 2D2OA 2XHYA 4ATLA 3WELA 9CGTA 1AQ0A 5JIPA 2WMFA 1WKYA 1HL9A 2C7FA 1WPCA 4JKLA 2A3EA 3T0DA 3NYDA 4FMVA 2EQDA 1E4IA 3WDPP 4D6HA 1BHGA 2ZUTA 3KL0A 3RCNA 2DQXA 4P7LA 3NSMA 4LPCA 4D6FA 1CECA 4H8VA 3VIGA 3VMOA 4U2YA 3WEMA 3OIHA 5BXPA 1BYAA 5M17A 4P7NA 3G6LA 3AFBA 3VIIA 2NT1A 2EPLX 3W29A 1RP8A 1WB0A 3SCPA 4TTGA 3OBAA 3VDHA 1JNDA 4HOXA 2JEPA 1IZJA 1W9XA 3AIBA 4H41A 1TUXA 1UWUA 1I75A 3RM8A 1XCXA 2CETA 2DSUA 4ZFMA 1OWQA 4P8XA 3GH4A 1V6WA 2BXYA 1BYCA 3VDAA 2FHFA 4UQCA 1DWJM 2G3NA 1MYRA 2JEQA 2X0YA 2XFYA 4WK9A 3L4WA 4WJXA 1V02A 2J8GA 1C92A 1UR4A 4PMVA 3N12A 3L4XA 1ZB5A 4P7OA 1UWQA 4NRSA 5I6SA 3W26A 3APGA 1JYNA 4AWEA 1AVAA 1JDCA 1V0KA 4UQDA 1BYDA 1HKJA 3VGEA 1C93A 1OD8A 3NIYA 4MB1A 5EMYA 1EHNA 3UEQA 3ZOAA 3UG3A 5A8NA 1FH7A 4A3HA 4PSRA 4HA4A 1QNQA 4KWUA 3SURA 7TAAA 3DC0A 3CHEA 4MNLA 1V3KA 1CENA 1GCYA 2OLHA 3MUZ1 4W5ZA 2WHLA 1WZMA 2VOTA 5LA0A 1GONA 1GORA 1J01A 1OB0A 1EO5A 2CIPA 2UY5A 1JZ7A 2C8NA 4DWSC 4GI9A 3ZJKA 3AYRA 1QHPA 3MUAA 4NF7A 1BLIA 4ZE4A 4AD2A 4Z2HA 3QHNA 5AY7A 4GXPA 1LF1A 1ITCA 3W4RA 4AD4A 3W6LA 4PTXA 1BSIA 4L4OA 3CZJA 3W6MA 4PMZA 2WK2A 1CGWA 1HJVA 2WVUA 1WDQA 2E9LA 3M07A 1VEPA 4UOQA 3CTTA 3ARSA 4M81A 1Q6CA 4PN2A 1F4HA 1FH9A 1KGWA 4ZXLA 3AHZA 5DFAA 3VX0A 1UZ1A 4JFUA 4Q7NA 3L4ZA 1Q4NX 2WZIA 2W66A 1H41A 4E8DA 4MPKA 3VX1A 1AQMA 1UH4A 2BRWA 1UD8A 3T2OA 3CLWA 5IDIA 1B30A 1RH9A 4HOWA 4PMQA 4KGJA 1BF2A 1KB3A 2NT0A 3AIRA 3ARWA 4DUXA 4YHGA 2V3DA 2D3NA 3K46A 3VD5A 1W3KA 1JAKA 2BS9A 3ZJ6A 1VJZA 2G41A 4H8UA 4UR9A 1UR2A 1HVXA 2ZX9A 2BY3A 2XWDA 4MDOA 1HXJA 2CNCA 1JI2A 1WNOA 1EHAA 1G5AA 5A6BA 2W62A 1V6YA 3SUTA 3WUGA 3SCQA 2GFTA 1FFQA 3ARPA 1RP9A 2DSZA 3ZSTA 4CD6A 1ISYA 1OM0A 2J7EA 1M04A 2YA0A 4PCTA 3U7VA 3POHA 5FCZA 5A2CA 1ZJBA 1GQJA 2HISA 3K1DA 2XGBA 5A6BD 8CGTA 1UD6A 5CXPA 1CXEA 2OSXA 1G01A 3WMSA 3K8KA 1LXMA 4EANA 1KR1A 4J3UA 1CZ1A 2XVNA 4CCCA 3W81A 3MUIA 1CYGA 3HJEA 2E4TA 4GPNA 3LPGA 1CBGA 1HJQA 1W3HA 4CN1A 3W25A 4CN4A 1F9GA 1QNSA 4U3CA 1E40A 1PX3A 1QNOA 4J28A 4U5IA 1G94A 1CGYA 2XYLA 3L4TA 2VRJA 2GUYA 4OIFA 3N17A 4AZCB 1DWIM 4MB4A 3WNMA 2WHKA 1EOKA 3OGRA 3F5LA 5CJ5A 4AW7A 4PYSA 4BZYA 4HMEA 3SCSA 1KWKA 3FHAA 5EBAA 1LL4A 2YDQA 1HP4A 1VEOA 2CERA 2VZOA 1UQZA 1GQIA 1HN1A 4C7GA 3CBWA 2WWCA 1HX0A 5FIPA 4P8WA 2VRKA 5CGTA 1DEDA 4PSPA 3ZT6A 1PX8A 4WKFA 3WEOA 2QPSA 3WD3A 4AEFA 4QLKA 2VRQA 1GJWA 5I78A 3A47A 1HVQA 3F5JA 2J4GA 3O2LA 2ZICA 1NOFA 1WDPA 4GO9A 1HKIA 1KCLA 3VPLA 4JL2A 1HP5A 4YN5A 4TX8A 4CU7A 2J7DA 3SUWA 3SCTA 3CPUA 1ZL1A 1C7SA 2DT2A 5HXMA 3OA5A 3VNYA 2DT3A 3I3DA 2FHBA 4FLQA 1H09A 2BVTA 2YOCA 3WDIA 4PMYA 1LL6A 4KH2A 3EDEA 2HVMA 4LQ1A 2G4FA 3OZPA 3N13A 2W67A 4LXFA 2J62A 3SCUA 2O9PA 3KWXA 4MTVA 2WCSA 4M80A 2OWXA 1EQPA 2GJXA 4GQQA 1CXKA 4JIEA 5AC4A 1UA7A 2CKRA 1WZKA 3TOPA 1MW1A 3ZJ8A 2EJ1A 3W38A 1RWAA 1V6VA 4AZ5A 3CGTA 1N7RA 3N11A 1ODUA 5A8OA 2DT0A 2V3GA 3AI0A 3PHAA 5D9NA 1UD2A 1R8LA 4U2ZA 1OJNA 1CEOA 1E1EA 1CXFA 1CPUA 2QLYA 1EA9C 1OSEA 1V02E 1YQ2A 2CPUA 3K4DA 4QDMA 2BY2A 4MJ2A 5JBEA 5BXTA 3OLGA 5GNYA 3AIWA 4DWSA 1A47A 3PZIA 4M29A 5CPTA 2UY4A 4BQ5A 4WKAA 1CXHA 3I3EA 3BC9A 1PIGA 2E8ZA 3VILA 1JNEA 3SUUA 3ZIZA 4LX4A 4KGLA 4EKJA 1H4PA 1V6UA 3VIJA 1VAHA 3L2LA 3T2PA 5BCAA 2PWHA 1NOUA 5IXEA 1EIBA 3OGSA 4A3YA 1JD9A 2GSJA 1SMAA 5E6ZA 1JI1A 3A4WA 3MSGA 2WNWA 4Q22A 1C82A 4HU8A 5DF0A 1NP0A 1E6XM 4MNMA 4PCSA 1CB8A 1C7TA 1GQLA 1P6WA 2VO5A 3BSHA 1B1YA 3AJ7A 1U2YA 1BFNA 3CZ8A 1KR0A 5LA1A 1HNYA 2WAGA 5A2AA 4GINA 3WFLA 1QBAA 2F8QA 2YKKA 3CIVA 1V0LA 3RM4A 4P7RA 2AAAA 3VNZA 2FGZA 1N7NA 1OJMA 2BHZA 3UG4A 1WE5A 2UY3A 4TUFA 1NWRA 5BROA 3VMPA 2DIEA 3QGVA 1H2JA 4H04A 2V38A 4AZHA 4AXNA 1UR9A 3CMJA 3LPPA 4JFWA 5A8QA 3THDA 2W61A 3AMCA 3QOMA 3KEHA 1BG4A 1US2A 1I1WA 4J3WA 2Z1SA 7A3HA 4DM1A 5E0FA 3MUY1 1SFSA 2WMIA 1QNRA 1ZBVA 1E6PA 4B3KA 1J18A 1QI3A 1J0JA 3BH4A 5CPQA 2WHMA 3B8SA 4NRRA 1SYTA 3SUSA 2D24A 2ESCA 4XUYA 1B3ZA 1Q6DA 3UR8A 1E4MM 4W88A 3SEPA 1JXJA 4BA0A 1UKTA 1KXQA 1W2VA 2WLYA 4B9YA 1MWOA 1E1FA 1CGXA 2Y8VA 2WBGA 2WYSA 2BVYA 3WY1A 4C7DA 2EPKX 3WD4A 3ZR5A 4U31A 2EPMX 1LOHA 1UYQA 3ZO9A 4D6DA 5A94A 1J11A 4AIUA 2CHOA 4RE3A 3CUFA 3WSUA 3BLPX 2X1IA 1DWGM 1UUQA 1OCQA 2Y24A 4UFIA 3WMBA 1E6QM 3B9DA 3BMWA 3CMGA 3MV01 3AMDA 3PTKA 3AIQA 3WD2A 4M24A 3DYOA 3VGFA 3AS0A 2XIBA 2WMJA 3OLIA 4QLLA 3D3AA 5A6MA 3AZTA 1JZ4A 2GDUA 4CD5A 1HKKA 4F79A 4M56A 2VUYA 1DWFM 1WDSA 5BRPA 1TZ7A 4WIWA 1V0NA 4OBRA 4PMRA 1MXDA 5D4YA 2FH6A 2J74A 2V3EA 2D0FA 4PUEA 1D2KA 4CUCA 2VC9A 5BXRA 1K6AA 1DP0A 4YHEA 5I0DA 1ISVA 2BRPA 4MAZA 1LL7A 4W8BA 2D1ZA 4KMQA 4OJYA 2BY1A 2W92A 1ISZA 2J7HA 3VUPA 3AXIA 4UFMA 1EDGA 1CIUA 2Q1FA 4JKKA 3AIVA 2VNCA 3IK2A 5D8ZA 2WANA 1C90A 1XYZA 2ZUSA 2GJXB 2JALA 6A3HA 3GXMA 3WH5A 5D9MA 4ACYA 2WVVA 4B3LA 1UWRA 4V28A 4E4PA 3WNNA 5CQ1A 2W4XA 3MANA 3VM5A 3RJYA 3M46A 5BRQA 3PZTA 2YL5A 4UQAA 3WL0A 3E1F1 2ZXDA 5E70A 3EDKA 1H11A 4UTFA 4HOZA 1QVBA 3VDCA 3PZGA 1PJ9A 1W2PA 2J47A 4TVCA 3NJ3A 3WDQA 5A8MA 3CHCA 1J0MA 2E24A 1FHDA 1PPIA 3QHOA 1ZBCA 4D71A 3PBGA 4N42A 5D8WA 4FF5A 4DWSB 3WQ5A 3GDBA 1OGBA 3BMVA 3S6TA 4DUVA 4ML4A 1O6IA 1A3HA 2B31A 1WZAA 3RM9A 3VGGA 4D6GA 1BQCA 3VGDA 1E6NA 2BHUA 2WHJA 3L4VA 5GNXA 3DYMA 3N15A 3OZOA 3QHMA 2ZE0A 1SMDA 5KZ6A 4AYSA 2RGMA 1G0CA 3T0BA 4DM2A 1VRXA 3O6AA 4EE9A 1M01A 2XJ7A 1NWSA 4AZIA 1F4AA 1OGGA 2J25A 3WH7A 2E22A 4JFVA 1H3GA 1NM9A 1JF5A 3EDDA 1E5JA 4PMUA 2WW5A 1ZS2A 2J75A 2DSWA 3TTYA 1GPFA 3AIUA 5BXSA 2DIJA 5I3DA 5HBFA 1GHRA 3WUFA 3M6DA 4AZ6A 4R27A 1EO7A 2VL4A 2ZX6A 3II1A 1BTCA 5CLTA 1VBUA 3WH9A 5AC5A 5F7UA 4B9ZA 5CG0A 3FY1A 1B3VA 3RILA 2PBOA 4PRWA 3AMGA 1TA3A 1DTUA 1ITXA 4H7VA 4E8CA 3SCOA 4TVDA 3HN3A 5CGMA 3GXDA 4X9YA 4Z2LA 1JZ8A 2YA1A 5JBDA 4A4AA 2JE8A 3VINA 4D6CA 2XGIA 2WMIB 1M53A 1X1JA 3NDYA 4W8AA 5IHRA 3AROA 2QMJA 1E55A 4M8UA 3EMZA 1FA2A 5HPOA 1BPLB 2WMGA 1GOOA 1FOBA 2QPUA 1OGSA 2FDMA 1GNXA 2F2HA 2D23A 3W28A 1RWHA 3ZQ9A 1OT1A 1VFOA 4AZBA 3POCA 1RD6A 3RO8A 3NSXA 3AMKA 2PWFA 3CH9A 3VIFA 4U5KA 3WNLA 3J7HA 3ZR6A 1E6SM 4PBGA 1KFWA 2JFEX 2BY0A 1GVIA 3GXFA 3WQ4A 2QV4A 1ZJAA 3MO4A 3OB8A 3AICA 5ABEA
chains in the Genus database with same CATH superfamily
1XX1A 4Y9PA 2R1LA 1W3TA 4RDWA 1LRQA 1WAWA 1J2BA 3KL5A 2TMDA 1JD7A 1H5VA 2DH3A 3RPDA 1SJDA 1L6YA 3SCRA 4F4RA 1GWJA 2XM2A 1F07A 4D9PA 5I24A 1GVRA 4E38A 4OUIA 9XIMA 1XRSA 2QCEA 4XD3A 1ECQA 4JCMA 2FJKA 1Q63A 3D46A 4PMDA 3BSGA 3E2SA 3RDKA 1TRIA 4PRTA 2O9TA 4MJMA 4L1XA 5FJTA 2F9RA 1JZ3A 4AEOA 2X8RA 5FL1A 3BJSA 1I4NA 4AD3A 4DJED 5K4XA 3BV4A 1E72M 2WCAA 4GUHA 4BQ3A 1C8QA 4FX7A 6ALDA 1E6ZA 1C8YA 5D9OA 1UOKA 3GAYA 1R7OA 2E9MA 3VKJA 4OV4A 1WZLA 5I79A 2X2YA 4RX0A 1ONRA 4K68A 4K39A 5C9XA 1QASA 3WJSA 2QJGA 4GVFA 4HT3A 3IIXA 4RDYA 2JIEA 3AXXA 3MA8A 4C6OA 1LXKA 3TIMA 1NQ6A 1HO4A 4UFLA 4RV3A 3INPA 1I45A 3MMUA 2C1HA 1ALDA 1XBYA 1PVNA 4W93A 1Y7VA 4K2SA 3T0CA 4EPEC 4KCUA 3KS5A 2OQLA 1HF6A 1OHLA 3JUGA 2ZUMA 3W2UA 3TJXA 4GUJA 2Z29A 3BW4A 2W5FA 3MV11 4FNUA 4OT7A 4MWAD 2TAAA 2VZKD 3TQ0A 3WCZA 2PRLA 2CLLA 4QE5A 1RA0A 1OZMA 2ONEA 4JX5A 1L8NA 4MY9A 2A1YA 2DZPA 1NFBA 3AXMA 3N1AA 1JDDA 2YR1A 3VOHA 1FP9A 3G0SA 3LXCA 4EPKA 2HE8A 1PZ3A 1BVNP 4YPJA 3VTRA 2G3JA 1E71M 3VCRA 1EXBA 3PTQA 3BARA 4U4MA 4Y2WA 4E2OA 3PY2A 2WDAA 1F9CA 4QCEA 2JF7A 2JGYA 2FPYA 3CHDA 3VNKA 3BGGA 1IHIA 2JKEA 1N8FA 3VIMA 1KRBC 3MC5A 2FH8A 3M0LA 1MNSA 4AVOA 1W32A 3DHUA 3OLDA 3K8LA 2WCOA 1HMWA 1KBBA 1QO5A 3CC1A 1SO6A 1PAMA 5AYIA 3W01A 5CLWA 5A95A 2EBNA 2Y2WA 3DFSA 2RDUA 2QUNA 4X61A 1EYEA 1DJQA 3MU7A 4GNKB 2PDUA 4ZB0A 1E15A 3W24A 2P0OA 4L5ZA 1AJ0A 1TG7A 1H1YA 1RCOB 3NZ1A 4HZ7A 1EPVA 1PZ0A 4EWJA 2PDYA 2J6XA 1UKOA 5A1AA 4TV5A 3EZ4A 3AOFA 2CCRA 1WBJA 1Q6RA 4DJDC 4LANA 3Q65A 4R7OA 1Q3NA 3KTCA 2J7FA 3PN8A 1TWZA 3QY8A 3W27A 2A7PA 4FLRA 3PNZA 3WF3A 5HJYA 3H2NA 3B05A 1HKMA 3S1VA 1M03A 2VI0A 5LNUA 1C8VA 2PDQA 3PS7A 3A9BA 1O5RA 4IXHA 3LGGA 4C6NA 1OYCA 2EPHA 3PZQA 3GVQA 2D2HA 5LIYX 1P7TA 2QW5A 2UZ9A 3TN4A 1UZHA 2PWVA 3KFTA 5GPRA 1XXXA 3KWSA 4YWSA 4MNJA 4Z42C 2P8CA 3CQIA 3L67A 4J27A 4UFJA 1FWWA 4K36A 3DGRA 3S9YA 2V6AA 2ZX5A 5HMEA 3VZXA 1W1VA 1CGVA 3QM3A 4JHZA 3O05A 1QHOA 1RD5A 3E5BA 2QUMA 3EA1A 3F7JA 2X42A 1IR1A 2XISA 3CWHA 2A3HA 4J3XA 2KAUC 3S2LA 1OJOA 4NNCA 4RZBA 1DXEA 2P3EA 4UNKA 1OD0A 1Q6GA 4H00A 1KQYA 4BQ2A 3PPHA 4BF9A 4OGZA 5LXEA 4JY8A 1AD1A 2GK1A 3H54A 2QIIA 5AC8A 1KFEA 3S42A 3ECQA 3UA3A 1FWBC 5DT7A 1NDZA 2E6FA 4DF0A 1JGMA 2A3CA 2OOGA 1K7EA 3TC7A 5CZKA 1TELA 4E4FA 3ARXA 4ZFCA 4L6HA 2NQZA 3WG6A 4O16A 4WHBA 2OXNA 2YJQA 2VCCA 3FFSA 2YL9A 3EEZA 3OA3A 1NH6A 3WQEA 2YBUA 4KCWA 4MB5A 4RNHA 1UKPA 3LCWA 1TV4A 1EC8A 4NAEB 3V16A 4BY3A 3HGRA 4O1BA 4AU0A 1O0SA 5E6YA 1ZAHA 1F3WA 2BASA 3N2XA 2F38A 2VX4A 2GVLA 2ZFAA 2YL8A 2H6RA 4MJ4A 1MZHA 3KCLA 2VGGA 3O6YX 1RVGA 2EG8A 2NQJA 1DJWA 2VFHA 5EL1A 2WQPA 1Z42A 2MANA 2X1SA 4HMCA 3DFYA 4ZB2A 4CQCA 5KETA 3ZJ7A 4AQLA 5KMYA 4YYCA 3GTNA 1D3HA 3G18A 3W71A 3TWAA 1NWTA 3W7KA 2PF8A 2ZRZA 4QP0A 4LB4A 3FAWA 3L0KA 3MSYA 3U7BA 4L9XA 3AIEA 3UCQA 4MWAE 3TW7A 1V3LA 3MSDA 4LTSA 3V75A 6PTDA 2PS2A 4B16A 2GDVA 3SGUA 1O4UA 3P74A 3GDLA 3I65A 2PWGA 1X1HA 2ZUUA 3O7UA 3DUGA 4H6QA 3UJFA 2PPGA 2PB1A 4GQGA 2CBVA 3VIKA 3G1XA 4HZ6A 3LQLA 2OYMA 4HK7A 3ITXA 2HQAA 2HMCA 4ZOAA 4TMCA 4KT2A 3WLQA 4D2JA 3S2NA 4JQAA 1XYFA 2E6DA 1R3TA 1UR8A 1YPXA 4Y6GA 2VX6A 1R3WA 4Q4SA 1OF6A 1VS1A 4GZEA 1WKEA 1TCMA 2PDBA 3UWZA 1N2VA 4CNOA 1MEHA 5A2BA 3LN3A 1G4EA 2BVDA 2VYOA 4F0MA 1E9ZB 4PTVA 1JQXA 2QULA 3MKVA 4GXMA 5T8GA 1FDZA 3M64A 1ONXA 2ACQA 3QOKA 1J0NA 4JIQA 1HGWA 3GH7A 1FWDC 3WEZA 1UIOA 5TAOA 1O5XA 3B0PA 3QZ6A 3VC6A 3UPMA 1XG3A 4AAJA 1GVSA 3IGUA 2TSYA 1QK0A 4LGXA 1RAKA 3VD3A 3I68A 2F2KA 2VT0A 3TUUA 4CGTA 2ZTKA 3BSMA 2C79A 3M0KA 3UXLA 1XUUA 2YX0A 3UY8A 3NTYA 4IG2A 4A3RA 3KL3A 1X98A 7REQA 1WA3A 2OODA 4H8HA 2A3AA 3BANA 3LNMA 4GZJA 4L4PA 3T8LA 1TPB1 4JCLA 4P7QA 2DJXA 3ZZ1A 4QBXA 4ERIA 5CGQA 4GVGA 1LDCA 1HJUA 1R5YA 1C3FA 1YPIA 4PB3A 4QEEA 2ISDA 1MUCA 2GK1B 3FXYA 5A69A 1DWAM 3UZJA 1JG9A 4WJ8A 4HSNA 5AB3A 4O28A 3U4AA 3QQ0A 3A3HA 1R3SA 2I5IA 2OFJA 5H6HA 4YIWA 1OG0A 4JQ4A 4UOJA 1H49A 1KM2A 4GY1A 4MHBA 1TMQA 3TZFA 4DYJA 5A6SA 3TH6A 5HQEA 3T44A 4DWDA 1J0KA 4QTGA 1V0MA 4EXBA 2YDAA 3W72A 3S83A 4JYFA 4IGSA 2ZVIA 3PPCA 4RXFA 2GYIA 2Q3OA 4AC7C 3KBVA 3T2QA 3CZLA 5EMLA 1EJUC 5F4SA 1QATA 3T4WA 2O4QA 4QM1A 4O54A 1SJAA 1UH2A 3EWZA 3R5EA 2EPNA 1W5OA 1ZY9A 2VZTA 1UJQA 1W1ZA 1US0A 3ATYA 3M4HA 4MYXA 3REQA 4BHYA 3UYIA 4Q8UA 3TP4A 3VIOA 4NNAA 4S3JA 1SFLA 3GDMA 4BWLA 1PCWA 2AQWA 5HQLA 4AWUA 2DSKA 3EX1A 2O92A 3ZSSA 1FDYA 1B3YA 2E40A 3QV7A 1GT8A 4TOQA 3GRIA 3BGAA 3N04A 2WVTA 4GISA 3QV8A 2YIHA 4TTUA 3GYEA 3UPWA 5BNKA 3PPFA 1E9LA 3HMCA 1AW1A 1JDAA 3CUHA 1JL8A 1HKWA 1MFVA 1KBJA 1H1NA 2XVPA 1UR0A 3TYEA 5LGZA 1PHQA 3NUKA 2BXZA 4KRUA 1ADOA 1B31A 1KM1A 2XIJA 3BV7A 2XN2A 2VMFA 3PWAA 1PZ2A 5I3GA 2NUYA 5C6MA 4LUSA 4QG6A 3WNKA 4UNIA 2YW4A 2BOEX 4GG9A 4X2PA 1EF2A 1A4LA 4BI6A 1AH0A 2ZXBA 1VCGA 1AG1O 1XGDA 4HA3A 1UPPA 5J04A 2QGYA 1KRCC 3BAYA 5DN1A 3BWWA 2BV9A 3KVKA 1X1NA 3TR9A 5LIKX 3W2JA 5GQBA 4AVNA 1XRTA 4GIYA 2CBIA 3QSTA 3PB2A 3F4CA 2VR4A 3C5QA 3NPUA 4MF4A 2H3DA 2J78A 4Z1YA 3ARRA 1WXYA 4UMCA 3V5FA 3CM4A 3IWPA 3KLKA 1PSCA 2J8TA 3MS8A 1XL9A 3LZ3A 2WPGA 3UVAA 4FXRA 5HMFA 3OODA 3BOXA 4K8HA 2PGFA 3S5SA 1A5SA 1ESWA 3AISA 2BHYA 4JGDA 2HPMA 4WKHA 3HFYA 3HJZA 1EGVA 1NARA 1WCGA 1NJJA 2DVTA 2WZHA 4AIEA 3L21A 4GACA 1IT7A 1CNVA 1P0BA 5ENLA 3M0MA 1KXTA 3S9IA 3P5YA 1KTNA 1XSJA 2PTYA 4C5YA 4C90A 1W9PA 2BGQA 1WX0A 3PTMA 2Y4SA 1SZFA 4LYRA 1B4EA 3W88A 3THQA 3ZT5A 4PUUA 4YTTA 4EK7A 3MYPA 4I3GA 3WQ8A 4RW3A 1D8CA 4IG2B 2GUUA 1T7LA 7REQB 4HPXA 1IR2A 4I5RA 5FI8A 1JQVA 2PDIA 4LAKA 3ZVHB 2ZRYA 3NQMA 1TMLA 3W3OA 1DYSA 1DJYA 4D1IA 3GX9A 4JFSA 4UOZA 1YW1A 5DX7A 3I7QA 1B3WA 3W9ZA 3DXIA 3CL6A 1XHGA 4FLSA 1O68A 1ELSA 4OVXA 3NPWA 3WFZA 3OP2A 3FK4A 5HUOA 1PKMA 1CW2A 4PTDA 1Q2SA 4XX6A 5AYBA 4J7RA 4ZB5A 3LB0A 1XIHA 3WF1A 4TXEA 3M7SA 3CEUA 3GU9A 1R2TA 3V1PA 4AF0A 4FIRA 3HU7A 3APTA 1LQAA 1EKOA 4JTQA 1TPVA 2Z00A 3JVAA 4Z2IA 3G6MA 4OBTA 1QPKA 2DSVA 3IJIA 2GVJA 1EH9A 3LU2A 4M7SA 1HUVA 2XFRA 2D2OA 3M5XA 4ATLA 3UY7A 3WELA 1AQ0A 5JIPA 2WMFA 1EJ7L 4DF2A 2Z25A 2A3EA 3NYDA 4L1WA 1A0CA 2CZEA 3QQWA 4AWTA 2YCKX 1B4KA 4Q33A 3TYUA 4EXQA 4LPCA 4H8VA 3WEMA 3F4DA 1AZ1A 1NF7A 3OIHA 5BXPA 5M17A 4C1NB 4RDZA 3RUBL 5HMDA 1FCVA 1S3HA 2IQTA 3DX5A 4F2TA 3ZS4A 3MI6A 1WB0A 4TTGA 3VDHA 1JNDA 3H7VA 4HOXA 1W9XA 3AIBA 2P3ZA 4XBSA 4LUSB 2CETA 3TROA 4YYFA 2DSUA 4HQVA 2GJLA 3LCGA 1V6WA 5GJPA 2G3NA 1XLIA 1MYRA 3W22A 2X0YA 3LGEA 4WK9A 3HOJA 2OO6A 3EXTA 1UR4A 3LTPA 2ZC8A 4DO6A 2INEA 2QJHA 4PGLA 8TIMA 4NRSA 5I6SA 3OW1A 3W26A 3APGA 3QZAA 2VELA 4RNJA 1AVAA 2A85A 4UQDA 1BYDA 5CSRA 3KUMA 3EXRA 1H5YA 1OD8A 3NIYA 3G22A 2DORA 5EMYA 2HK0A 4HA4A 4KWUA 4F2BA 4MNLA 2IKHA 1IIHA 3S1XA 1VHCA 4F0HA 1WZMA 2HVOA 4XSMA 4C5ZA 2GGGA 2Y88A 3MCOA 4TV6A 1EO5A 1UUOA 4EX4A 4GI9A 3O16A 3ZJKA 3NEVA 4S3EA 2G37A 2RDXA 4ADSA 3DU0A 3VKAA 1P6BA 4JN7A 5AY7A 1BEUA 3LX9A 1E1CA 1XS2A 4PTXA 5DRIA 1UZDA 4V15A 3CZJA 3SZ8A 4IJBA 4HNLA 2WK2A 4H3DA 1VEPA 3UJSA 3NQBA 3OOQA 3S46A 4PN2A 4GLEA 1F4HA 2TYSA 1A5BA 1KGWA 3AHZA 1T6MA 3KX6A 4QS6A 3VX0A 4CNSA 3TW9A 1S5WA 4NJKA 1PYMA 1FXPA 1Q4NX 4KWOA 1AQMA 1UH4A 2YFNA 5IDIA 4HHPA 1QJWA 4R9XA 2I14A 4US5A 3W1MA 3ZLGA 3ONCA 4MGGA 3W75A 3AIRA 4LBUA 3ARWA 4DUXA 3C3NA 4OFCA 1V77A 2CLHA 3ZFHA 2BS9A 2I56A 4H8UA 1UR2A 1HVXA 2ZX9A 2VDIA 3PFRA 4L80A 2CNCA 1WNOA 3LCHA 3LV6A 3BPWA 1OK6A 3SUTA 1VPQA 4AUBA 1VQTA 4Q7IA 2Y5JA 3N25A 4E2DA 1RP9A 2DSZA 2V63A 3ZSTA 2WJEA 1EIXA 1S2UA 3SGZA 4PCTA 3S5OA 5FCZA 2HISA 1ZCCA 1QAPA 4I8DA 1UD6A 3BK0A 2QVNA 1TJ1A 1R30A 3WMSA 2O56A 4C6KA 4J3UA 2XVNA 4EPDC 4GH1A 1TPEA 2GDQA 3MUIA 1CYGA 2O55A 3CPGA 1HJQA 1BWVA 1XLDA 4CN1A 4JQ3A 3PWGA 1QR7A 3TSMA 1E40A 1T8XA 3W07A 4J28A 4U5IA 2JKPA 4XAPA 1RBOB 2NSOA 2XYLA 3CU2A 4S3AA 4OIFA 5BOFA 4AZCB 2DZBA 3W7MA 3OO2A 5CJ5A 3DFHA 4UTKA 3SCSA 2FYMA 3V35A 3P2VA 2VZOA 2E7FA 8XIMA 1GQIA 4C7GA 1EJRC 3MHFA 4Q3MA 3MDWA 3SIZA 1HX0A 1PWLA 2VRKA 1M65A 5LNSA 4PSPA 5EMKA 3ZT6A 3H53A 3WEOA 2OT0A 2ZBTA 2A21A 4UTTC 1JCLA 4AEFA 3R2GA 2VRQA 4WJEA 3TFCA 1JCXA 3UNTA 1S1RA 1NF0A 5HANA 3F5JA 4WDUA 3YPIA 4GO9A 3MKCA 1KM3A 1KCLA 4JL2A 1HP5A 4TX8A 5CPOA 1T96A 4CU7A 3SCTA 3TQPA 1ZL1A 1C7SA 3WX7A 4WXZA 2DT3A 2GQAA 1H7XA 4FLQA 2YCLA 1XLFA 2NWSA 1AL8A 2YOCA 4KH2A 2HVMA 4LQ1A 1S2VA 2FJUB 4NHVA 4LXFA 2GVEA 4Z08A 2X7VA 5E0KA 1E9YB 3STPA 4M80A 4DXXA 4ZGYA 4GQQA 3G1VA 2A0NA 5AC4A 3TOPA 3CQHA 1MW1A 1PL9A 3W7LA 1J93A 2EJ1A 3W38A 3LMZA 1V6VA 1Y65A 3G8RA 1NFGA 5EU9A 2QVHA 5A8OA 3G1DA 4JX6A 2DT0A 5HWNA 2V3GA 3OYXA 3AI0A 4FOJA 3B3DA 1GTHA 4DZ5A 2QLYA 3EOSA 1BQGA 3UQNA 2OG9A 3K4DA 1RQEA 3VZYA 1K3UA 3RX3A 3SRHA 4G56A 2KXSA 4GY0A 2FZMA 3FKRA 5GNYA 3LOTA 4LUJA 4E0CA 4M29A 5C2CA 4MJZA 5CPTA 1BTMA 1CXHA 3I3EA 3NL2A 3V0UA 2OZ8A 3BC9A 2W9MA 4QSHA 2VEIA 2E8ZA 4K8GA 3BLOA 4LX4A 1FWEC 3I4EA 2VEKA 1H4PA 3RX2A 1U5HA 3IJQA 2GZXA 1VAHA 1I2NA 1PZ1A 1ZENA 3L2LA 2E28A 1JDFA 1TPUA 4AXKA 1FWIC 4X3ZA 1NOUA 5IXEA 3NA8A 1JD9A 3MSGA 4Q22A 1EUAA 1DJZA 1E6XM 2XN0A 3GDKA 5LNWA 3HV8A 4LC6A 4PCSA 4ZQPA 1B1YA 1TPDA 4M51A 3EX6A 3P80A 1P1MA 2WAGA 3F1QA 1NIUA 2J13A 4HHLA 1HZYA 2VGBA 5GJNA 3LHYA 3FYPA 1JVNA 2YKKA 3W1QA 1WQ5A 3WLJA 2NXHA 3GUWA 4JTDA 4P7RA 2AAAA 4Y8FA 1OJMA 4ZSTA 2ZTJA 2BHZA 3UG4A 4KERA 1IZCA 1WE5A 4DNHA 3UZXA 3VMPA 3MZNA 1WAUA 2R24A 1R3RA 3QVQA 4H04A 3FJ4A 4AZHA 1UR9A 4O8RA 4DZHA 4JFWA 1O1ZA 3LCLA 3GG8A 1BG4A 4XO7A 1E51A 4XD6A 2GWNA 4DM1A 5CJMA 3MUY1 1GOXA 4GVIA 4JNMA 2WJFA 1E6PA 2ALDA 4B3KA 1J0JA 3BH4A 3KVLA 3NURA 1SYTA 4ALDA 2H8XA 3JS3A 1Z9AA 1B3ZA 4ML9A 4NASA 1Z7AA 4O4WA 4W88A 3SEPA 4BA0A 3U2EA 1UKTA 3RHGA 5K4ZA 5FJIA 2ZRXA 3FV9A 1E1FA 1CGXA 1L6FA 2Y8VA 2Y62A 4FA3A 2WYSA 4HN4A 4C7DA 5D02A 3NO3A 5BW6A 4LVBA 3WD4A 5I3IA 1YMYA 3HGSA 3ZO9A 3TZNA 2PRMA 1K02A 3L9CA 2CHOA 1B5TA 3WSUA 2X1IA 3A5FA 4IHCA 3SI9A 4DIAA 1E6QM 3B9DA 2DFAA 3MV01 4XUGA 4PB4A 3IT4B 3PTKA 4A3UA 3UR2A 1Y0EA 2BBFA 2A79A 5D05A 1X6UA 2WMJA 3OLIA 3TCSA 2GDUA 4DJFA 4F79A 4XKYB 1VGAA 1V6TA 3CIWA 3LYEA 1WDSA 1TZ7A 4B3ZA 4WIWA 3EAUA 1MXDA 2ZRUA 2FH6A 1H7NA 4HCLA 2J74A 1D2KA 4CUCA 2VC9A 5BXRA 3KVJA 2ZCGA 3TAOA 5CC3A 3N4AA 4W8BA 1OYAA 4N6FA 3VYLA 3NZGA 4MFDA 4UFMA 1EDGA 4XQ6A 2Q1FA 1XF0A 3AIVA 5D8ZA 4UTHA 1XYZA 3PP7A 4ZO6A 3R8RA 3GXMA 4N4QA 5D9MA 3SRKA 1S2WA 5FF3A 4N9BA 4B3LA 3MUCA 4V28A 3OEXA 2Z4GA 3RJYA 3M46A 5BRQA 4UB9A 4PE8A 5LIWX 2YL5A 3EDKA 3C56A 3IK4A 1H11A 4LUYA 4UTFA 1CB7B 1A4MA 3HGOA 5AZ0A 1XBVA 4TVCA 3BQ6A 3CHCA 1FHDA 3IVSA 1GYMA 3PBGA 4N42A 5D8WA 4GFSA 3WQ5A 4L7ZA 3BMVA 4DUVA 1XFCA 5EMMA 5BRBA 4YCOA 2B31A 3W7GA 4LALA 3VGDA 3CB3A 1F6KA 4ERGA 1QUMA 1CCWB 2ZC1A 3FJLA 5HATA 2C14A 1DKWA 2Y7GA 3ZLHA 4PB5A 3MUXA 1FWGC 4M3PA 2BX7A 3KHJA 2X30A 5KZ6A 4AYSA 3NGFA 5DBTA 3O6AA 2PA6A 4GUGA 1UMLA 2QDGA 4EE9A 2F6KA 3PUOA 1NDYA 3PG8A 4AZIA 2J25A 3STGA 3N14A 3I7RA 1NM9A 3ITOA 4AHOA 1ZS2A 4YJ5A 2DSWA 1LRNA 2Z1XA 3TTYA 1GPFA 4IX2A 5I3DA 3PJWA 4I90A 4LS1A 4B2DA 2NVCA 4R27A 4KW2A 1F05A 3EGJA 4QJ1A 1QO2A 4XAZA 2G96A 1GYLA 3OHMB 4B9ZA 1QW7A 5HINA 1IF2A 3N73A 3S6OA 3FY1A 3CHVA 3PBUA 3RILA 2IPFA 2ON3A 4IP4A 4E8CA 2QCMA 3FKKA 2ODOA 3HN3A 4POCA 2X40A 4H6RA 3NVTA 3VE7A 1A5NC 1POKA 4HTBA 1JZ8A 1GVFA 2YA1A 5JBDA 2QXWA 2AL2B 3H4GA 2KX9A 1M53A 1FUYA 3QGAC 5HULA 2QMJA 1E55A 3H2CA 3P5ZA 3HPFA 2QPUA 3QBUA 1OGSA 4MLRA 2D23A 2QPXA 4C65A 2FZ8A 4AZBA 1RD6A 4XBKA 2CW6A 3RO8A 1GVEA 3AMKA 1I0BA 3CH9A 2G4JA 1XIDA 2ISVA 2QEZA 4B5UA 3ZR6A 5HNRA 1E6SM 2JFEX 4DLFA 3WQ4A 2QV4A 1ZJAA 2MNRA 5XIAA 1MSSA 3WF4A 2DV0A 2ISFA 2QCHA 5JUVA 3LCIA 2J88A 3BLKA 1K7XA 1BVZA 4NKCA 3N29A 3W2LA 1BAGA 3N2TA 2OSWA 4GJIA 2BSLA 4PR4A 4ZBCA 1L2QA 4C6BA 1MI3A 3U6WA 2IPWA 3IANA 3MJMA 3S4TA 1UA3A 2JQXA 4X2RA 1L9WA 3OQ8A 2G8ZA 1XRVA 2PU1A 4JDYA 4PUWA 1OFQA 3IIPA 2IKGA 3WLOA 3WLKX 1CGTA 3SQMA 1VB9A 4RPPA 1XH0A 3WNPA 3ENLA 4NXKA 1SR9A 3TXZA 5SWUA 1XPGA 1EGZA 2EEXA 2XVGA 3GTHA 4IMFA 2KXRA 2X0HA 4WVXA 5I3HA 4O1EA 2DY3A 3IS4A 3VD7A 4MG4A 1W1IE 2XFFA 4U33A 1E73M 2YYTA 1OC7A 4O50A 1W5QA 4G7EA 3O6DA 4EF9A 7ENLA 2ZOXA 3JZUA 3LHZA 4RZ4A 2Z0IA 5AC6A 3GQYA 1PKNA 3DBNA 4HPNA 3NR0A 4EPBC 3W02A 3H22A 3WMCA 2YL6A 8RUCA 4H01A 1TO3A 1B9ZA 2HS6A 2G97A 1I2OA 5A6AA 3KBWA 3PZOA 3VXGA 5EB8A 4M5PA 3VO0A 3S5ZA 3CV6A 2PTXA 4ZQCA 3FN9A 4UMBA 2JGQA 3WK1A 3GTXA 1J12A 3C2EA 2WKLA 2ISSA 1W91A 1T99A 1I9CB 3QMTA 4ZQOA 4Z1BA 4TVUA 3MBDA 1A3XA 4GMEA 2W27A 4BF7A 1EFZA 1YDOA 3L12A 4AD0A 4J3TA 4WX2A 4IIEA 1TREA 1PKYA 2V8ZA 1S46A 3GUGA 4LRSA 3R10A 4UQ9A 3NQ8A 1DXIA 2HE5A 1QI0A 1G4TA 1UQYA 1W1TA 4A22A 4MKVA 2NV1A 4TMBA 2PBGA 3N4EA 3WF0A 1GVYA 2BVWA 5D30A 4CQ8A 1OQFA 4H9VA 4KEZA 1V03A 2Z1WA 3E0WA 1UWTA 3WK3A 2VHLA 3STFA 2YXXA 2NW0A 3LI0A 3AMLA 1OCNA 2XSXA 3R0DA 1K8YA 4IFKB 4XZNX 3R58A 1IQ8A 2W63A 2R1KA 1OVDA 5HR7A 1SR0A 3EWWA 3L0GA 3HPSA 5F1VA 4FXFA 5JU6A 1IGWA 1S3TC 1GG0A 1CB2A 2VXNA 5E09A 1RQHA 1UB3A 4Q8WA 3WBEA 1O66A 3B4YA 3TONA 1R9XA 3VDBA 3KOZA 3FSTA 4AX7A 3WBAA 1HFBA 5IHSA 5CAKA 2PD9A 4LT9A 4AZ7A 5K9CA 4EXAA 3WQVA 5HR6A 1UPMB 2QHAA 3D0CA 3SAZA 3P3BA 3CH0A 2AL1A 4W8LA 1US3A 4DO7A 3GNOA 2O0TA 3SY1A 4NSBA 4HSHA 2V5DA 3G0XA 4O1DA 3T1GA 1MUMA 2FHCA 1VBGA 2ALRA 3N9SA 3WUEA 2VVSA 4RV8A 5ABHA 3SGGA 4CU6A 2CLEA 2E0PA 3C3UA 4ZE5A 4QXIA 1JIBA 4CEUC 1KBLA 2Z24A 4HKPA 1LYXA 2VZUA 3NQGA 4BJHA 3P82A 4RDVA 4Q8TA 2J7BA 3AS2A 1LWIA 2HBXA 4MADA 3CL8A 1N7PA 3BQ5A 4X63A 1FP8A 3T09A 1M6JA 1U5VA 1QI2A 3E38A 2CESA 3KZPA 2YZRA 5I09A 4IZGA 3IAQA 3SQSA 2J6VA 3P6LA 4GQRA 1J0IA 3PBMA 4D8AA 5CBJA 1HM2A 4RE4A 1J0HA 4DJEC 1SO5A 3L2MA 4BFAA 1RWFA 2VZVA 3MDUA 1MVYA 1L6SA 5DANA 4W86A 1A0DA 2WXDM 3NGJA 4GI4A 3B0YA 3G1FA 4UCGA 2GQ3A 3UWUA 4MOZA 1RWGA 1UBSA 3VMNA 3GNDA 1FWFC 4WY0F 1UP0A 4FIQA 2JKAA 1GOKA 3PF3A 4ILSA 1JCTA 1K03A 1QI4A 3IRDA 1GW9A 3MBFA 3NQ2A 2D20A 4LFYA 6TIMA 1B54A 4LAUA 3EX4A 4D6JA 3RGTA 2DZUA 2VCAA 1XICA 4A2RA 4CQ9A 3MCMA 2G50A 3A4XA 3QF0A 1F3XA 3N9KA 2WNNA 1P0KA 4LV4A 2XU2A 5D37A 1TJ2A 3CL7A 4C91A 1R86A 3OYZA 4O19A 3T9PA 1MXGA 4OE7A 4AZGA 1G69A 4L9YA 2QF8A 3LZ5A 2OWWA 1K9TA 4MWAC 1BGGA 3GTFA 1X6NA 1EGUA 1JCMP 2DGAA 3GZAA 4WR3A 2EO7A 2Z7GA 1M7XA 2VZSA 5BWAA 3F4VA 3FYYA 2GVYA 1EP2A 1MZRA 4IUGA 2PI6A 4HNVA 3HPXA 4QQUA 1ODZA 4UR8A 3O9NA 3WQWA 3DN5A 3UXDA 4B4HA 1LWJA 3AHTA 4X22A 1M9HA 1JUBA 1N8IA 3M47A 1DE5A 3LBOA 1OC6A 3BVJA 3C2OA 1U5JA 3VNMA 1QPNA 4M6QA 4XZBA 4S3KA 3F5KA 1YNPA 1H61A 1LG1A 3WNOA 3I6TA 2YDRA 2X2GA 2EXOA 3EYPA 3K8MA 4P8UA 2QS8A 1IWPA 2I9EA 4MB3A 3VAVA 5C54A 1E6RA 5C7HA 1VYPX 3UXIA 3HIJA 2VQUA 4A6GA 2Y5EA 1JAEA 3P62A 2D3LA 3M0YA 3ARZA 4JTRA 2WZMA 1BG9A 3KBMA 2Y1HA 5K3VA 1HMUA 2C6QA 3NAVA 3NQFA 2CWXA 2PC8A 1KA9F 1ZZMA 3DI0A 3CAKA 3N2CA 4DHGA 1R3QA 1W54A 2GVGA 4DNMA 3RU6A 3AHXA 4HHMA 5F4XA 4S3FA 4ZSUA 4DQWA 2J8FA 1MEIA 1ICQA 3UNDA 1OIFA 3FA3A 4NJJA 3GBDA 4IWWA 4K6AA 1FHVA 1MW3A 1E4LA 1ZGDA 4DO4A 2QCFA 1A3WA 5L6UA 1W9VA 4BEUA 1CXIA 1W31A 3ZT7A 1U30A 2H3BA 4FSAA 4OECA 2FTWA 1XDLA 3SCVA 3BCFA 1LWHA 2PDJA 3SECA 3N2BA 3N18A 1VBHA 1KGUA 5DEZA 3QKZA 4JTTA 5CSUA 1LQ2A 1XFBA 3GHSA 2ZQ0A 3WQOA 2OEKA 4H2HA 2ZWYA 1EC7A 1HL8A 3IIVA 3PBYA 3USBA 1TV5A 2RDWA 3QEZA 2NX9A 4C6DA 3A4AA 1AMYA 2CXGA 2CEQA 3GVRA 3SY5A 2IW0A 4U28A 4ZL1A 4PBFA 1RCQA 4LCSA 3GR4A 1YXDA 1ZJHA 4JIRA 2GLKA 4HJWA 1JYWA 2IXUA 4O4VA 1DIOA 2B0MA 4UBPC 5F2MA 3NSNA 1O94A 4FX8A 4DN1A 2CHNA 3VIPA 3G1YA 1CLXA 4X9SA 4XTDA 3IJ9A 1KM4A 1QPOA 4OUEA 1CXLA 2F7FA 4HNCA 3L7RA 3M44A 4ZQNA 4IMAA 4C60A 4PH6A 1QW8A 1W8SA 2Y8KA 4Z2KA 3V0SA 1J0YA 1B3XA 1CDGA 4IJCA 4CCEA 2Z1KA 1RWCA 1UIPA 1N55A 1H62A 3UWQA 3IJ7A 3TTEA 4CD7A 1P0EA 2Z6IA 4GZIA 4ASTA 3PPGA 3WZ0E 3AAMA 3F2DA 2DU2A 1TFVA 1YE6A 4V1YA 4E6MA 2QJMA 3LHTA 1J9YA 1K9DA 5C9UA 4OZOA 2WLZA 1JULA 1MQPA 1OF8A 3H6OA 2QCLA 3HQ1A 3ONBA 3L23A 3CUIA 1WKFA 2BZNA 2E3ZA 3M0JA 1N8WA 3NYZA 1LORA 2CLKA 1VRAB 3ZMRA 3ZYZA 3UG5A 2PDPA 3B8WA 3RMJA 3LS9A 5FF4A 1FXQA 2WC4A 3SFWA 2XM1A 2PDKA 2HEJA 3WJYA 4KFNA 3NXFA 5BYWA 1W3IA 4BK9A 2UV8G 2WSYA 4KETA 4WDXA 2WM0A 3B97A 1CT5A 4DUWA 1YADA 3BMXA 3PANA 1F1SA 3R8GA 1E0TA 1Q85A 2ZX7A 2E67A 5CZ0A 1YBQA 2KZHA 1G7VA 1DE6A 4LY8A 1R3VA 2A7NA 1UBPC 2CLOA 1E0WA 3QV6A 2WVSA 2XWEA 1HG3A 1G1YA 4PUDA 1LZOA 2CKSA 1ZBKA 3UA4A 3D3FA 3VOJA 2P0IA 2E1WA 1FHLA 3QKEA 5AVHA 5LYRA 1CLKA 2YXOA 1WP6A 4MKNA 3M0ZA 5FJOA 1REQA 1W1YA 3COTA 1H7WA 4N6EA 4J3SA 4S1FA 1LG2A 2R1NA 4RLIA 1GEHA 1DHKA 2YA2A 4FP1A 1XSKA 3NM1A 3OG2A 1TUFA 4I9JA 5C55A 1TTQA 2QAPA 5I77A 3U57A 4DI8A 3ITGA 1L0PA 3QY7A 3V5CA 4IP5A 1I1XA 2VJXA 1OINA 1Z44A 5M5DA 2EAWA 3A6OA 4F9DA 1KLYA 4NI3A 3WIJA 3B04A 3T81A 4ZA0A 2PWUA 2VC5A 1JF6A 1RBLA 5H8MA 4IH3A 1YDNA 2GOUA 4AMCA 1JGIA 1I6NA 2XTKA 3VK5A 1ISXA 4RZ6A 2VFDA 3H70A 4XIMA 3R11A 4QJ5B 3BAJA 1GOIA 3SJNA 2BTMA 1HO1A 1VENA 3LV5A 3F2BA 5LIXX 1FCUA 1A53A 1WUEA 2Z26A 4Q8PA 2HNHA 4A8LA 1E3ZA 4RW5A 1HJWA 2NVDA 3TTQA 1TX0A 4DWSD 1LLQA 1BWKA 2PDMA 4UFKA 2ZX8A 5LGXA 4WOQA 1MEWA 3AC0A 3W53A 2VEGA 5FACA 3DDMA 3MMWA 2WM1A 3WDJA 2VX7A 4P8VA 2XIQA 3SCWA 4Y7EA 1QHZA 2D69A 3DGBA 2RJHA 3LNPA 3GFZA 2HS8A 4TR9A 1VFLA 3GR8A 1J79A 4QDWA 1AUSL 3BAKA 3C8NA 5CKSA 2FGLA 1MFUA 4LBRA 4YTRA 1D8WA 2O4MA 1DXFA 4D72A 5DMYA 4NXSA 3S1UA 2LLEA 1MNZA 2OEJA 2B7PA 2V2HA 2CU0A 1Q4WA 3HQPA 3PNUA 2FMNA 4REQA 4M19A 3NL5A 4JTFA 3I3BA 4V27A 2GQ8A 2VVNA 1XC6A 3THCA 3O15A 3TJLA 1UKSA 3THUA 4PEEA 4IM4A 4UWMA 1SSGA 2OTDA 5BOOA 4OKDA 3D47A 1ME8A 2QDDA 5CAHA 4UCFA 3UCCA 3VM7A 3NZQA 3VU2A 3W86A 7ODCA 3FAXA 5EMUA 3LERA 4LSBA 1R85A 3U5UA 4DRSA 4CCZA 4XTIA 3LXAA 5KITA 3BW3A 1UH3A 4V1XA 3C6CA 1QOXA 3QZEA 3QC3A 2R1PA 1V79A 1SVDA 4M1RA 1TPH1 4KBXA 1H50A 2WMKA 2VC7A 4O14A 1X7FA 3DG7A 1XC4A 1HL9A 4JKLA 1J5TA 1WPCA 3RCMA 1I2PA 1AQFA 3T0DA 3QW3A 4D6HA 1YBQB 1BHGA 2ZUTA 1KCZA 3PG9A 3UWVA 3AUOA 4MWAB 3QQ1A 4OU1A 2VZKB 2DQXA 3NSMA 4D6FA 4U2YA 1VHNA 4S3BA 5G4EA 3SN0A 4FI4A 4P7NA 4HNNA 1O1HA 3W29A 3W7PA 2RJGA 3LBMA 4S3DA 1IZJA 4DELA 5T26A 4H41A 3E74A 4KQNA 1UWUA 4YVXA 1L6WA 2R82A 1OYBA 4NU7A 1RHCA 1S5TA 3CV7A 3VDAA 1VP5A 2DUAA 2QNEA 1DWJM 3N6JA 2J8GA 3T0TA 3D6NA 4PMVA 4HK5A 4I9AA 1LRTA 3UWYA 4GCXA 1UWQA 5AHLA 1JYNA 1KCXA 4AWEA 4QQ3A 2DZAA 2P10A 3BLLA 1V0KA 1WDWA 4GOAA 3ZOAA 4DX3A 1FH7A 2I57A 1EJTC 4A3HA 1C29A 3GG0A 3TN6A 3DC0A 3CHEA 1Q66A 1IE7C 5CZTA 3OPSA 1OZQA 1GCYA 3MUZ1 2WHLA 5HNUA 5LA0A 2QT3A 3O3RA 1F3TA 1OB0A 1JZ7A 3F4NA 3E5PA 4E2VA 3G1HA 4AHPA 2R9RA 1QHPA 2DVUA 4M6UA 4KESA 4R3UA 4AD2A 3QHNA 4ROPA 1ZCOA 1LBLA 1WYIA 2FVLA 4AD4A 3LEPA 4JS3A 1KFJA 4QISA 4L4OA 4ERAA 3LQGA 3LHWA 5FJUA 4B5WA 1SW7A 2ZA3A 1EP1A 1CGWA 1HJVA 1WDQA 2E9LA 4W9TA 4GYKA 3CTTA 1MO0A 3ARSA 4FS9A 3GKAA 4GC4A 2Q01A 5GJMA 4GYPA 2WNZA 2QKFA 1VLWA 1Y5VA 4ZXLA 4HK6A 4IMDA 4AB4A 1QWGA 3WMLA 1YNYA 1KM6A 3UXKA 2W66A 3FX4A 4MPKA 4LJ3A 3IARA 2DZXA 3T2OA 3CLWA 3VI2A 4WGXA 4CQDA 1B30A 3NQVA 4HOWA 2Y0FA 3M0IA 3RK8A 3EOLA 3E6EA 1NU5A 2V5KA 4XAGA 3BJFA 2V3DA 2BLEA 3VD5A 5I02A 1VJZA 3ABZA 4UR9A 2BY3A 5I03A 2XWDA 3ITLA 4US5D 3CAQA 4GK8A 3BG9A 2XIMA 3BW2A 3N2MA 2GFTA 3S2JA 4WQ6A 3CYJA 3PAOA 3TNBA 1M04A 1VRDA 2YA0A 3POHA 4Z0SA 1ZJBA 1GQJA 1GVOA 4GGHA 2XGBA 8CGTA 3FDGA 3VNLA 2OSXA 1HQTA 3L2IA 3UGVA 3W1TA 3A3WA 2X0SA 3TYDA 1UC4A 1LXMA 1RQBA 4RXGA 3EOEA 2X7WA 4EF8A 3HJEA 3DFQA 4GPNA 3LPGA 1FVPA 3P84A 1W3HA 2R91A 1F9GA 3GE7A 1SZRA 3R0UA 1QNOA 4JTCA 1G94A 2VRJA 2GUYA 1DWIM 3WNMA 1EOKA 1UW9A 3OGRA 4XO6A 1XP3A 1KWKA 3G1RA 3GVGA 2X41A 1VEOA 5FAGA 1UQZA 4HPJA 1J6OA 5IBXA 1F6YA 3EPMA 1HL2A 3CBWA 1RVKA 4P8WA 1FCBA 4LUTB 1PXGA 2HROA 2PAJA 4AX6A 4OQVA 4C6IA 3KBUC 4QG8A 1S39A 4L64A 1PX8A 1KFBA 3F2CA 1N7KA 3WD3A 1KO0A 5AHNA 3CUZA 3HBLA 2Y8UA 3TR2A 3V36A 3LHUA 5I78A 4JDBA 1M7JA 3A47A 2J4GA 1HKIA 4O8AA 3Q2DA 3ITVA 2PLKA 4HNOA 4DY1A 1W17A 3TSBA 1RZMA 2DT2A 5HXMA 3I3DA 4WDWA 1TTPA 2BVTA 3WDIA 4Z0JA 4PMYA 1LL6A 2HXTA 1IT8A 2EKGA 3V0TA 2J62A 3XISA 1UCWA 3KWXA 4NAEA 3MY9A 1J8VA 3H55A 4Y96A 2OVLA 3UG8A 2F6UA 2WCSA 2OWXA 4D8OA 2CKRA 1WZKA 2POTA 3ZJ8A 4LRTA 2YBVA 4AZ5A 4GIEA 2E1DA 2J24A 4QG9A 3IT6B 1ODUA 5EBUA 4Q8MA 2E25A 5D9NA 4U2ZA 3W73A 1JPMA 1E1EA 3K1GA 3QLLA 1OSEA 1YQ2A 2CPUA 3WLMA 1JUEA 7PTDA 5BXTA 1XDJA 3GVWA 4IPPA 3PZIA 1XG4A 5AC7A 5KZDA 2X1UA 3TE9A 1PIGA 3VILA 5CJNA 3ZIZA 1LOSA 4KGLA 2XIOA 4EKJA 3NL6A 3C2FA 3MWCA 3T2PA 4LS0A 5LSMA 1QNVA 1W5MA 2GSJA 5E6ZA 3A4WA 1C82A 4TX9A 2NQ9A 1CX9A 4WGHA 5BMXA 1C7TA 1P6WA 3BSHA 4H9MA 1AFSA 4IOTA 4NJHA 4NT0A 5LA1A 1EYWA 4DLOA 4KRZA 4O12A 4FNSA 4FAMA 5A2AA 1VCFA 2POZA 1OX4B 4GWEA 2F8QA 3U9IA 3L0NA 5AYXA 4CQBA 3G1SA 2IKIA 1A5CA 2FGZA 1N7NA 4UTJA 4CNTA 3GFXA 4NJIA 3VNIA 3O6CA 4ZOCA 2VWTA 4TUFA 4MVAA 2DIEA 3TX9A 3AYTA 4AXNA 5CC7A 1SJCA 1W6TA 5A8QA 4P5UA 3THDA 2W61A 2Z7KA 3BOLA 1XW8A 3UD2A 3AMCA 3QOMA 3KEHA 3H8AA 3E0FA 2OKTA 7A3HA 5E0FA 1OFDA 1TPWA 3IJ6A 4XUYA 5HWMA 4JTAA 2HWGA 1Q6DA 3UR8A 3ZWTA 4M0XA 5F2LA 3CT7A 3CXOA 4GY7A 4B9YA 1ME7A 3W7DA 4KEMA 3GZ3A 4DLQA 2CWNA 4RNIA 3HG3A 2HDJA 3PQIA 3LGDA 1LOHA 4D6DA 5A94A 4AIUA 3MPGA 3S8HA 1DWGM 1OCQA 3OVGA 5DY2A 3CMGA 2WO5A 4FALA 3AIQA 3TFXA 4M24A 4A8NA 3DYOA 2O7SA 1PKLA 2XIBA 3LLDA 3AZTA 1JZ4A 4G5DA 3K5XA 1DWFM 4OBRA 5D4YA 3TJ4A 5CPMA 2V3EA 2D0FA 4PUEA 1GQNA 1T0OA 4G6CA 2ATMA 5DELA 2OJPA 3EA3A 2D1ZA 4KMQA 1UWAA 2OGYA 1ISZA 3VUPA 4DJFD 1CIUA 4EP8C 4WCJA 4JKKA 2WANA 1AH3A 1A5KC 1C90A 4J9JA 2ZUSA 5AZ1A 2JALA 2GQ9A 6A3HA 3WH5A 2JK2A 2INZA 4L65A 4OWGA 5CQ1A 4UTWC 2R8WA 2W4XA 4A2SA 3BOFA 1UC5A 1Q6LA 2ISWA 2ZA1A 3PZTA 4G1NA 4J1OA 3MHGA 3E1F1 4OTKA 5E70A 3WLHA 1F3EA 3PZGA 4KEVA 4JPGA 3HQNA 3NJ3A 5H1WA 1J0MA 3RG6A 2DZVA 2YB4A 2J27A 1ZBCA 3KXQA 1UMYA 4PUNA 3GDBA 3MYOA 3S6TA 4Q4PA 3FA5A 3QYQA 1P1XA 3RM9A 3VGGA 1XKYA 3DBPA 3L4VA 3HV9A 3KCJA 1JPKA 1TR9A 3LHVA 2Y5SA 3FVDA 4XK2A 3N6HA 3UT0A 2ZZ2A 1K77A 1EGMA 1XBZA 1HKVA 3AU2A 1G0CA 1VRXA 3GTIA 1EF3A 1BKSA 3F59A 1OGGA 5C7VA 5I3KA 4QITA 1XUZA 3ZXWA 3ZR4A 3WH7A 2VC6A 2E22A 4FOUA 4DAFA 3WQCA 1MUWA 3O63A 1JF5A 1JRCA 4KKXA 1GZ1A 2EGZA 5HBFA 3R94A 3WUFA 2GSHA 1OFRA 4S3CA 3EWDA 1BTCA 5CLTA 5EGRA 1VBUA 5F7UA 4LAOA 3GLCA 3QTGA 5CG0A 2ASHA 1B3VA 1IIGA 2OQYA 4PRWA 3AMGA 4LWWA 1K1DA 4H7VA 3SCOA 1L8PA 5AYYA 4TVDA 5CGMA 3GXDA 3B4UA 4Z2LA 1KTBA 2PP1A 2DJLA 2EF9A 4A4AA 1G6CA 1KKOA 3CYVA 1LCOA 1X1JA 3GY1A 1KD0A 3W7HA 3OBKA 5CZJA 2OKOA 5IHRA 3P81A 4DJDA 1W5NA 2GL5A 1AL7A 4M8UA 3EMZA 4TQTA 2BODX 4Y8EA 5HPOA 4FEZA 4ES4A 1BPLB 1GOOA 1FOBA 2Z27A 3KRSA 4MSSA 3MJYA 3A23A 4PUJA 3W28A 1RWHA 3NL3A 3W1LA 3O06A 1PIIA 3BZJA 2RH9A 3VC5A 3NSXA 3URNA 1Y5WA 4IQLA 1FWTA 4S2CA 4R88A 4AIBA 1WV2A 3VIFA 3KTSA 4S39A 4DB7A 1JRBA 3OB8A 5ABEA 2PDCA 1MRAA 4GI6A 2PDLA 1ISWA 3ANYA 3LCFA 1RJQA 1XPYA 2J7CA 2EPOA 1DHPA 4ZTXA 3ZVHA 4F8XA 3P14A 2A7RA 2B7OA 2E6AA 3W2NA 4ONVA 5LKYA 1GHSA 1W9DM 1EOMA 3MW7A 2WC7A 2WCGA 1TB3A 3RITA 3AHVA 3QW4B 4A35A 3LPOA 4UXDA 3QH2A 1VBRA 4ATDA 4JZ5A 4N4PA 2WWDA 4PC8A 4RE0A 3CZGA 1GOWA 4JBRA 3VD9A 4HU0A 5HK4A 3W83A 3IJDA 3ID7A 1ZSXA 1K9EA 4HHHA 1UROA 3H2EA 3GDTA 3MI2A 4I8YA 1SO4A 4KWVA 3TLLA 2NSXA 4CU8A 3QPZA 4NG3A 5DLCA 3ARYA 4O0KA 3QMSA 4ZOBA 1XGEA 2YPIA 3G2GA 6REQA 2SFPA 1P4CA 4JTIA 4BS0A 1OBAA 4XZHA 2IUZA 4K38A 2ZZ1A 1S5MA 5E9AA 1AJZA 1QDSA 4MUPA 4MDPA 2FZDA 1C8XA 4L6OA 3O0KA 2QCDA 4H2CA 3TN5A 5K9XA 2FTPA 4JTEA 4V33A 4F9JA 1QU4A 3WDRA 5JH1A 3W0KA 1V7AA 2PRHA 4J35A 3URAA 3NOEA 4HN8A 2CLPA 2F61A 5CPSA 6CGTA 1W9BM 5AHMA 1UKQA 2F84A 4C1NA 4FR6A 4JAWA 3QR1A 5CCZA 3BAIA 3CUGA 4JR5A 1PTGA 1ZBWA 1QW9A 2I16A 1JYVA 4R5EA 4ORIA 1Q8JA 1YIXA 4H4IA 3EWBX 1KFKA 3SJ3A 3JRKA 3W1UA 1V6XA 4LC8A 5ABFA 5FKYA 4MZ1A 1C91A 3OVQA 5D2WA 3UR7A 3FOKA 1CLVA 3ABOA 1Q6FA 2BGSA 4ZXOA 1GQKA 4K7VA 2D2JA 4QSFA 4LVFA 1X7IA 3PBWA 1XD0A 3W76A 3PZVA 3URQA 3AQUA 3EPNA 3WD0A 3P7YA 3UD6A 3PK7A 1NELA 1D9EA 4WOZA 1YLVA 3CQ0A 3KW3A 1MW0A 4H7CA 1E5NA 3L4UA 1GJUA 4YTSA 4IF2A 4LW7A 4QNWA 3R12A 3QR0A 1RJPA 1V3JA 4XVDA 2PCEA 1I8QA 1VC4A 3GU1A 3LPFA 3HFTA 4PBEA 5HA7A 2XIIA 3PUDA 5TIMA 2X03A 1Q7QA 2VWSA 4N2YA 4N9CA 1M7OA 3KE0A 4WSKA 1KCKA 3V18A 4GABA 2PGEA 1RCXB 3UJ2A 3LMYA 5HMSA 1Z32X 5HJLA 4JFTA 2XH7A 3H7RA 3RXZA 1FWSA 3FNDA 4GH3A 3UWWA 4DZAA 3E0IA 4Q4QA 1DQXA 2Y7EA 2V3FA 4Y9MA 4F66A 2FDSA 4IISA 3W37A 1I0DA 1LT7A 4LVDA 5ECUA 3W00A 3W1AA 1RK6A 1X38A 3EWCA 3SRDA 1FWNA 4H9XA 3B8VA 3DECA 2J9YA 5HDRA 2OCZA 5K7JA 5FF2A 3TSDA 4RJEA 4FX6M 4S38A 5CBIA 4IMGA 2GJRA 3CAWA 4MIMA 1LJYA 3CHFA 3E0LA 2W91A 3GAKA 2X16A 6TAAA 3T05A 3MKKA 1R7AA 1ZUAX 1OX6A 5D2XA 1XQLA 1XBXA 1E70M 2NUWA 1VFMA 4ZZ9A 3ICJA 4ATWA 2VDGA 4PUMA 2FLIA 2Z1BA 3BTNA 1XLBA 4JL1A 4AD1A 4H9UA 2IXVA 6REQB 3G0UA 3GD6A 3FA4A 2QDEA 4FPSA 4NZ3A 4JX4A 1PCKA 1UR1A 1UWIA 4PCPA 3WYZA 3I4KA 3U2CA 3EDFA 3FDKA 1M3UA 2ZUWA 4FNTA 2QCDB 5EFDA 4J3ZA 1YX1A 3RLGA 2CHRA 2FKPA 3ZM8A 3LM7A 5D03A 1TVPA 1RPKA 2GJNA 1TE1A 4LY4A 3W7JA 4CVUA 4AZCA 4Z1DA 4DBWA 3B9EA 4RL3A 4U3AA 2W79A 1IEIA 4CVWA 3DFPA 1GZGA 4A8RA 3EX2A 3A64A 3T42A 5FJPA 2VCBA 2XFWA 3N6QA 4EIVA 3GS6A 3VFCA 3TQVA 3HTWA 3KP1A 2PP0A 1H0IA 1UASA 1W9UA 4CEXC 5T9BG 4JHOA 2JF6A 2WC3A 1TMHA 5ABFB 3EWYA 2R6OA 4LAZA 3HZ3A 5ABTA 3QFWA 3LRKA 2ACUA 4N9EA 3W87A 2E5BA 1O7AA 3P60A 4ZR8A 3BCJA 4IPNB 4CCDA 5CC6A 1R9ZA 1XH2A 1UHVA 2GJPA 1JDEA 3IUIA 1UG6A 3BAWA 2VURA 3I7SA 2E09A 2WKGA 4ZQRA 1F8MA 2GUBA 2OSYA 4NX5A 1OJPA 1XDMA 2CC0A 3T55A 1S2TA 1KV5A 3NNTA 3TC3A 4B92A 4PFMA 1OY0A 1R0MA 2ZE3A 3S2CA 1TPFA 3QN3A 3NZRA 1NTHA 5D2VA 2C0AA 1V5XA 3IUDA 1E43A 1W0MA 1LBMA 1LT8A 4IQDA 3NXLA 5KSWA 4O17A 4UQEA 4JY9A 3WK2A 2R1MA 3E2VA 2IS7A 2HBVA 2WZEA 5CEWA 2YDSA 4WUIA 1GW1A 4C6MA 4ZEPA 1NOWA 2I5QA 3JU2A 3R8HA 1SPQA 5FEXA 4AY1A 4JEJA 5AVNA 4MKSA 1D7FA 4DPPA 3U48A 4GYJA 4S2BA 4C7FA 5EMJA 3IGXA 1JJKA 3G77A 3CJPA 1KXVA 2EJAA 2WNQA 3K4AA 1KW1A 2IKJA 1JZ5A 4W7VA 1XLCA 4RNFA 5A8PA 2REQB 2GOKA 2O7QA 4HYWA 3S3GA 4G7FA 3PZUA 4JN8A 5DXXA 5C70A 1VYRA 4K7YA 3NQAA 3CZKA 2CLFA 3M16A 3CZEA 1V08A 4O0ZA 1WUFA 1JCYA 1IEQA 3S5YA 4GFIA 1QOPA 2DVXA 1DL3A 1EDQA 4XKMA 2OWCA 1ONWA 5HJXA 1IEVA 1VKFA 1W5PA 4M7TA 1Q7ZA 2V5LA 2H9AA 4JNZA 4DI9A 2XH0A 3MMTA 3PC0A 1SSDA 3BXWA 5XIMA 5DT5A 4DAIA 1K8CA 3P8JA 4JXCA 1A80A 1E56A 4DLMA 4GX8A 3NCOA 2VFEA 1NDVA 4XV0A 4GUIA 1BRLB 1J10A 1EEXA 3W7QA 2L5HA 1PB0A 3S6DA 3S5NA 3PUGA 3L5MA 1HN0A 4IUOA 4LVAA 3EA2A 3RYSA 4KF1A 4IX0A 3CB8A 2JIWA 5JQ9A 3UBPC 1IXPA 1XINA 2A6LA 3ARVA 5CZSA 3GNPA 1EB3A 3WK0A 4PTWA 4GZ7A 1UD3A 2J79A 1TQJA 1XLEA 1P6CA 2C91A 3KBJA 1F2JA 1SQ7A 1UUMA 2V4IB 5BOEA 1S1PA 3CUXA 4B15A 3TNOA 3ITCA 1U1JA 4NAFB 4F0RA 2D22A 3IVTA 5A8GA 1MQRA 2C71A 2ICSA 4OOZA 1BF6A 4N02A 2VFFA 1H0GA 2QIWA 4Q4MA 4XSLA 1ENUA 5TBOA 2BOFX 4PMOA 2XDFA 2ZZ7A 5DO8A 1P5BA 3M9YA 1VEMA 4FLOA 1JCJA 4H19A 4FNQA 5FEZA 3LTYA 3OZYA 3VD4A 1ME9A 2QDHA 1W3NA 4IT1A 4M82A 2PTZA 1GUVA 2RKXA 1WDDA 3ARQA 2WVVB 1FWHC 2W3ZA 1XYLA 3FSUA 2DEPA 1EZWA 2WV8A 3FW6A 4GNVA 4WSHA 2WBKA 3WQGA 3BAXA 1KWGA 4NZCA 3S0CA 1XQKA 1OEPA 3CIXA 1V3HA 3AWOA 2WSPA 1E0XA 3DFNA 3CUJA 3Q45A 3B9AA 1K8XA 1H60A 1TR1A 3LXBA 4YL2A 2YB1A 4XKYA 3LENA 3KRUA 3C0JA 1IWAA 1YHTA 1VJIA 2E77A 3CQKA 5TD4A 5IDZA 1XIGA 1EEPA 3VE9A 5E1QA 3WBWA 5GNZA 2RDTA 1TTIA 3B9OA 3TU9A 1U1HA 2OZ3A 5D38A 1KBIA 5D2TA 1UOZA 1SGJA 5G1YA 1G9HA 5E93A 3WF2A 2V2CA 5G2WA 3PFMA 3NQEA 3V3WA 3WLPA 5HNTA 2OPJA 1W37A 1R87A 3KP0A 4R7WA 2X05A 4UMAA 3BJTA 3RF9A 1QNPA 1AZ2A 1XLMA 3VKBA 1RV8A 3VKKA 1W1B1 4LV9A 2IQDA 1FRBA 1GGOA 2XH4A 4JKMA 1EBGA 4IPLA 4MUZA 2I1OA 5G1MA 5M03A 1PDYA 4WY0B 1U33A 4X0VA 1IYXA 1VH7A 1QBBA 1ICPA 2OLSA 1Q6EA 2A5HA 2CZDA 3PZNA 3QR8A 3EWXA 4R53A 5AHIA 4W84A 3IAPA 3HGJA 3M5ZA 2BNJA 4EAMA 3LM3A 4W7WA 2VUNA 1PV8A 1TA3B 2AGTA 2OYLA 1T8QA 2D2GA 5G4HC 4URIA 3OTRA 2CBUA 4FXJA 4AIOA 3R4IA 4QCFA 4AY8A 4O1AA 4GIAA 3RLVA 4DF1A 4ICMA 4N7QA 3EDJA 5C71A 1UP2A 3W74A 3PSWA 4OOUA 4P61A 4AFYA 4K1WA 2HVNA 2I7GA 4PTNA 4QS5A 4CD8A 1FWAC 2BG5A 3DC8A 1GTEA 8A3HA 5EY5A 3HB9A 3UF9A 1F7BA 5EFFA 1TPC1 2H9AB 4CN6A 4CD4A 3H2FA 2CZVA 2V30A 4H9YA 3OIXA 3B8IA 1KFLA 1MW2A 4W87A 7TIMA 3Q67A 2BFGA 5I23A 1FFRA