3PQIA

Crystal structure of the bacteriophage phi92 membrane-piercing protein gp138
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
222
structure length
202
Chain Sequence
HTSLPVRVIGVDYGSKTVTLESIVKNTEIDYPTFHDVPFMVNGGGTGRISFPIKAGDIGVVVFSSSGTLIQPCGLYPACFIPKIATATDSSEEVDSEKVIISNNKQTYASFDPNGNISVYNTQGMKIDMTPNSIVLTDAGGGKLTLQGGTMTYKGGTVNLNGLTITPDGRMTDSGGIGLHTHTHPVRGVETGGSTVTSDKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords gene product 138
publication title Phage pierces the host cell membrane with the iron-loaded spike.
pubmed doi rcsb
source organism Bacteriophage phi92
total genus 27
structure length 202
sequence length 222
ec nomenclature
pdb deposition date 2010-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18352 Gp138_N Phage protein Gp138 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.230 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Gp5 N-terminal domain 3pqiA01
2.60.220.60 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Chondroitinase Ac; Chain A, domain 3 3pqiA02
3QR8A 2P5ZX 3PQIA 4UHVA 4MTKA
chains in the Genus database with same CATH superfamily
5EKLA 2EXDA 3STBC 2EJFC 3PMFA 3I70A 4H7BA 1J8IA 4DR1Q 2K52A 4IFDI 4NMZA 4MN3A 2K5NA 1ZXTA 1IW7D 4JI0L 3KF8B 4KN7C 2EZVA 1X55A 3MFGA 2F3WA 3PIPA 1QWYA 3X3NA 3OTOL 2N8NA 3JAME 3HZXA 1EIYB 2NYZD 1V1QA 3IL8A 2EE1A 4JOIA 1SNDA 2NZHA 4JYAQ 3RN2A 3GTMB 3K0XA 1Y8OB 4K2KA 4ME5A 3J7ZC 1PZKD 2O5JC 4Q5VA 2A68D 4OX9Q 3PUYA 5IE8A 4WJ4A 4KHPQ 2EYLA 4C56C 2RF4A 3FP9A 3QOJA 4R4QA 4YWKA 3S1RB 2YU9H 1LXMA 4V0BA 1EQRA 4RHSA 1W6JA 4JOIC 4YWLA 3GV3A 3HKZB 2HT1A 4LMQD 4LFCQ 3TDQA 3Q22A 3UDFA 2E24A 2LS01 5C0XI 4GNXA 1Y1WH 5F2DA 5I2YA 1PH7A 2UXCQ 2JP1A 4B3RQ 2UUAL 4FF1A 3L7ZC 2X69A 3A55A 2EYJA 1IHZA 3NHHA 5M5YH 1ASYA 2F1MA 2BA1A 4NDXA 5ELNA 2RHSB 4XYOA 4BBRB 3V96A 1Q8IA 1HPCA 1VQBA 1YJWA 1W2BA 4GNXC 2ZXPA 1MHWC 3BVGA 3DHQA 1Z9FA 3E3XA 4DR3L 1KIXA 1D2BA 2CQAA 3DMUA 1VQ7A 1Y1WG 4H0LC 1QG7A 2WFWA 4WORA 1KL9A 4QL5A 5CV8A 2SDFA 1G91A 3EQLC 3M3YB 1I3QH 1I8QA 4WFN3 2VY3A 1CKNA 4C3JB 4DR5L 3CC7A 4QUFA 1XNRQ 4O1NA 3S14B 2DUDA 4LUZA 2E2HB 2X6GA 1RWHA 1TWCH 2R93B 2JA5B 3EVQA 1IZ6A 1FGBD 1K28A 1VQHA 3KLWA 3RR5A 2ALYB 2B2UA 3PUWA 1BBUA 3F1ZA 2MFIA 3GTQB 2RKSA 2A6HD 3HRZC 3MC0B 4J1MA 1B44D 3TP8A 4LNQA 3DEPA 1KABA 5GQOA 3UI2A 4EQOA 1V1PA 5DM73 5J1ZA 2F0HA 2HDMA 1QVCA 4KI0A 2EY6A 4L5SA 2HD3A 2OTLA 3ICEA 1VCIA 1RODA 4DR1L 2EY5A 4ZRZA 2K32A 1TWAB 1A0IA 1K73C 4F8MA 3M7NA 3KBGA 3U7VA 3GO5A 1UE6A 4NB3A 3SE0A 4P2CB 1CFMA 3PUXA 1TS2A 1EEFD 5CGKA 1K3BC 1B3QA 2F0LA 4XIGS 1GHKA 1Q1BA 1MD2D 4ME3A 2L5TA 1EZ8A 1EY8A 1U4MA 4JYAL 1EYDA 1HTLD 5DLQE 1YJ9A 4OX9L 1HUNA 4KHPL 1SNMA 1VQNA 1H9SA 4HJ5A 3CQZB 1XMQQ 1K9MC 4HJAA 4A3DB 1VDZA 1V1OA 2NTSA 5IYDH 4HCEA 4A76A 4D71A 4LFCL 2FHTA 5T1IA 1DOLA 1SXTA 3EFXD 1HQMC 2UXCL 4B3RL 1D6EC 2VXWA 2K5VA 3I90A 3MZ5A 1BCPB 4A3IH 3JAMi 3U50C 1PH2A 5JJIA 4JI1Q 3OWEB 2DNCA 3GDEA 3I4MB 2QGQA 1PTOB 5IYDG 4QQBX 1N7PA 1AW7A 4DV3Q 1DZ1A 1GOZA 3HOXB 2MUYA 5ELCA 3FVQA 1S40A 1SMYC 3STBD 3IFTA 1SRUA 2F0QA 2OCEA 3T56B 5L37A 4LAAA 5KIXA 1GVPA 2NVXH 2KQ3A 4DV2Q 3BDCA 3ZJYC 1B1ZA 2KEEA 3HP3A 1SJHD 3NBIA 4A3IG 1XNRL 2E2IH 4AYBG 1STNA 1VMCA 1PYSB 5D65A 2EYOA 1HRJA 2A69C 3R93A 2DJFC 3WDNA 4IPDA 5CV4A 5LMNW 4P72A 4KY5A 2EIFA 5JVG3 3E0EA 3CW2C 1CA6A 3PV0A 1CA5A 4Y7NH 2YTVA 3H91A 4GOPA 3MEHA 1PRTB 1LTGD 4CDDC 1HJPA 4K14A 4D1JA 3CMEA 3UDXA 1NTGA 3S9WA 2Z9HA 3NBHA 4HTHA 5EPJA 2AQ1B 3L9AX 5EKKA 4R8NA 5AFWA 1Q81C 2FJ2A 4LFBQ 5IOCA 2WB1B 2K4KA 4RCOA 2Z6BA 4GOPC 2H4OA 1NBWA 3EIVA 5M3FH 1W6KA 2JA7B 4YHHQ 1XTCD 2ID0A 4JI7Q 4YY3Q 1HNWQ 3NQTA 2B29A 2GA4B 4GZYC 1EU4A 2K5QA 4PZ7A 2QDLA 2I46A 1NCVA 4KLKA 1KRTA 1QUQB 3F2BA 3MXNB 3VYSA 1BQQT 3MXUA 1RDPD 4OEMB 3H3VH 2MO1A 1R4QB 5CMDA 3CCMA 1EY0A 5M3FG 1PVOA 2G9DA 2XGTA 4KHVA 2XRQD 1I4GA 2A6EC 3K0YA 1EIFA 4RMFA 3GTJB 1R9TH 2OXPA 4C3IH 4JBKA 3OIPA 3CPWA 4LF7Q 3E0JA 4D6CA 3DWAA 4KY6A 1FNWA 2L55A 3A8JE 2K05A 4KY7A 5HURA 3CCUA 4G7OC 4OWXB 3CHBD 5IYCH 3CCLA 3F59A 1PTOF 1E2VA 4FVMA 2EPBA 4JI1L 4IALA 4BS9A 4NXNQ 3E9IA 5E7NA 1CQVA 4DV3L 3KF8A 4DV4Q 4C3IG 3OW2A 1EZ6A 2WINB 4JV5Q 4JK1C 4HIOA 2Q8RE 3KK7A 3RUZA 1T9HA 1VQ4A 3J7AV 2NVQB 1JT8A 4DPGA 4DV2L 5IYCG 4EX5A 1N7QA 4UY8C 3KJOA 4TSSA 1EUJA 4C1NI 4GNXB 3K7AH 2K7VA 3H6MA 1X1HA 4FF3A 1GUNA 1O7ZA 3OPOA 4NKLA 4OHJA 1D1IA 1RL2A 3H09A 3QR8A 1PRTF 5BN3A 1A3VA 3U9OA 2YTXA 3TZDA 2XN9C 1DYQA 1HA6A 1N36Q 3H15A 2WAQG 2F0VA 4N8X1 5I4DA 4CJ1B 4D8OA 2ENBA 4QCLA 4X65Q 3FKIH 1LYLA 4OGQC 3H0GG 3KFUA 4A3EB 2K5DA 1Y1VH 4MZ9A 1TWFH 4DXFA 2E2JB 1CKNB 4D1IA 1YEZA 4LFBL 4QUCA 2V1CC 5C3WA 2F0EA 2B2VA 4YHHL 4JI7L 4P73A 3A8IE 3UDIA 4YY3L 1HNXQ 1HNWL 2KHIA 3GP7A 4EGVA 2JA8B 1BBXC 1BO0A 4JI3Q 1CUKA 2F0PA 3BG3A 3CRKC 3FKIG 5GAEC 1Y1WB 4DUZQ 2Q1FA 1E7ZA 1B7YB 3HG9A 3VDYA 3MHBA 3D4DA 2F0WA 1SMYD 3LGJA 1UE1A 1Y1VG 2B2VC 3T1YQ 3CCSA 4RGNA 4C3HB 1V9PA 5M5XB 4JI4Q 3S2HB 3NTHA 4JCVE 3M7GA 3J80L 1UUPA 3IRBA 5FK9C 1RWFA 2BRVX 2HCCA 4K5VA 3J80i 1HM2A 1SBBB 2IX3A 4LF7L 2A69D 4FXDA 4L5QA 5IGGA 3G48A 3LWUA 1WTWA 1KQSA 5JJLA 1LACA 4KKUA 4RA8A 1BOSA 2FXQA 1DJRD 2B63B 5C4XH 1CKOA 4LFAQ 4NXNL 1ICWA 3TP7A 2CW0D 1STEA 4OWTB 1TWHB 1N34Q 4A3CH 5C5MA 2PI2E 4DV4L 3A7AB 4GS3A 2NZ1D 2LY7A 4JV5L 1I4PA 1I4QA 1HMWA 1T5XD 5C44H 1DOMA 1H9SB 5M5WB 3F2DA 1EYGA 3L2PA 3I4OA 5LHY1 3AB9A 2BRPA 1I4HA 5BR8Q 2LXKA 2JEAI 4JI6Q 1Z47A 5C4XG 3C3LA 4HJ9A 4ALPA 2JA6B 3I55A 5EJWA 1DGSA 4A3CG 1ESFA 1K8OA 4K0KQ 1SE8A 3SK5A 2WKDA 2IT1A 3D6CA 3FRPB 1RTNA 1YNJC 1CT1D 4BWGB 5C44G 4X3SA 2ZTEA 5LMNQ 1XWEA 1YITA 4A3JH 3GQBA 3S15H 1HFNA 1HN0A 4TKOB 5E4WC 1N36L 2Y0SB 1YHAA 4EVOA 1SE4A 2RQXA 4X65L 2KXSA 2PQAB 1LTID 3PO3B 1OXXK 1VQPA 1ICFB 1IL8A 1LT4D 1ML0D 2N3SA 1I50B 1WTOA 2MGSA 3HEJA 3J81c 5G3LF 2EXZA 1D8LA 4K8JA 4DNIA 3ULJA 3G6EA 1M8AA 1JICA 4A3JG 1Q86C 2JQOA 1BDOA 3TS0A 1HNXL 1TWGH 4IPCA 1MGSA 1BCPC 4UHVA 4PMBA 1KDCA 1KLUD 3GTOH 1HNZQ 5E1FA 2ZT9C 4JI3L 1VQOA 4DUZL 2QA4A 2FMMA 1PTOC 4JI5Q 1A63A 4YWMA 1R4PB 2WDAA 4C2MH 4D6GA 3MWYW 4D6IA 3T1YL 1VQ8A 1EEID 1F2MA 4IQZA 1UWVA 1CI3M 2K28A 1KAWA 1GUTA 4JI4L 5C3EB 4AH6A 5CV7A 3RLNA 3HOZH 2HQEA 5C6AA 3CU7A 2F0KA 5J22A 3NBHB 2RDHA 1F2ZA 4BBSH 3IFDA 1E1TA 1I4XA 4YIJA 4RGTA 5JOBA 5C4ZA 1H9MA 2L12A 3A0JA 1EWIA 3T51B 2G5DA 1D5XC 1PH6A 3S1NB 2BDNA 1B8AA 4QMGA 2AQ3B 1IBMQ 3R8BA 1PH4A 1U0LA 4LFAL 1NMFA 2K1BA 3HOZG 2JXMB 3ERSX 1N34L 1Y14B 2NBFA 3I7FA 1PRTC 1B4OA 2DNEA 2F0TA 2PNRC 5C4HA 1A2UA 4BBSG 1TR5A 5CYUA 3HOVH 3PCOB 3PUVA 4UAIA 3A5ZB 1SYFA 1PDQA 1QOHA 4HR7B 3HKSA 4DR7Q 3DWPA 5BR8L 1QUQA 5IT9c 4JI6L 2A74C 1SYEA 4FP5D 1XPOA 1I4RA 2TMPA 2IJ0A 4QIWE 2L4NA 1U4PA 4K0KL 1K0SA 1LOHA 1VQJA 3CD6A 3HOVG 5JJZA 3URYA 5EPKA 5LMNL 3UDGA 1PYWD 2SNMA 1SNQA 1F1SA 2R92B 5ELBA 1TY2A 4L63B 1IYUA 1C48A 4DAVA 4RKBA 1S5DD 2PW5A 1EYAA 3TP5A 1CK1A 1L0YB 1OJPA 3J7A5 4XT1B 2D2CC 2YV5A 5IYBH 4R9WA 2H1EA 2VNUD 2KECA 4QB4A 2K75A 3GTLB 3KUPA 4LF5Q 2AUKA 2KCTA 1B50A 4X66Q 1I6HB 1TXYA 4J15A 2NVTB 2LSSA 4PZ8A 1PH9A 2BRWA 1X3EA 4IO9A 3GTKH 3I4NB 1HNZL 1OXUA 3TMEA 2C5CA 4AYBE 2KHJA 2WMFA 4JI5L 1KD1C 2BE5C 4DAMA 2F03A 3BZKA 1ZYRC 5IYBG 3I3CA 1TIID 3K8AA 2F0SA 2Q8TA 1OXTA 4RHRA 3OSOA 2K14A 2JYOA 1B9NA 1LV9A 1RD9D 4IUPA 4O42A 3K5MA 3K5NA 2UU9Q 2NZOA 1DM0B 5FLXc 2BA0A 1UNSA 4DR4Q 4DU9A 3PF4A 2F0OA 3J81E 3NUCA 4ZYSA 1B53A 2BCOA 1OXSC 1G2SA 1VQIA 4U68A 4TQUS 3R2IA 5KNCA 4EQNA 3S17B 2HIVA 1EY5A 4YCVA 1F9GA 4BY7H 1OXVA 4FF4A 1NUCA 2ZTCA 4AIMA 4RKLA 1IBML 3GTPH 2PMZB 3HOUB 1F77A 2TSSA 5GROA 2PZWA 4WJ3M 1QCBD 2JEBI 3H0GB 3RMHA 3BYYB 1QB5D 1XNQQ 1E2WA 3VR5A 1CM9A 2JK8A 2F0DA 3PO2B 4ZK9B 1HFGA 2E75C 3DLLA 3CRLC 1PZID 3WWVA 4OO1H 4DR7L 4BY7G 4R4IA 1A3UA 1BCPD 2R3ZA 2WV6D 1W3YA 3M4OH 4X3TA 1KHIA 1VQAA 4ZAIA 2AWOA 1S3OA 2J0TD 4RAUC 1EQVA 1XPRA 2VUMH 1EY4A 2B2UC 3M4YA 2N78A 3CF5A 1Q8KA 4KMUC 1F2YA 4OO1G 2L11A 2O2LD 3KDFA 1YHBA 1VF5C 1XXGA 5FJ8H 5IIFA 4G7HC 1C9OA 4GLXA 1WTPA 3N52A 1LTTD 3H94A 3RLOA 1HA5A 1QILA 3QOLA 3S2DH 1LM0A 5KYIA 4IUTA 2ZXOA 1S5FD 3UD2A 2VUMG 4N9PA 4LF5L 3AMUA 1FL0A 4X66L 2F0GA 5IT9E 1JWMD 1RJTA 5GAGC 1H9RA 2PZUA 5FJ8G 2PPBC 1A6XA 1YI2A 4HAEA 4A3FH 1H95A 3I2ZA 3NQIA 2V4DA 1Z6HA 1XYIA 1FYCA 2K33A 4JBMA 1SMXA 1ZKOA 5HGTA 1DONA 2F0IA 4J6HA 1KAAA 1OO9B 1WD1A 4IFDH 2E2DC 5EPLA 3JAML 5M3MH 1VQGA 3HKZE 4ILWA 4EQPA 3VYRA 1X65A 1SFOB 5C5LA 2UU9L 2Z8LA 3L0OA 1SNPA 3MEFA 4A93B 2E8GA 2WAQE 4DR4L 4A3FG 2F3IA 1KNAA 4ZCKA 1WD0A 1FJGQ 1BUVT 1WJJA 2EDGA 4OONA 2D0PA 2K03A 2M00A 3RZOB 2PQAA 3S1MB 4IFDG 1AE3A 4DAYA 1I5FA 5M3MG 2R7ZB 3ND8A 1WTRA 2EQSA 1Y8NB 3VYUA 2E22A 1JE5A 2NVYB 4IUQA 2D9UA 3BVMA 1A8VA 2OEOA 1XNQL 1U9RA 2G9HD 1E1OA 3S1QB 1O7LA 2GN5A 4OXPA 4D6HA 5C0XH 2ES2A 2X03A 3SEBA 1HUMA 1G8ZD 2NTTA 4FYDA 4M8AA 1L0XB 3T16A 1A2TA 3F2CA 4ZLTF 1LTAD 1JE4A 3D31A 3HOWB 4K2LA 5FLXE 3J81i 3I4LA 2N55A 1X3GA 3CC4A 2MQHA 1XTDA 5KRUA 3IKJA 2MP1A 2PW7A 2EY2A 5E3FA 1CZGA 4RFBA 5KYLA 2CFMA 2BE5D 1B9MA 3KF6A 3MXPA 4A3GH 1X54A 5C0XG 1ZYRD 2JN4A 4HJ8A 4PV1C 1B70B 5C4JB 1PH3A 2VQEQ 3C2PA 3Q0AA 3GTGB 3K6OA 1E2ZA 5IP7H 3CCRA 1EY7A 3SVMA 5C3XA 2UXDQ 1NE3A 3RZDH 1CSPA 4GN5A 2K6AA 1K83H 2WMKA 5J39A 2B2YA 4HMJA 4LUOA 5EAYA 3A5UA 2KJXA 4A3KB 4A3GG 4Y52H 2N49A 1WCMB 1JJGA 1Q90A 1D5ZC 1J5EQ 4I7ZC 3S16B 3SDZA 3G71A 5IP7G 4B3TQ 3D3RA 2L15A 3OW7A 5A35A 2E76C 2B2YC 3T1HQ 2KEDA 5IODA 3CKIB 4HN7A 1SYGA 1GKHA 4BY1B 1KRSA 2M9VA 3QJYA 4IJHA 4O2DA 1H9JA 2CQOA 1CKMA 2IY5B 4H02A 4JVZA 2YTYA 3GTMH 2Z6KA 1N33Q 2WMJA 1LUZA 4ZQ3A 1FJGL 4IUVA 4OIJA 1RTOA 3EROA 4DF7A 3S1RH 1X9NA 4LJZC 3BU2A 3P1HA 4CDEC 1MJEA 1JJCB 3OIQA 1F9QA 4CJ2C 1G291 2DY7A 5A2QE 1Q12A 3C1EA 1CSQA 2IX0A 1QZGA 1MSHA 1SE3A 1Y69U 1GHJA 4MIUA 1IXRA 4RG1A 4WRDA 2I5HA 2BDOA 4FXGC 4QJFA 3HOYH 4IOAA 3NK9A 4BBRH 2HQLA 1JJ2A 4G7ZC 5I9PA 1TVXA 2B8FA 5FOBB 1C8CA 2VQFQ 3HKZG 2BH2A 1VQCA 4IUUA 1C4QA 4HIMA 1II3A 2L0CA 1ESRA 3KBTC 4DLQA 4YCWA 1I94Q 1LLRD 1X3QA 2WP8J 3M3YH 2F0FA 2ZTDA 2D0OA 4LUVA 4C3JH 3HOYG 1HZBA 4X3UA 1SSOA 3S14H 2I5LX 4BBRG 1RCVD 2E2HH 3TQYA 5AJ3Q 2R93H 1TKWB 4L8JA 2VQEL 2KCMA 2JA5H 3GTKB 5EGTA 4IJLA 2EYMA 4JW0A 3FMCA 4GLVB 3U58A 2YU9B 2EYFA 3NEMA 2LKVA 2UXDL 4LW1A 1O7IA 2AHOB 3GTQH 2EVBA 3I91A 4C3JG 3MFYA 4DV1Q 2C9OA 5J3BA 3EA6A 4F7XA 5M5YB 3R3OA 2R93G 3G7LA 3B6YA 3PUZA 4UDUC 1J5EL 2JA5G 1AP0A 3BVZA 2PNHA 2Z1CA 4B3TL 4HSPA 1STYA 1TWAH 3T1HL 4IUNA 4B08A 2EOTA 4OIKA 2LFNA 3E5SA 3BZCA 3W3AA 2RHQB 4IURA 1GXDC 2B2TA 4PG3A 4A3LH 3BYTB 3KDFB 4JG2A 3CCVA 3M85A 2DY8A 1I3QB 3CP0A 3Q8DA 5JPNC 3T4AC 1KTKA 3TN2A 1N33L 2RSNA 1TWCB 4MNOA 2HDLA 3U4VA 5IGBA 3CQZH 4A3DH 2DN8A 4GLAC 2BH8A 4A3LG 4GN4B 1RKNA 3KYHC 3F8TA 4FDBA 4B3SQ 4DV5Q 1YIJA 2NUCA 4NPSA 2B3GA 2RDGA 2KCCA 4XTCS 4CDFC 1BKBA 2VUMB 1HTPA 1ET9A 5LL6X 3C1FA 3JC66 1ASZA 5CV5A 4A3DG 3I4MH 1PTOH 1I6VC 2LXJA 4D6JA 2VQFL 5EBCA 3HOXH 1JMCA 2F0NA 5D14A 1RIPA 1TS3A 1YVCA 2ASBA 1IKMA 4QIWB 1WTQA 1I94L 2C35B 3QG1A 4D72A 1VQLA 4XT3B 5ELOA 3HGBA 4CDCC 1K8MA 2AQ2B 2NWGA 3OYYA 2CHBD 3RNUA 4QY7A 2A6ED 1CHQD 5K36H 2O5IC 2KHSA 1X3PA 2L9HA 3LWEA 4DAYB 2PO4A 1BF4A 4IPGA 5E4XA 2IWHA 3I4MG 5AJ3L 3SR1A 1TY0A 4D6FA 4QF4A 1PH8A 1AN8A 3HOXG 2K04A 1EFWA 2KBNA 4X64Q 1G2TA 2KXRA 5EQ0A 4CKBA 4A3FB 1YJNA 2HCIA 3SXHA 2KVMA 3IAYA 3TRZA 5CV6A 3TP6A 5IWAQ 3F2UA 5K36G 4ZUJA 2HHHQ 4DV1L 5I6WA 2SEBD 1F2LA 3TZUA 3OOCA 1TS4A 4A3IB 2E74C 1J6QA 2F0JA 4OWWB 4DNTB 1IKLA 1N8RC 4AYBB 2A6HC 5JPMC 1SNCA 3KLRA 3KF6B 3KOJA 4N8FA 1PH1A 3AFQA 1BNZA 4IPHA 5CORA 2F3VA 2CVRA 4F88A 4L5TA 4B9WA 1NY4A 3I56A 5KNDA 4PQXA 5K5PA 1EYCA 3ONAB 2Q2TA 4ZKCB 2NVXB 1CZWA 1S4ZA 1H9KA 1Y8PB 4PNYA 1Q82C 2E2IB 1QNKA 2ZJPA 1K3RA 4OO1I 4KD4A 1B2TA 4YCUA 2WB1G 1SYBA 1PXUA 3NE5B 4C1NK 2WMGA 2OQ0A 1OTCA 1VQ6A 3GTJH 4K6DA 1AEXA 4Y7NB 1NNXA 3KLSX 1EU3A 1PFBA 5EKIA 4B3SL 4DV5L 3PQIA 1F9SA 1FNUA 3ZYYX 3PGZA 4H13C 1VQ5A 4GKJQ 2ICIA 1LTLA 3EJIA 2HUGA 1KLGD 2EY1A 2RCNA 3NP8A 4H44C 5JJKA 3DWQA 4DR6Q 3FDTA 2F52A 4KKSA 4BXXH 1JOOA 1MSGA 3RD4A 1PYBA 3ULPA 4NW2A 4MHEA 5M3FB 4IZ8A 1JB3A 2ZXRA 1U4LA 3FPUB 2EJMA 3I8ZA 2NVQH 4BA2I 2F4VQ 3BDOA 1HHVA 3VA7A 2B2WA 1L0WA 1VQMA 1NAPA 3CCQA 3K80C 2Y0SE 1X1IA 4BXXG 3M4QA 1K8GA 3A74A 5D3IB 1AZQA 4ZKBB 1Q1EA 2GVAA 4X64L 3E6ZX 5M9OA 2B2WC 2NN6H 3M9BA 4G4KA 4MTKA 2X6LA 1R9TB 4C3IB 4K5XA 1D1KA 3QO2A 5IWAL 1KC8C 4D6EA 3PIO3 5CBAE 1WTVA 2PI2A 3VR6A 2HHHL 4R4OA 1YZ6A 4JI2Q 3MXGA 3QIAA 4KHZA 4R1JA 3VR2A 4NXMQ 4OL7A 4MTNA 3NWSA 1BBWA 3NSWA 4A3EH 1Z7TA 1HH2P 1HZCA 1EOVA 3NXWA 1E0BA 2E2JH 3EBEA 5COYA 1GUOA 1B3AA 2MJ8A 2NN6G 4QGUA 4HEDA 1IBLQ 2ATWA 1A3TA 4DKAC 4TVAB 1HQRD 2JJQA 4PZ6A 4J8QA 3AEVA 2JA8H 2AMCB 2Q2UA 2ZJRA 1YNJD 4TRDA 2WAQB 3W1BA 1ILPA 1GUWA 4A3EG 4FO2A 2D62A 2WIIB 2YYZA 4LK1C 3HOYB 4C3HH 5M5XH 3K7AB 1EGUA 3K5OA 3S2HH 2WMHA 2ZJQA 2FINB 1P8LA 1K8AC 4AQYQ 2WMIB 2J7ZA 4POGA 4DLOA 4CGYB 2JA8G 1STBA 2CH4W 4B9XA 3W5OA 2KOLA 3D0FA 4KD3A 2PQEA 2RBMA 3J80c 4A3MH 2XIWA 4GKJL 4DK1A 1NR4A 5KNBA 1MBYA 1EL0A 3FKIB 4C3HG 1IYVA 3P7JA 5JAVA 3BJUA 4DR6L 1HM3A 2B63H 1Y1VB 3M4PA 1TWFB 3D4RA 1F9RA 2UUCQ 1PTOD 1P16A 4HCSA 1TWHH 2KCNA 3BDLA 1UAPA 4IOCA 1C82A 1OJOA 2RDFA 3AYHB 1STHA 1UE5A 2DJGC 1AZPA 1GD7A 2SNSA 2JA9A 1HR0W 1XPUA 3H3VI 4A3MG 5M5WH 2UXBQ 2F4VL 4D6DA 1UEBA 1FNVA 1V8QA 3A54A 3PF5A 2QILA 2RVLA 5CBEE 4XQNA 1JOKA 4DV7Q 2B63G 1BVSA 2JA6H 1QVFA 1G51A 3D6WA 4N9TA 2I07B 1GUSA 1STGA 2IW3A 3VR4A 1JR0D 3S24A 4FNFA 1AFPA 1U5KA 2JSOA 5DNFA 4UPAA 1MI2A 1FVIA 2A19A 4K8IA 2I5MX 1QE6A 4JI2L 4DK0A 1PRTD 4XYQA 4JI8Q 1LO5D 1WYDA 1MIUA 4NXML 2JA6G 5FLMH 3MAQA 4LF4Q 4K5WA 3PO3H 2XWBB 2IHFA 1WFQA 4CBVA 2O4XA 5JEAH 3MVVA 1I50H 4CKEA 1JORA 2QKIC 5C4XB 1D7QA 3MA2B 2A73B 3A7LA 1IBLL 2F4IA 2IL8A 3TSSA 3N6RA 5FO9B 5HGQA 1YNNC 1ENAA 2Y0SG 5ELEA 5LL6S 1PA6A 5C44B 1W3SA 4JC0A 4DAPA 1N7NA 3CCJA 1DOKA 1J0NA 1E3PA 4XQJA 5FLMG 2MPMA 3PO3G 3HFZB 5JEAG 1DD2A 2A1AA 4A75A 1HCZA 4S3SA 3QWNA 2XSCA 4DK3C 1EQTA 5FO7B 4ZUIA 3A56A 5C3EH 4UP9A 1A62A 1ILQA 1E24A 1LTSD 1TT2A 1YBYA 2E5LQ 2PMZE 4AQYL 1VQFA 5GAHC 1CTMA 3Q6SA 4A3JB 3SK8A 3S15B 4LF9Q 1SROA 3EN2A 3J81L 1IYJB 4ULLA 4F87A 1L1OB 1O78A 1VQ9A 3S1NH 1JC7A 2Q2IA 2IHEA 3D8GA 1JWSD 1NR2A 4WJWA 5EBDA 5C3EG 4BA1I 1MJCA 1WTHA 2UUCL 4UP7A 3SK6A 1VF7A 3WOFA 1LTBD 2B8GA 2VB3X 3LX0A 1SYDA 4KK7A 2FMCA 4CJ0B 3CC2A 1S5CD 4HIKA 1PFMA 1TWGB 4PMCA 1HMUA 1EQQA 5IY0A 3NTKA 3GTOB 2EYPA 4DV0Q 2UXBL 3FEWX 1LT3D 4O0AA 3PSIA 2CW0C 3SK4A 2K5WA 4A3BH 4HIDA 4XXEA 3KBXA 5FO8B 4DV7L 4C2MB 3K7UC 1F9PA 1LT5D 4LF8Q 4LF6Q 1EFID 1EIHA 1SE2A 2NB0A 3J80E 1PHJA 2Q8IB 1OJMA 1XMOQ 2FFKB 3HOZB 1RWAA 2Q2HA 4NP5A 4M1UB 1ZEQX 4Q0FA 4R8IA 1HZAA 4BBSB 4RH6A 1Q7YC 2PZTA 2JE6I 2QEXA 1SAPA 4EQ5A 2R92H 4A3BG 2F0MA 4K6LA 1X32A 3UE0A 3Q23A 4JI8L 3NPPA 2VW9A 4POFA 2OT2A 3KBUC 4LF4L 1G6ZA 3J7YW 2H5XA 1MKHA 2GVBA 4LWCA 1SLJA 3GTLH 4RGOS 3SHLA 1IBKQ 1I6HH 1UE7A 1EOTA 2BOSA 1XMQL 2NVTH 3U4ZA 1T5EA 3J81j 5IT9L 3PIOA 1HZ9A 5G3LD 2XWJB 2R92G 3HOVB 4ID6A 3O13A 4KJOA 3I4NH 4X3KA 3ULLA 1BCPF 4XDXA 5ISRA 1KXLA 3K5LA 1GM5A 3C46A 3V2TA 4I65A 5D3DA 3Q24A 2I0QA 1LTRD 4I7AA 2ZM6Q 1ENFA 2EYHA 2Z6KC 2A8VA 2WACA 3DM1A 4A4IA 4RWSC 2QCPX 1QVGA 2CWAA 4HJ7A 1KNEA 2MHVA 3G6JB 5IGCA 2E5LL 2LMCB 1LXKA 3I4NG 1GO3E 4LF9L 3NELA 2P5ZX 2L1BA 3H3VC 1YNXA 5IGEA 4DN4M 1RF2D 4HSVA 3S17H 5JEAJ 4IFDJ 1M1KC 5JVH3 2QDBA 3TEHB 2CCZA 2N88A 3HOUH 3PIP3 1O80A 3V05A 5FKAC 1BR9A 2K50A 2CKZB 1SDFA 3H0GH 1O7YA 3ITPA 3VA5A 5H1SE 1VS0A 1PFNA 3MTSA 5HY6A 3P20A 4B3MQ 2RSOA 2VL6A 3PO2H 5TSSA 4R4CA 4DV0L 2CWPA 3TS2A 1M90C 4DXGA 4FF2A 1N32Q 1HR0Q 2R7FA 1EY9A 3HOUG 1D5MC 2WB1E 1QJOA 5DEHA 3VR3A 1YNND 5FLXL 3K57A 4LF8L 1TQOA 4LF6L 3CAMA 1FGUA 1BXTA 1PFSA 3G4SA 3UD1A 4ODGA 1XMOL 5C0XJ 3PO2G 2WMIA 4E6IA 3QB3A 3E9HA 3D4WA 1PZJD 2K01A 1K0RA 1SJED 4PMWA 2QEJC 1S5ED 1VQKA 1QZHA 1AE2A 2SOBA 3T13A 1XJVA 4R4TA 4DR2Q 2UUBQ 1S72A 2R6GA 1V43A 5BN5A 1Q3LA 3OMCA 4FXKC 1WTXA 4BY7B 5LMUQ 4APVA 1Q46A 4DUYQ 1SNOA 3GTPB 1L2FA 4DK6C 2MNAA 3TREA 5I6YA 1EIGA 2OTJA 2XTIA 2Z4HA 1IW7C 1V1PB 1IBKL 1FD7D 3GV6A 4KKTA 1WI5A 1QNUA 4OELB 3CPFA 1A15A 2B2TC 4DV6Q 1EWHA 1X56A 1RHPA 3T53B 1X3FA 1X1JA 1WVLA 3L3OC 4CHTB 3R2TA 1J0MA 2J4XA 2DGYA 4A3MB 1ENCA 2ZM6L 2R61A 1VQEA 2A68C 3AQQA 4GN3B 4JBWA 4KTAA 1VQDA 3M4OB 3DM3A 3HS0C 1J9OA 1SFOH 2IPKD 4GKKQ 1X6OA 2Z4IA 1TS5A 3X3MA 3VYTA 1EY6A 1VMPA 4DNRB 4A93H 2M2LA 2RCFA 3P75A 4JPBW 5CR3A 3JAMc 2VS1A 4P71A 1PMRA 4DGZA 3A8KE 2AKWB 1CHPD 3K58A 4DFAA 1PV4A 5IP9H 1KDAA 3RZOH 1N7RA 3ER0A 2VB2X 1DCZA 3S1MH 4RCNA 1AH9A 1M4VA 3BZDB 5BN4A 4IN3A 3AU7A 5A2QL 1JB7A 3S2DB 2NN6I 3FHWA 2R7ZH 2EJGC 1C7YA 1STAA 1OJNA 2NVYH 2XRSD 5I2XA 5KGUA 4X62Q 4A93G 2B39A 1JCKB 3S1QH 5CC4A 2D5DA 2AUJD 3TBIB 1C0AA 4B3ML 4HMIA 3CXCA 2Z0SA 3ND9A 5ELDA 3W2DA 5IP9G 2OWOA 5NUCA 2QF7A 2KENA 1GUGA 4JI0Q 3RN5A 1N32L 1HR0L 2KA7A 2F0UA 3HOWH 1GJXA 2XVSA 2R7ZG 4DA2A 1RWCA 5DAUA 1N7OA 1UEAB 5ELFA 3OTOQ 2AWNA 5GADC 1TU2B 2CH4A 1EWCA 4JBJA 2PCFB 1NJIC 3U9SA 5M3MB 3I72A 2R7DA 4L5RC 3GD7A 2OF1A 3OMGA 2RA4A 1CQFA 1KDBA 1SR3A 4P75A 1WOCA 5C4JH 4X6AH 5IGFA 2WCOA 3GTGH 3RLFA 3WOEA 1L1OA 2JA7H 1RW9A 3HOWG 1PH5A 3DXJC 3K81C 4DR2L 2UUBL 2A5HA 3SGIA 4L6TB 5T1GA 1SYCA 5LMUL 4DUYL 1S5BD 1HXYD 1FR3A 3OHXC 1SN8A 1SEBD 4KJNA 4GOPB 4A3KH 4RGMA 5IGDA 2QW7A 2UUAQ 3NWTA 1L1OC 2WKCA 1WCMH 5KEEA 4G57A 1PLFA 3NENA 1NSNS 1JWUD 4UP8A 3S16H 3K59A 4DV6L 3ERQA 2JA7G 3BS1A 3W1GA 1RWGA 2IX1A 2HIXA 1U4RA 2VZAA 1IL2A 3FPPA 1YHQA 4CKCA 4DR3Q 3DEOA 1E22A 4V190 1LABA 4BY1H 4A3KG 3DUZA 1XX8A 4KN4C 2XNAC 1WCMG 3AFPA 4XQQA 4DR5Q 3CCEA 1ONLA 1LT6D 4GKKL 4A3GB 5CV9A 1G6PA 3OWFA 1NMGA 5DM63 1N9WA 1JQYD 2KUMA 4ABNA 2K5HA 4Z9CB 2PYKA 3KLSA 3CMAA 2OQKA 3LNNA 4U673 2MO0A 4A3BB 4BY1G 1ET6A 3RZDB 3MXNA 4KV6A 3UE1A 2ICEC 1K83B 3J7AF 4P74A 1DXMA 3NTIA 1CB8A 1JOQA 4X62L 5I9OA 3I73A 3KJPA
chains in the Genus database with same CATH topology
3QR8A 2P5ZX 3PQIA 3F59A 4UHVA 3UD2A 3KBUC 2KXSA 4D8OA 4DLOA 3KBTC 2KXRA 4DLQA 4MTKA 3UD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QR8 A;  2P5Z X;  3PQI A;  4UHV A;  4MTK A; 
#chains in the Genus database with same CATH topology
 5EKL A;  2EXD A;  3STB C;  2EJF C;  3PMF A;  3I70 A;  4H7B A;  1J8I A;  4DR1 Q;  2K52 A;  4IFD I;  4NMZ A;  4MN3 A;  2K5N A;  1ZXT A;  1IW7 D;  4JI0 L;  3KF8 B;  4KN7 C;  2EZV A;  1X55 A;  3MFG A;  2F3W A;  3PIP A;  1QWY A;  3X3N A;  3OTO L;  2N8N A;  3JAM E;  3HZX A;  1EIY B;  2NYZ D;  1V1Q A;  3IL8 A;  2EE1 A;  4JOI A;  1SND A;  2NZH A;  4JYA Q;  3RN2 A;  3GTM B;  3K0X A;  1Y8O B;  4K2K A;  4ME5 A;  3J7Z C;  1PZK D;  2O5J C;  4Q5V A;  2A68 D;  4OX9 Q;  3PUY A;  5IE8 A;  4WJ4 A;  4KHP Q;  2EYL A;  4C56 C;  2RF4 A;  3FP9 A;  3QOJ A;  4R4Q A;  4YWK A;  3S1R B;  2YU9 H;  1LXM A;  4V0B A;  1EQR A;  4RHS A;  1W6J A;  4JOI C;  4YWL A;  3GV3 A;  3HKZ B;  2HT1 A;  4LMQ D;  4LFC Q;  3TDQ A;  3Q22 A;  3UDF A;  2E24 A;  2LS0 1;  5C0X I;  4GNX A;  1Y1W H;  5F2D A;  5I2Y A;  1PH7 A;  2UXC Q;  2JP1 A;  4B3R Q;  2UUA L;  4FF1 A;  3L7Z C;  2X69 A;  3A55 A;  2EYJ A;  1IHZ A;  3NHH A;  5M5Y H;  1ASY A;  2F1M A;  2BA1 A;  4NDX A;  5ELN A;  2RHS B;  4XYO A;  4BBR B;  3V96 A;  1Q8I A;  1HPC A;  1VQB A;  1YJW A;  1W2B A;  4GNX C;  2ZXP A;  1MHW C;  3BVG A;  3DHQ A;  1Z9F A;  3E3X A;  4DR3 L;  1KIX A;  1D2B A;  2CQA A;  3DMU A;  1VQ7 A;  1Y1W G;  4H0L C;  1QG7 A;  2WFW A;  4WOR A;  1KL9 A;  4QL5 A;  5CV8 A;  2SDF A;  1G91 A;  3EQL C;  3M3Y B;  1I3Q H;  1I8Q A;  4WFN 3;  2VY3 A;  1CKN A;  4C3J B;  4DR5 L;  3CC7 A;  4QUF A;  1XNR Q;  4O1N A;  3S14 B;  2DUD A;  4LUZ A;  2E2H B;  2X6G A;  1RWH A;  1TWC H;  2R93 B;  2JA5 B;  3EVQ A;  1IZ6 A;  1FGB D;  1K28 A;  1VQH A;  3KLW A;  3RR5 A;  2ALY B;  2B2U A;  3PUW A;  1BBU A;  3F1Z A;  2MFI A;  3GTQ B;  2RKS A;  2A6H D;  3HRZ C;  3MC0 B;  4J1M A;  1B44 D;  3TP8 A;  4LNQ A;  3DEP A;  1KAB A;  5GQO A;  3UI2 A;  4EQO A;  1V1P A;  5DM7 3;  5J1Z A;  2F0H A;  2HDM A;  1QVC A;  4KI0 A;  2EY6 A;  4L5S A;  2HD3 A;  2OTL A;  3ICE A;  1VCI A;  1ROD A;  4DR1 L;  2EY5 A;  4ZRZ A;  2K32 A;  1TWA B;  1A0I A;  1K73 C;  4F8M A;  3M7N A;  3KBG A;  3U7V A;  3GO5 A;  1UE6 A;  4NB3 A;  3SE0 A;  4P2C B;  1CFM A;  3PUX A;  1TS2 A;  1EEF D;  5CGK A;  1K3B C;  1B3Q A;  2F0L A;  4XIG S;  1GHK A;  1Q1B A;  1MD2 D;  4ME3 A;  2L5T A;  1EZ8 A;  1EY8 A;  1U4M A;  4JYA L;  1EYD A;  1HTL D;  5DLQ E;  1YJ9 A;  4OX9 L;  1HUN A;  4KHP L;  1SNM A;  1VQN A;  1H9S A;  4HJ5 A;  3CQZ B;  1XMQ Q;  1K9M C;  4HJA A;  4A3D B;  1VDZ A;  1V1O A;  2NTS A;  5IYD H;  4HCE A;  4A76 A;  4D71 A;  4LFC L;  2FHT A;  5T1I A;  1DOL A;  1SXT A;  3EFX D;  1HQM C;  2UXC L;  4B3R L;  1D6E C;  2VXW A;  2K5V A;  3I90 A;  3MZ5 A;  1BCP B;  4A3I H;  3JAM i;  3U50 C;  1PH2 A;  5JJI A;  4JI1 Q;  3OWE B;  2DNC A;  3GDE A;  3I4M B;  2QGQ A;  1PTO B;  5IYD G;  4QQB X;  1N7P A;  1AW7 A;  4DV3 Q;  1DZ1 A;  1GOZ A;  3HOX B;  2MUY A;  5ELC A;  3FVQ A;  1S40 A;  1SMY C;  3STB D;  3IFT A;  1SRU A;  2F0Q A;  2OCE A;  3T56 B;  5L37 A;  4LAA A;  5KIX A;  1GVP A;  2NVX H;  2KQ3 A;  4DV2 Q;  3BDC A;  3ZJY C;  1B1Z A;  2KEE A;  3HP3 A;  1SJH D;  3NBI A;  4A3I G;  1XNR L;  2E2I H;  4AYB G;  1STN A;  1VMC A;  1PYS B;  5D65 A;  2EYO A;  1HRJ A;  2A69 C;  3R93 A;  2DJF C;  3WDN A;  4IPD A;  5CV4 A;  5LMN W;  4P72 A;  4KY5 A;  2EIF A;  5JVG 3;  3E0E A;  3CW2 C;  1CA6 A;  3PV0 A;  1CA5 A;  4Y7N H;  2YTV A;  3H91 A;  4GOP A;  3MEH A;  1PRT B;  1LTG D;  4CDD C;  1HJP A;  4K14 A;  4D1J A;  3CME A;  3UDX A;  1NTG A;  3S9W A;  2Z9H A;  3NBH A;  4HTH A;  5EPJ A;  2AQ1 B;  3L9A X;  5EKK A;  4R8N A;  5AFW A;  1Q81 C;  2FJ2 A;  4LFB Q;  5IOC A;  2WB1 B;  2K4K A;  4RCO A;  2Z6B A;  4GOP C;  2H4O A;  1NBW A;  3EIV A;  5M3F H;  1W6K A;  2JA7 B;  4YHH Q;  1XTC D;  2ID0 A;  4JI7 Q;  4YY3 Q;  1HNW Q;  3NQT A;  2B29 A;  2GA4 B;  4GZY C;  1EU4 A;  2K5Q A;  4PZ7 A;  2QDL A;  2I46 A;  1NCV A;  4KLK A;  1KRT A;  1QUQ B;  3F2B A;  3MXN B;  3VYS A;  1BQQ T;  3MXU A;  1RDP D;  4OEM B;  3H3V H;  2MO1 A;  1R4Q B;  5CMD A;  3CCM A;  1EY0 A;  5M3F G;  1PVO A;  2G9D A;  2XGT A;  4KHV A;  2XRQ D;  1I4G A;  2A6E C;  3K0Y A;  1EIF A;  4RMF A;  3GTJ B;  1R9T H;  2OXP A;  4C3I H;  4JBK A;  3OIP A;  3CPW A;  4LF7 Q;  3E0J A;  4D6C A;  3DWA A;  4KY6 A;  1FNW A;  2L55 A;  3A8J E;  2K05 A;  4KY7 A;  5HUR A;  3CCU A;  4G7O C;  4OWX B;  3CHB D;  5IYC H;  3CCL A;  3F59 A;  1PTO F;  1E2V A;  4FVM A;  2EPB A;  4JI1 L;  4IAL A;  4BS9 A;  4NXN Q;  3E9I A;  5E7N A;  1CQV A;  4DV3 L;  3KF8 A;  4DV4 Q;  4C3I G;  3OW2 A;  1EZ6 A;  2WIN B;  4JV5 Q;  4JK1 C;  4HIO A;  2Q8R E;  3KK7 A;  3RUZ A;  1T9H A;  1VQ4 A;  3J7A V;  2NVQ B;  1JT8 A;  4DPG A;  4DV2 L;  5IYC G;  4EX5 A;  1N7Q A;  4UY8 C;  3KJO A;  4TSS A;  1EUJ A;  4C1N I;  4GNX B;  3K7A H;  2K7V A;  3H6M A;  1X1H A;  4FF3 A;  1GUN A;  1O7Z A;  3OPO A;  4NKL A;  4OHJ A;  1D1I A;  1RL2 A;  3H09 A;  3QR8 A;  1PRT F;  5BN3 A;  1A3V A;  3U9O A;  2YTX A;  3TZD A;  2XN9 C;  1DYQ A;  1HA6 A;  1N36 Q;  3H15 A;  2WAQ G;  2F0V A;  4N8X 1;  5I4D A;  4CJ1 B;  4D8O A;  2ENB A;  4QCL A;  4X65 Q;  3FKI H;  1LYL A;  4OGQ C;  3H0G G;  3KFU A;  4A3E B;  2K5D A;  1Y1V H;  4MZ9 A;  1TWF H;  4DXF A;  2E2J B;  1CKN B;  4D1I A;  1YEZ A;  4LFB L;  4QUC A;  2V1C C;  5C3W A;  2F0E A;  2B2V A;  4YHH L;  4JI7 L;  4P73 A;  3A8I E;  3UDI A;  4YY3 L;  1HNX Q;  1HNW L;  2KHI A;  3GP7 A;  4EGV A;  2JA8 B;  1BBX C;  1BO0 A;  4JI3 Q;  1CUK A;  2F0P A;  3BG3 A;  3CRK C;  3FKI G;  5GAE C;  1Y1W B;  4DUZ Q;  2Q1F A;  1E7Z A;  1B7Y B;  3HG9 A;  3VDY A;  3MHB A;  3D4D A;  2F0W A;  1SMY D;  3LGJ A;  1UE1 A;  1Y1V G;  2B2V C;  3T1Y Q;  3CCS A;  4RGN A;  4C3H B;  1V9P A;  5M5X B;  4JI4 Q;  3S2H B;  3NTH A;  4JCV E;  3M7G A;  3J80 L;  1UUP A;  3IRB A;  5FK9 C;  1RWF A;  2BRV X;  2HCC A;  4K5V A;  3J80 i;  1HM2 A;  1SBB B;  2IX3 A;  4LF7 L;  2A69 D;  4FXD A;  4L5Q A;  5IGG A;  3G48 A;  3LWU A;  1WTW A;  1KQS A;  5JJL A;  1LAC A;  4KKU A;  4RA8 A;  1BOS A;  2FXQ A;  1DJR D;  2B63 B;  5C4X H;  1CKO A;  4LFA Q;  4NXN L;  1ICW A;  3TP7 A;  2CW0 D;  1STE A;  4OWT B;  1TWH B;  1N34 Q;  4A3C H;  5C5M A;  2PI2 E;  4DV4 L;  3A7A B;  4GS3 A;  2NZ1 D;  2LY7 A;  4JV5 L;  1I4P A;  1I4Q A;  1HMW A;  1T5X D;  5C44 H;  1DOM A;  1H9S B;  5M5W B;  3F2D A;  1EYG A;  3L2P A;  3I4O A;  5LHY 1;  3AB9 A;  2BRP A;  1I4H A;  5BR8 Q;  2LXK A;  2JEA I;  4JI6 Q;  1Z47 A;  5C4X G;  3C3L A;  4HJ9 A;  4ALP A;  2JA6 B;  3I55 A;  5EJW A;  1DGS A;  4A3C G;  1ESF A;  1K8O A;  4K0K Q;  1SE8 A;  3SK5 A;  2WKD A;  2IT1 A;  3D6C A;  3FRP B;  1RTN A;  1YNJ C;  1CT1 D;  4BWG B;  5C44 G;  4X3S A;  2ZTE A;  5LMN Q;  1XWE A;  1YIT A;  4A3J H;  3GQB A;  3S15 H;  1HFN A;  1HN0 A;  4TKO B;  5E4W C;  1N36 L;  2Y0S B;  1YHA A;  4EVO A;  1SE4 A;  2RQX A;  4X65 L;  2KXS A;  2PQA B;  1LTI D;  3PO3 B;  1OXX K;  1VQP A;  1ICF B;  1IL8 A;  1LT4 D;  1ML0 D;  2N3S A;  1I50 B;  1WTO A;  2MGS A;  3HEJ A;  3J81 c;  5G3L F;  2EXZ A;  1D8L A;  4K8J A;  4DNI A;  3ULJ A;  3G6E A;  1M8A A;  1JIC A;  4A3J G;  1Q86 C;  2JQO A;  1BDO A;  3TS0 A;  1HNX L;  1TWG H;  4IPC A;  1MGS A;  1BCP C;  4UHV A;  4PMB A;  1KDC A;  1KLU D;  3GTO H;  1HNZ Q;  5E1F A;  2ZT9 C;  4JI3 L;  1VQO A;  4DUZ L;  2QA4 A;  2FMM A;  1PTO C;  4JI5 Q;  1A63 A;  4YWM A;  1R4P B;  2WDA A;  4C2M H;  4D6G A;  3MWY W;  4D6I A;  3T1Y L;  1VQ8 A;  1EEI D;  1F2M A;  4IQZ A;  1UWV A;  1CI3 M;  2K28 A;  1KAW A;  1GUT A;  4JI4 L;  5C3E B;  4AH6 A;  5CV7 A;  3RLN A;  3HOZ H;  2HQE A;  5C6A A;  3CU7 A;  2F0K A;  5J22 A;  3NBH B;  2RDH A;  1F2Z A;  4BBS H;  3IFD A;  1E1T A;  1I4X A;  4YIJ A;  4RGT A;  5JOB A;  5C4Z A;  1H9M A;  2L12 A;  3A0J A;  1EWI A;  3T51 B;  2G5D A;  1D5X C;  1PH6 A;  3S1N B;  2BDN A;  1B8A A;  4QMG A;  2AQ3 B;  1IBM Q;  3R8B A;  1PH4 A;  1U0L A;  4LFA L;  1NMF A;  2K1B A;  3HOZ G;  2JXM B;  3ERS X;  1N34 L;  1Y14 B;  2NBF A;  3I7F A;  1PRT C;  1B4O A;  2DNE A;  2F0T A;  2PNR C;  5C4H A;  1A2U A;  4BBS G;  1TR5 A;  5CYU A;  3HOV H;  3PCO B;  3PUV A;  4UAI A;  3A5Z B;  1SYF A;  1PDQ A;  1QOH A;  4HR7 B;  3HKS A;  4DR7 Q;  3DWP A;  5BR8 L;  1QUQ A;  5IT9 c;  4JI6 L;  2A74 C;  1SYE A;  4FP5 D;  1XPO A;  1I4R A;  2TMP A;  2IJ0 A;  4QIW E;  2L4N A;  1U4P A;  4K0K L;  1K0S A;  1LOH A;  1VQJ A;  3CD6 A;  3HOV G;  5JJZ A;  3URY A;  5EPK A;  5LMN L;  3UDG A;  1PYW D;  2SNM A;  1SNQ A;  1F1S A;  2R92 B;  5ELB A;  1TY2 A;  4L63 B;  1IYU A;  1C48 A;  4DAV A;  4RKB A;  1S5D D;  2PW5 A;  1EYA A;  3TP5 A;  1CK1 A;  1L0Y B;  1OJP A;  3J7A 5;  4XT1 B;  2D2C C;  2YV5 A;  5IYB H;  4R9W A;  2H1E A;  2VNU D;  2KEC A;  4QB4 A;  2K75 A;  3GTL B;  3KUP A;  4LF5 Q;  2AUK A;  2KCT A;  1B50 A;  4X66 Q;  1I6H B;  1TXY A;  4J15 A;  2NVT B;  2LSS A;  4PZ8 A;  1PH9 A;  2BRW A;  1X3E A;  4IO9 A;  3GTK H;  3I4N B;  1HNZ L;  1OXU A;  3TME A;  2C5C A;  4AYB E;  2KHJ A;  2WMF A;  4JI5 L;  1KD1 C;  2BE5 C;  4DAM A;  2F03 A;  3BZK A;  1ZYR C;  5IYB G;  3I3C A;  1TII D;  3K8A A;  2F0S A;  2Q8T A;  1OXT A;  4RHR A;  3OSO A;  2K14 A;  2JYO A;  1B9N A;  1LV9 A;  1RD9 D;  4IUP A;  4O42 A;  3K5M A;  3K5N A;  2UU9 Q;  2NZO A;  1DM0 B;  5FLX c;  2BA0 A;  1UNS A;  4DR4 Q;  4DU9 A;  3PF4 A;  2F0O A;  3J81 E;  3NUC A;  4ZYS A;  1B53 A;  2BCO A;  1OXS C;  1G2S A;  1VQI A;  4U68 A;  4TQU S;  3R2I A;  5KNC A;  4EQN A;  3S17 B;  2HIV A;  1EY5 A;  4YCV A;  1F9G A;  4BY7 H;  1OXV A;  4FF4 A;  1NUC A;  2ZTC A;  4AIM A;  4RKL A;  1IBM L;  3GTP H;  2PMZ B;  3HOU B;  1F77 A;  2TSS A;  5GRO A;  2PZW A;  4WJ3 M;  1QCB D;  2JEB I;  3H0G B;  3RMH A;  3BYY B;  1QB5 D;  1XNQ Q;  1E2W A;  3VR5 A;  1CM9 A;  2JK8 A;  2F0D A;  3PO2 B;  4ZK9 B;  1HFG A;  2E75 C;  3DLL A;  3CRL C;  1PZI D;  3WWV A;  4OO1 H;  4DR7 L;  4BY7 G;  4R4I A;  1A3U A;  1BCP D;  2R3Z A;  2WV6 D;  1W3Y A;  3M4O H;  4X3T A;  1KHI A;  1VQA A;  4ZAI A;  2AWO A;  1S3O A;  2J0T D;  4RAU C;  1EQV A;  1XPR A;  2VUM H;  1EY4 A;  2B2U C;  3M4Y A;  2N78 A;  3CF5 A;  1Q8K A;  4KMU C;  1F2Y A;  4OO1 G;  2L11 A;  2O2L D;  3KDF A;  1YHB A;  1VF5 C;  1XXG A;  5FJ8 H;  5IIF A;  4G7H C;  1C9O A;  4GLX A;  1WTP A;  3N52 A;  1LTT D;  3H94 A;  3RLO A;  1HA5 A;  1QIL A;  3QOL A;  3S2D H;  1LM0 A;  5KYI A;  4IUT A;  2ZXO A;  1S5F D;  3UD2 A;  2VUM G;  4N9P A;  4LF5 L;  3AMU A;  1FL0 A;  4X66 L;  2F0G A;  5IT9 E;  1JWM D;  1RJT A;  5GAG C;  1H9R A;  2PZU A;  5FJ8 G;  2PPB C;  1A6X A;  1YI2 A;  4HAE A;  4A3F H;  1H95 A;  3I2Z A;  3NQI A;  2V4D A;  1Z6H A;  1XYI A;  1FYC A;  2K33 A;  4JBM A;  1SMX A;  1ZKO A;  5HGT A;  1DON A;  2F0I A;  4J6H A;  1KAA A;  1OO9 B;  1WD1 A;  4IFD H;  2E2D C;  5EPL A;  3JAM L;  5M3M H;  1VQG A;  3HKZ E;  4ILW A;  4EQP A;  3VYR A;  1X65 A;  1SFO B;  5C5L A;  2UU9 L;  2Z8L A;  3L0O A;  1SNP A;  3MEF A;  4A93 B;  2E8G A;  2WAQ E;  4DR4 L;  4A3F G;  2F3I A;  1KNA A;  4ZCK A;  1WD0 A;  1FJG Q;  1BUV T;  1WJJ A;  2EDG A;  4OON A;  2D0P A;  2K03 A;  2M00 A;  3RZO B;  2PQA A;  3S1M B;  4IFD G;  1AE3 A;  4DAY A;  1I5F A;  5M3M G;  2R7Z B;  3ND8 A;  1WTR A;  2EQS A;  1Y8N B;  3VYU A;  2E22 A;  1JE5 A;  2NVY B;  4IUQ A;  2D9U A;  3BVM A;  1A8V A;  2OEO A;  1XNQ L;  1U9R A;  2G9H D;  1E1O A;  3S1Q B;  1O7L A;  2GN5 A;  4OXP A;  4D6H A;  5C0X H;  2ES2 A;  2X03 A;  3SEB A;  1HUM A;  1G8Z D;  2NTT A;  4FYD A;  4M8A A;  1L0X B;  3T16 A;  1A2T A;  3F2C A;  4ZLT F;  1LTA D;  1JE4 A;  3D31 A;  3HOW B;  4K2L A;  5FLX E;  3J81 i;  3I4L A;  2N55 A;  1X3G A;  3CC4 A;  2MQH A;  1XTD A;  5KRU A;  3IKJ A;  2MP1 A;  2PW7 A;  2EY2 A;  5E3F A;  1CZG A;  4RFB A;  5KYL A;  2CFM A;  2BE5 D;  1B9M A;  3KF6 A;  3MXP A;  4A3G H;  1X54 A;  5C0X G;  1ZYR D;  2JN4 A;  4HJ8 A;  4PV1 C;  1B70 B;  5C4J B;  1PH3 A;  2VQE Q;  3C2P A;  3Q0A A;  3GTG B;  3K6O A;  1E2Z A;  5IP7 H;  3CCR A;  1EY7 A;  3SVM A;  5C3X A;  2UXD Q;  1NE3 A;  3RZD H;  1CSP A;  4GN5 A;  2K6A A;  1K83 H;  2WMK A;  5J39 A;  2B2Y A;  4HMJ A;  4LUO A;  5EAY A;  3A5U A;  2KJX A;  4A3K B;  4A3G G;  4Y52 H;  2N49 A;  1WCM B;  1JJG A;  1Q90 A;  1D5Z C;  1J5E Q;  4I7Z C;  3S16 B;  3SDZ A;  3G71 A;  5IP7 G;  4B3T Q;  3D3R A;  2L15 A;  3OW7 A;  5A35 A;  2E76 C;  2B2Y C;  3T1H Q;  2KED A;  5IOD A;  3CKI B;  4HN7 A;  1SYG A;  1GKH A;  4BY1 B;  1KRS A;  2M9V A;  3QJY A;  4IJH A;  4O2D A;  1H9J A;  2CQO A;  1CKM A;  2IY5 B;  4H02 A;  4JVZ A;  2YTY A;  3GTM H;  2Z6K A;  1N33 Q;  2WMJ A;  1LUZ A;  4ZQ3 A;  1FJG L;  4IUV A;  4OIJ A;  1RTO A;  3ERO A;  4DF7 A;  3S1R H;  1X9N A;  4LJZ C;  3BU2 A;  3P1H A;  4CDE C;  1MJE A;  1JJC B;  3OIQ A;  1F9Q A;  4CJ2 C;  1G29 1;  2DY7 A;  5A2Q E;  1Q12 A;  3C1E A;  1CSQ A;  2IX0 A;  1QZG A;  1MSH A;  1SE3 A;  1Y69 U;  1GHJ A;  4MIU A;  1IXR A;  4RG1 A;  4WRD A;  2I5H A;  2BDO A;  4FXG C;  4QJF A;  3HOY H;  4IOA A;  3NK9 A;  4BBR H;  2HQL A;  1JJ2 A;  4G7Z C;  5I9P A;  1TVX A;  2B8F A;  5FOB B;  1C8C A;  2VQF Q;  3HKZ G;  2BH2 A;  1VQC A;  4IUU A;  1C4Q A;  4HIM A;  1II3 A;  2L0C A;  1ESR A;  3KBT C;  4DLQ A;  4YCW A;  1I94 Q;  1LLR D;  1X3Q A;  2WP8 J;  3M3Y H;  2F0F A;  2ZTD A;  2D0O A;  4LUV A;  4C3J H;  3HOY G;  1HZB A;  4X3U A;  1SSO A;  3S14 H;  2I5L X;  4BBR G;  1RCV D;  2E2H H;  3TQY A;  5AJ3 Q;  2R93 H;  1TKW B;  4L8J A;  2VQE L;  2KCM A;  2JA5 H;  3GTK B;  5EGT A;  4IJL A;  2EYM A;  4JW0 A;  3FMC A;  4GLV B;  3U58 A;  2YU9 B;  2EYF A;  3NEM A;  2LKV A;  2UXD L;  4LW1 A;  1O7I A;  2AHO B;  3GTQ H;  2EVB A;  3I91 A;  4C3J G;  3MFY A;  4DV1 Q;  2C9O A;  5J3B A;  3EA6 A;  4F7X A;  5M5Y B;  3R3O A;  2R93 G;  3G7L A;  3B6Y A;  3PUZ A;  4UDU C;  1J5E L;  2JA5 G;  1AP0 A;  3BVZ A;  2PNH A;  2Z1C A;  4B3T L;  4HSP A;  1STY A;  1TWA H;  3T1H L;  4IUN A;  4B08 A;  2EOT A;  4OIK A;  2LFN A;  3E5S A;  3BZC A;  3W3A A;  2RHQ B;  4IUR A;  1GXD C;  2B2T A;  4PG3 A;  4A3L H;  3BYT B;  3KDF B;  4JG2 A;  3CCV A;  3M85 A;  2DY8 A;  1I3Q B;  3CP0 A;  3Q8D A;  5JPN C;  3T4A C;  1KTK A;  3TN2 A;  1N33 L;  2RSN A;  1TWC B;  4MNO A;  2HDL A;  3U4V A;  5IGB A;  3CQZ H;  4A3D H;  2DN8 A;  4GLA C;  2BH8 A;  4A3L G;  4GN4 B;  1RKN A;  3KYH C;  3F8T A;  4FDB A;  4B3S Q;  4DV5 Q;  1YIJ A;  2NUC A;  4NPS A;  2B3G A;  2RDG A;  2KCC A;  4XTC S;  4CDF C;  1BKB A;  2VUM B;  1HTP A;  1ET9 A;  5LL6 X;  3C1F A;  3JC6 6;  1ASZ A;  5CV5 A;  4A3D G;  3I4M H;  1PTO H;  1I6V C;  2LXJ A;  4D6J A;  2VQF L;  5EBC A;  3HOX H;  1JMC A;  2F0N A;  5D14 A;  1RIP A;  1TS3 A;  1YVC A;  2ASB A;  1IKM A;  4QIW B;  1WTQ A;  1I94 L;  2C35 B;  3QG1 A;  4D72 A;  1VQL A;  4XT3 B;  5ELO A;  3HGB A;  4CDC C;  1K8M A;  2AQ2 B;  2NWG A;  3OYY A;  2CHB D;  3RNU A;  4QY7 A;  2A6E D;  1CHQ D;  5K36 H;  2O5I C;  2KHS A;  1X3P A;  2L9H A;  3LWE A;  4DAY B;  2PO4 A;  1BF4 A;  4IPG A;  5E4X A;  2IWH A;  3I4M G;  5AJ3 L;  3SR1 A;  1TY0 A;  4D6F A;  4QF4 A;  1PH8 A;  1AN8 A;  3HOX G;  2K04 A;  1EFW A;  2KBN A;  4X64 Q;  1G2T A;  2KXR A;  5EQ0 A;  4CKB A;  4A3F B;  1YJN A;  2HCI A;  3SXH A;  2KVM A;  3IAY A;  3TRZ A;  5CV6 A;  3TP6 A;  5IWA Q;  3F2U A;  5K36 G;  4ZUJ A;  2HHH Q;  4DV1 L;  5I6W A;  2SEB D;  1F2L A;  3TZU A;  3OOC A;  1TS4 A;  4A3I B;  2E74 C;  1J6Q A;  2F0J A;  4OWW B;  4DNT B;  1IKL A;  1N8R C;  4AYB B;  2A6H C;  5JPM C;  1SNC A;  3KLR A;  3KF6 B;  3KOJ A;  4N8F A;  1PH1 A;  3AFQ A;  1BNZ A;  4IPH A;  5COR A;  2F3V A;  2CVR A;  4F88 A;  4L5T A;  4B9W A;  1NY4 A;  3I56 A;  5KND A;  4PQX A;  5K5P A;  1EYC A;  3ONA B;  2Q2T A;  4ZKC B;  2NVX B;  1CZW A;  1S4Z A;  1H9K A;  1Y8P B;  4PNY A;  1Q82 C;  2E2I B;  1QNK A;  2ZJP A;  1K3R A;  4OO1 I;  4KD4 A;  1B2T A;  4YCU A;  2WB1 G;  1SYB A;  1PXU A;  3NE5 B;  4C1N K;  2WMG A;  2OQ0 A;  1OTC A;  1VQ6 A;  3GTJ H;  4K6D A;  1AEX A;  4Y7N B;  1NNX A;  3KLS X;  1EU3 A;  1PFB A;  5EKI A;  4B3S L;  4DV5 L;  3PQI A;  1F9S A;  1FNU A;  3ZYY X;  3PGZ A;  4H13 C;  1VQ5 A;  4GKJ Q;  2ICI A;  1LTL A;  3EJI A;  2HUG A;  1KLG D;  2EY1 A;  2RCN A;  3NP8 A;  4H44 C;  5JJK A;  3DWQ A;  4DR6 Q;  3FDT A;  2F52 A;  4KKS A;  4BXX H;  1JOO A;  1MSG A;  3RD4 A;  1PYB A;  3ULP A;  4NW2 A;  4MHE A;  5M3F B;  4IZ8 A;  1JB3 A;  2ZXR A;  1U4L A;  3FPU B;  2EJM A;  3I8Z A;  2NVQ H;  4BA2 I;  2F4V Q;  3BDO A;  1HHV A;  3VA7 A;  2B2W A;  1L0W A;  1VQM A;  1NAP A;  3CCQ A;  3K80 C;  2Y0S E;  1X1I A;  4BXX G;  3M4Q A;  1K8G A;  3A74 A;  5D3I B;  1AZQ A;  4ZKB B;  1Q1E A;  2GVA A;  4X64 L;  3E6Z X;  5M9O A;  2B2W C;  2NN6 H;  3M9B A;  4G4K A;  4MTK A;  2X6L A;  1R9T B;  4C3I B;  4K5X A;  1D1K A;  3QO2 A;  5IWA L;  1KC8 C;  4D6E A;  3PIO 3;  5CBA E;  1WTV A;  2PI2 A;  3VR6 A;  2HHH L;  4R4O A;  1YZ6 A;  4JI2 Q;  3MXG A;  3QIA A;  4KHZ A;  4R1J A;  3VR2 A;  4NXM Q;  4OL7 A;  4MTN A;  3NWS A;  1BBW A;  3NSW A;  4A3E H;  1Z7T A;  1HH2 P;  1HZC A;  1EOV A;  3NXW A;  1E0B A;  2E2J H;  3EBE A;  5COY A;  1GUO A;  1B3A A;  2MJ8 A;  2NN6 G;  4QGU A;  4HED A;  1IBL Q;  2ATW A;  1A3T A;  4DKA C;  4TVA B;  1HQR D;  2JJQ A;  4PZ6 A;  4J8Q A;  3AEV A;  2JA8 H;  2AMC B;  2Q2U A;  2ZJR A;  1YNJ D;  4TRD A;  2WAQ B;  3W1B A;  1ILP A;  1GUW A;  4A3E G;  4FO2 A;  2D62 A;  2WII B;  2YYZ A;  4LK1 C;  3HOY B;  4C3H H;  5M5X H;  3K7A B;  1EGU A;  3K5O A;  3S2H H;  2WMH A;  2ZJQ A;  2FIN B;  1P8L A;  1K8A C;  4AQY Q;  2WMI B;  2J7Z A;  4POG A;  4DLO A;  4CGY B;  2JA8 G;  1STB A;  2CH4 W;  4B9X A;  3W5O A;  2KOL A;  3D0F A;  4KD3 A;  2PQE A;  2RBM A;  3J80 c;  4A3M H;  2XIW A;  4GKJ L;  4DK1 A;  1NR4 A;  5KNB A;  1MBY A;  1EL0 A;  3FKI B;  4C3H G;  1IYV A;  3P7J A;  5JAV A;  3BJU A;  4DR6 L;  1HM3 A;  2B63 H;  1Y1V B;  3M4P A;  1TWF B;  3D4R A;  1F9R A;  2UUC Q;  1PTO D;  1P16 A;  4HCS A;  1TWH H;  2KCN A;  3BDL A;  1UAP A;  4IOC A;  1C82 A;  1OJO A;  2RDF A;  3AYH B;  1STH A;  1UE5 A;  2DJG C;  1AZP A;  1GD7 A;  2SNS A;  2JA9 A;  1HR0 W;  1XPU A;  3H3V I;  4A3M G;  5M5W H;  2UXB Q;  2F4V L;  4D6D A;  1UEB A;  1FNV A;  1V8Q A;  3A54 A;  3PF5 A;  2QIL A;  2RVL A;  5CBE E;  4XQN A;  1JOK A;  4DV7 Q;  2B63 G;  1BVS A;  2JA6 H;  1QVF A;  1G51 A;  3D6W A;  4N9T A;  2I07 B;  1GUS A;  1STG A;  2IW3 A;  3VR4 A;  1JR0 D;  3S24 A;  4FNF A;  1AFP A;  1U5K A;  2JSO A;  5DNF A;  4UPA A;  1MI2 A;  1FVI A;  2A19 A;  4K8I A;  2I5M X;  1QE6 A;  4JI2 L;  4DK0 A;  1PRT D;  4XYQ A;  4JI8 Q;  1LO5 D;  1WYD A;  1MIU A;  4NXM L;  2JA6 G;  5FLM H;  3MAQ A;  4LF4 Q;  4K5W A;  3PO3 H;  2XWB B;  2IHF A;  1WFQ A;  4CBV A;  2O4X A;  5JEA H;  3MVV A;  1I50 H;  4CKE A;  1JOR A;  2QKI C;  5C4X B;  1D7Q A;  3MA2 B;  2A73 B;  3A7L A;  1IBL L;  2F4I A;  2IL8 A;  3TSS A;  3N6R A;  5FO9 B;  5HGQ A;  1YNN C;  1ENA A;  2Y0S G;  5ELE A;  5LL6 S;  1PA6 A;  5C44 B;  1W3S A;  4JC0 A;  4DAP A;  1N7N A;  3CCJ A;  1DOK A;  1J0N A;  1E3P A;  4XQJ A;  5FLM G;  2MPM A;  3PO3 G;  3HFZ B;  5JEA G;  1DD2 A;  2A1A A;  4A75 A;  1HCZ A;  4S3S A;  3QWN A;  2XSC A;  4DK3 C;  1EQT A;  5FO7 B;  4ZUI A;  3A56 A;  5C3E H;  4UP9 A;  1A62 A;  1ILQ A;  1E24 A;  1LTS D;  1TT2 A;  1YBY A;  2E5L Q;  2PMZ E;  4AQY L;  1VQF A;  5GAH C;  1CTM A;  3Q6S A;  4A3J B;  3SK8 A;  3S15 B;  4LF9 Q;  1SRO A;  3EN2 A;  3J81 L;  1IYJ B;  4ULL A;  4F87 A;  1L1O B;  1O78 A;  1VQ9 A;  3S1N H;  1JC7 A;  2Q2I A;  2IHE A;  3D8G A;  1JWS D;  1NR2 A;  4WJW A;  5EBD A;  5C3E G;  4BA1 I;  1MJC A;  1WTH A;  2UUC L;  4UP7 A;  3SK6 A;  1VF7 A;  3WOF A;  1LTB D;  2B8G A;  2VB3 X;  3LX0 A;  1SYD A;  4KK7 A;  2FMC A;  4CJ0 B;  3CC2 A;  1S5C D;  4HIK A;  1PFM A;  1TWG B;  4PMC A;  1HMU A;  1EQQ A;  5IY0 A;  3NTK A;  3GTO B;  2EYP A;  4DV0 Q;  2UXB L;  3FEW X;  1LT3 D;  4O0A A;  3PSI A;  2CW0 C;  3SK4 A;  2K5W A;  4A3B H;  4HID A;  4XXE A;  3KBX A;  5FO8 B;  4DV7 L;  4C2M B;  3K7U C;  1F9P A;  1LT5 D;  4LF8 Q;  4LF6 Q;  1EFI D;  1EIH A;  1SE2 A;  2NB0 A;  3J80 E;  1PHJ A;  2Q8I B;  1OJM A;  1XMO Q;  2FFK B;  3HOZ B;  1RWA A;  2Q2H A;  4NP5 A;  4M1U B;  1ZEQ X;  4Q0F A;  4R8I A;  1HZA A;  4BBS B;  4RH6 A;  1Q7Y C;  2PZT A;  2JE6 I;  2QEX A;  1SAP A;  4EQ5 A;  2R92 H;  4A3B G;  2F0M A;  4K6L A;  1X32 A;  3UE0 A;  3Q23 A;  4JI8 L;  3NPP A;  2VW9 A;  4POF A;  2OT2 A;  3KBU C;  4LF4 L;  1G6Z A;  3J7Y W;  2H5X A;  1MKH A;  2GVB A;  4LWC A;  1SLJ A;  3GTL H;  4RGO S;  3SHL A;  1IBK Q;  1I6H H;  1UE7 A;  1EOT A;  2BOS A;  1XMQ L;  2NVT H;  3U4Z A;  1T5E A;  3J81 j;  5IT9 L;  3PIO A;  1HZ9 A;  5G3L D;  2XWJ B;  2R92 G;  3HOV B;  4ID6 A;  3O13 A;  4KJO A;  3I4N H;  4X3K A;  3ULL A;  1BCP F;  4XDX A;  5ISR A;  1KXL A;  3K5L A;  1GM5 A;  3C46 A;  3V2T A;  4I65 A;  5D3D A;  3Q24 A;  2I0Q A;  1LTR D;  4I7A A;  2ZM6 Q;  1ENF A;  2EYH A;  2Z6K C;  2A8V A;  2WAC A;  3DM1 A;  4A4I A;  4RWS C;  2QCP X;  1QVG A;  2CWA A;  4HJ7 A;  1KNE A;  2MHV A;  3G6J B;  5IGC A;  2E5L L;  2LMC B;  1LXK A;  3I4N G;  1GO3 E;  4LF9 L;  3NEL A;  2P5Z X;  2L1B A;  3H3V C;  1YNX A;  5IGE A;  4DN4 M;  1RF2 D;  4HSV A;  3S17 H;  5JEA J;  4IFD J;  1M1K C;  5JVH 3;  2QDB A;  3TEH B;  2CCZ A;  2N88 A;  3HOU H;  3PIP 3;  1O80 A;  3V05 A;  5FKA C;  1BR9 A;  2K50 A;  2CKZ B;  1SDF A;  3H0G H;  1O7Y A;  3ITP A;  3VA5 A;  5H1S E;  1VS0 A;  1PFN A;  3MTS A;  5HY6 A;  3P20 A;  4B3M Q;  2RSO A;  2VL6 A;  3PO2 H;  5TSS A;  4R4C A;  4DV0 L;  2CWP A;  3TS2 A;  1M90 C;  4DXG A;  4FF2 A;  1N32 Q;  1HR0 Q;  2R7F A;  1EY9 A;  3HOU G;  1D5M C;  2WB1 E;  1QJO A;  5DEH A;  3VR3 A;  1YNN D;  5FLX L;  3K57 A;  4LF8 L;  1TQO A;  4LF6 L;  3CAM A;  1FGU A;  1BXT A;  1PFS A;  3G4S A;  3UD1 A;  4ODG A;  1XMO L;  5C0X J;  3PO2 G;  2WMI A;  4E6I A;  3QB3 A;  3E9H A;  3D4W A;  1PZJ D;  2K01 A;  1K0R A;  1SJE D;  4PMW A;  2QEJ C;  1S5E D;  1VQK A;  1QZH A;  1AE2 A;  2SOB A;  3T13 A;  1XJV A;  4R4T A;  4DR2 Q;  2UUB Q;  1S72 A;  2R6G A;  1V43 A;  5BN5 A;  1Q3L A;  3OMC A;  4FXK C;  1WTX A;  4BY7 B;  5LMU Q;  4APV A;  1Q46 A;  4DUY Q;  1SNO A;  3GTP B;  1L2F A;  4DK6 C;  2MNA A;  3TRE A;  5I6Y A;  1EIG A;  2OTJ A;  2XTI A;  2Z4H A;  1IW7 C;  1V1P B;  1IBK L;  1FD7 D;  3GV6 A;  4KKT A;  1WI5 A;  1QNU A;  4OEL B;  3CPF A;  1A15 A;  2B2T C;  4DV6 Q;  1EWH A;  1X56 A;  1RHP A;  3T53 B;  1X3F A;  1X1J A;  1WVL A;  3L3O C;  4CHT B;  3R2T A;  1J0M A;  2J4X A;  2DGY A;  4A3M B;  1ENC A;  2ZM6 L;  2R61 A;  1VQE A;  2A68 C;  3AQQ A;  4GN3 B;  4JBW A;  4KTA A;  1VQD A;  3M4O B;  3DM3 A;  3HS0 C;  1J9O A;  1SFO H;  2IPK D;  4GKK Q;  1X6O A;  2Z4I A;  1TS5 A;  3X3M A;  3VYT A;  1EY6 A;  1VMP A;  4DNR B;  4A93 H;  2M2L A;  2RCF A;  3P75 A;  4JPB W;  5CR3 A;  3JAM c;  2VS1 A;  4P71 A;  1PMR A;  4DGZ A;  3A8K E;  2AKW B;  1CHP D;  3K58 A;  4DFA A;  1PV4 A;  5IP9 H;  1KDA A;  3RZO H;  1N7R A;  3ER0 A;  2VB2 X;  1DCZ A;  3S1M H;  4RCN A;  1AH9 A;  1M4V A;  3BZD B;  5BN4 A;  4IN3 A;  3AU7 A;  5A2Q L;  1JB7 A;  3S2D B;  2NN6 I;  3FHW A;  2R7Z H;  2EJG C;  1C7Y A;  1STA A;  1OJN A;  2NVY H;  2XRS D;  5I2X A;  5KGU A;  4X62 Q;  4A93 G;  2B39 A;  1JCK B;  3S1Q H;  5CC4 A;  2D5D A;  2AUJ D;  3TBI B;  1C0A A;  4B3M L;  4HMI A;  3CXC A;  2Z0S A;  3ND9 A;  5ELD A;  3W2D A;  5IP9 G;  2OWO A;  5NUC A;  2QF7 A;  2KEN A;  1GUG A;  4JI0 Q;  3RN5 A;  1N32 L;  1HR0 L;  2KA7 A;  2F0U A;  3HOW H;  1GJX A;  2XVS A;  2R7Z G;  4DA2 A;  1RWC A;  5DAU A;  1N7O A;  1UEA B;  5ELF A;  3OTO Q;  2AWN A;  5GAD C;  1TU2 B;  2CH4 A;  1EWC A;  4JBJ A;  2PCF B;  1NJI C;  3U9S A;  5M3M B;  3I72 A;  2R7D A;  4L5R C;  3GD7 A;  2OF1 A;  3OMG A;  2RA4 A;  1CQF A;  1KDB A;  1SR3 A;  4P75 A;  1WOC A;  5C4J H;  4X6A H;  5IGF A;  2WCO A;  3GTG H;  3RLF A;  3WOE A;  1L1O A;  2JA7 H;  1RW9 A;  3HOW G;  1PH5 A;  3DXJ C;  3K81 C;  4DR2 L;  2UUB L;  2A5H A;  3SGI A;  4L6T B;  5T1G A;  1SYC A;  5LMU L;  4DUY L;  1S5B D;  1HXY D;  1FR3 A;  3OHX C;  1SN8 A;  1SEB D;  4KJN A;  4GOP B;  4A3K H;  4RGM A;  5IGD A;  2QW7 A;  2UUA Q;  3NWT A;  1L1O C;  2WKC A;  1WCM H;  5KEE A;  4G57 A;  1PLF A;  3NEN A;  1NSN S;  1JWU D;  4UP8 A;  3S16 H;  3K59 A;  4DV6 L;  3ERQ A;  2JA7 G;  3BS1 A;  3W1G A;  1RWG A;  2IX1 A;  2HIX A;  1U4R A;  2VZA A;  1IL2 A;  3FPP A;  1YHQ A;  4CKC A;  4DR3 Q;  3DEO A;  1E22 A;  4V19 0;  1LAB A;  4BY1 H;  4A3K G;  3DUZ A;  1XX8 A;  4KN4 C;  2XNA C;  1WCM G;  3AFP A;  4XQQ A;  4DR5 Q;  3CCE A;  1ONL A;  1LT6 D;  4GKK L;  4A3G B;  5CV9 A;  1G6P A;  3OWF A;  1NMG A;  5DM6 3;  1N9W A;  1JQY D;  2KUM A;  4ABN A;  2K5H A;  4Z9C B;  2PYK A;  3KLS A;  3CMA A;  2OQK A;  3LNN A;  4U67 3;  2MO0 A;  4A3B B;  4BY1 G;  1ET6 A;  3RZD B;  3MXN A;  4KV6 A;  3UE1 A;  2ICE C;  1K83 B;  3J7A F;  4P74 A;  1DXM A;  3NTI A;  1CB8 A;  1JOQ A;  4X62 L;  5I9O A;  3I73 A;  3KJP A; 
#chains in the Genus database with same CATH homology
 3QR8 A;  2P5Z X;  3PQI A;  3F59 A;  4UHV A;  3UD2 A;  3KBU C;  2KXS A;  4D8O A;  4DLO A;  3KBT C;  2KXR A;  4DLQ A;  4MTK A;  3UD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...