2WMIA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 in complex with the a-trisaccharide blood group antigen.
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
582
structure length
572
Chain Sequence
VDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTENYWIWANDIENKAADYLKVSAKNGGYFIWAEQNNGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 221
structure length 572
sequence length 582
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmiA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmiA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmiA02
1BAGA 3SCWA 3UEQA 1UKOA 1AQMA 1I8QA 1WDPA 3EBVA 2GK1B 1GHRA 4UR9A 3CLWA 4X0VA 1NM9A 4V27A 2G3IA 2YA1A 3K8KA 1CGTA 4AXNA 3CZJA 2HISA 4KMQA 2WCAA 3FN9A 3F5KA 1W1VA 3AS3A 1E71M 2F61A 2PWHA 3BSGA 1HKKA 1RWHA 2J77A 2DSUA 3BAKA 1F4HA 2PB1A 3GXDA 4MAZA 4BQ3A 1V08A 2XGIA 2G8ZA 4P8WA 1J0ZA 1WZMA 4AIOA 1JFXA 1SYTA 1GVIA 1QI4A 2YL6A 3AI0A 4EAMA 3AS2A 5ABFA 1V0NA 2JE8A 3UERA 5M03A 3WENA 3WIJA 1ZJBA 4EE9A 1B3YA 5D4YA 2PBGA 1E72M 3L4TA 3KWXA 2DSKA 4AZCA 4EANA 1LOHA 1J18A 1W9UA 2VZUA 2Y24A 2OWCA 3CGTA 1RPKA 4WF7A 2V5CA 1HKMA 2MANA 4NSBA 1TA3B 1SFSA 1HT6A 1TR1A 1US3A 4PBGA 2WMIA 3APGA 1KXVA 1UQYA 3WH8A 2ZUTA 1HM2A 2E9MA 3NDZA 1RD6A 1UWQA 3VIJA 4B9ZA 3AHXA 2WPGA 1CGYA 4ATLA 1HM3A 2VZSA 2FDMA 3IANA 1OJPA 1OBAA 4MTVA 4HU0A 1NARA 3AICA 4CVWA 7A3HA 4KH2A 2ESCA 4B3LA 3AYSA 3CHFA 3F5LA 1GQKA 3EDDA 2WZHA 2ZUSA 1NOWA 5JBEA 1V6XA 4DUWA 4PTWA 1NWUA 3SUTA 2OLHA 1JDCA 2GFTA 2J75A 1NWSA 4B3KA 3AXHA 3GYCA 2X0YA 3OIHA 1VF8A 1C7SA 1JGIA 3WL0A 3AIBA 4ZXLA 1SMAA 2G3JA 5C71A 1UHVA 2BV9A 4LYPA 4GO8A 2GK1A 2JF6A 1J0JA 2ZX6A 1BVNP 2QMKA 5A6BD 2DSVA 1Q6EA 4PMYA 3AMCA 5BXTA 2OYMA 2XVLA 1UQZA 1JDDA 3VTRA 3BGAA 2GUYA 1HVQA 4PN2A 4UQEA 5A6BA 5FD0A 1OIFA 4PSRA 8A3HA 5ECUA 4Z2GA 5I23A 4E8CA 4E2OA 4GQRA 1R7AA 1PX4A 3ZJ6A 4P7RA 4GZJA 1IT0A 5I77A 3AMLA 4HTYA 4UOQA 2X09A 4B15A 1E0WA 2XJ7A 4P8XA 4UQBA 3ALFA 2WANA 1KR0A 5DF0A 1FFQA 5D8ZA 1V0LA 2W62A 4H8VA 1QNOA 4PMZA 1U33A 4IPLA 4ATWA 5AYIA 1GPFA 4E8DA 1JF5A 1TA3A 1US2A 3TTOA 2XIBA 4UFIA 1W2PA 3ECQA 4WK9A 1EIBA 1KXTA 3IAPA 4A3YA 4TVCA 2VVNA 2WMFA 5FL1A 2UY4A 4PYSA 5CSUA 4JCMA 3L4XA 2YDRA 2DIEA 3KL3A 1J0HA 1PEZA 5E6YA 1I1WA 1MVYA 2D22A 3UR7A 3GNOA 3WEOA 1AMYA 1HL8A 1B90A 2YKKA 2J7DA 5I2UA 4AZBA 2WWDA 1UH4A 3RM9A 3WL1A 1OJMA 1JNDA 1W3YA 1F1SA 1F4AA 1JXKA 3W28A 3MUIA 2W91A 3MMUA 3VNYA 1FH7A 2BHUA 3EMCA 1Q6GA 1QI2A 1X1NA 1QPKA 2WVUA 4OUEA 9CGTA 1HX0A 3VUPA 3AZTA 5A6LA 5FOOA 1CTNA 2OWXA 4UFLA 2WHMA 1V6UA 3TOPA 3LPOA 1KCLA 1QHOA 4W5ZA 1HKIA 4XX6A 2VR4A 3ZM8A 5KEZA 4D6GA 1W1PA 3UCQA 2V3EA 4CUCA 3TONA 3PZ9A 4KRUA 4ZEPA 4C7DA 1WDRA 4PUEA 4MADA 2FHBA 3DC0A 4FLRA 1UKTA 5LYRA 1GW1A 1ZL1A 2XFYA 2WK2A 1BQCA 4PMDA 2X8RA 2DT0A 2UWFA 5HDRA 3DHPA 1EHAA 1X1IA 1W1TA 3WH9A 2XFRA 3N15A 1PJ9A 1JD7A 4URIA 3VMOA 4CN4A 3VU2A 1KBBA 2J7FA 2JEQA 2J7BA 3RM4A 3WD0A 1KB3A 1EOKA 1HJSA 1ESWA 4NRRA 1KXHA 1VB9A 5HOSA 3TP4A 5BRPA 4M82A 2WKGA 1E40A 3VGDA 2Q1FA 2D0GA 4OBSA 4BZYA 5HXMA 3ARYA 4D6DA 1UG6A 5DT7A 3VD3A 1J0KA 1LF1A 1JZ7A 3BCFA 4DUVA 4Z2HA 2XWDA 4D6JA 3WD2A 5IFPA 2CNCA 4Z2JA 5IFTA 5CPQA 5CGTA 1WE5A 3MMWA 2OSWA 3VIPA 2XM1A 1P6WA 5D9NA 3UG4A 4KGLA 3CBWA 1XD0A 2DGAA 2WSKA 4AMCA 5FL0A 1LXKA 5BXRA 3WEZA 1ZBKA 4W8AA 4CKQA 4U2YA 1GORA 4IUGA 1ZB5A 4WKFA 1DWAM 1QW8A 3TTSA 3QHNA 4IM4A 3RM8A 4FK9A 3WUFA 4GIAA 3IJ7A 2Y2WA 4HA4A 5IDIA 4B16A 2QPSA 4JKLA 1E6ZA 1E43A 4QFUA 4D6CA 3T2OA 1EO7A 4M56A 2D0FA 3FY1A 1R8LA 3ZMRA 1HN1A 3WKZA 4DUXA 2D20A 3G6MA 5DFAA 2CBVA 3HU7A 1ZBWA 1JAKA 4JFTA 1JIBA 3RCNA 2PWGA 1MFVA 4F9DA 2VX4A 1VBRA 3CMJA 1UZ1A 2GSJA 4GO9A 4DWSC 1LG1A 4J3UA 3KE0A 1UKPA 1S46A 4H2CA 3ARXA 1GHSA 4BQ2A 3SCRA 1JZ3A 1CGXA 2VI0A 1JF6A 2BRPA 1WZKA 3OBAA 3VD9A 4MPKA 2TAAA 2A3CA 2E3ZA 1IZJA 3RPMA 4Z2KA 2VT0A 3CHDA 4XZWA 2WWCA 2WB5A 1BF2A 2FH6A 3ZJ7A 2IUZA 1V03A 1MXGA 2YOCA 2DH2A 1FP9A 1PPIA 3UETA 4BS0A 1UD6A 4M80A 1MW1A 1W9XA 4OJYA 1JYNA 3A4AA 4GI6A 3CPUA 3EDEA 1FHLA 1LJYA 1E15A 3M07A 3VIGA 3MSGA 3VPLA 3VKKA 1ISXA 2A3EA 4QP0A 3GH7A 3F5JA 2BXYA 4UQ9A 3SCPA 4QLLA 2W4XA 3FW6A 3A3HA 2EJ1A 2J7GA 3OGVA 4UFHA 1W3HA 1EDQA 1V0MA 4LQ1A 4JHOA 5ABEA 2Z1SA 3O2LA 4HP5A 1KQZA 5KZ6A 3EDFA 1BGAA 1GUVA 1G94A 1OGGA 4QLJA 1KGWA 1E4MM 5I5RA 3EMZA 4GQQA 5CSYA 1CXEA 3BAJA 2FGLA 4HOXA 3FAXA 1UOKA 1JD9A 1UR2A 5D8WA 3WMBA 4CU8A 3VINA 5D9PA 3AIRA 4Q22A 2J78A 5D9OA 2YA0A 4AIEA 1UWUA 4TXEA 1BGGA 3RDKA 3M6DA 3ZJKA 2CHOA 1C8QA 4D6IA 2NW0A 3WDJA 1AQ0A 1HL9A 3NJ3A 1W1YA 1OWQA 1VJSA 3KZSA 3N13A 3ZIZA 1IZKA 1VFMA 4J3SA 1GNXA 1M01A 3VGFA 3AHVA 1R7OA 5GQBA 1VFFA 1XGZA 3AOFA 2D24A 3ZSSA 3OB8A 1TMQA 4J3XA 2ZWYA 1HJWA 4F66A 2BVDA 5A2BA 3GH5A 2ZUVA 3VX0A 2VJXA 4P8VA 3UG3A 5BYWA 1LL7A 3GDBA 3QR3A 1TVPA 1K9TA 1CB8A 4FMVA 4CD7A 1K9EA 3W25A 2JALA 3AIUA 2IXUA 5I24A 1C90A 4Q7NA 4MNJA 3ARWA 2J62A 1VAHA 4MDPA 1CGUA 3G6LA 1ITCA 3TA9A 1B3ZA 3DECA 5CPTA 4J3TA 1DP0A 1UR8A 3WDQA 3BAWA 5ABHA 1UD3A 3WD1A 4EKJA 1CDGA 3AHZA 4P7QA 1V6YA 1AVAA 4UCFA 4D1JA 1B3XA 3U7VA 5F7UA 3AMDA 3L4UA 3U5YA 1H4PA 2WCGA 4N0RA 4U31A 1XSKA 1EA9C 3AISA 2ZXQA 2YL9A 4ZE4A 3AIQA 4ZENA 5E9AA 4KWUA 1U30A 2CETA 3CUHA 3EDKA 1NP0A 1KR1A 3WDHA 4UFMA 1X1HA 2YLLA 3MUZ1 4GXPA 5IHSA 5IXEA 1HF6A 4HMDA 3MV11 2PC8A 4J3WA 1UD8A 5CZKA 1W3LA 4MJ4A 4WIWA 1OD0A 1FFRA 4UFKA 2WDAA 4H7VA 1M53A 3IK2A 4BQ4A 3J7HA 1I75A 1H0GA 1N7PA 3WMSA 1HMWA 1CIUA 2WZIA 1GVYA 3QOKA 1BYAA 1NOFA 1HVXA 1GQLA 2EPMX 5CLTA 4D6EA 2XTKA 4W85A 1JG9A 2E9LA 1B9ZA 2ZXAA 1J12A 1UA3A 4L4OA 3ARZA 1GCYA 1H09A 1H2JA 4PSPA 7CGTA 1BHGA 1ODZA 1E6SM 4HPHA 1E9LA 4CGTA 2EBNA 4JL2A 4BQ5A 3W37A 1A3HA 2ZXBA 4Y7EA 2EPKX 4HU8A 2BVYA 3RILA 1FHDA 4NF7A 1GOMA 4TUFA 5E6ZA 5CJ5A 1CXKA 2ZWZA 1W3JA 3U57A 4CD5A 4WSJA 3OZPA 1XH0A 4L4PA 2ZXDA 1N7OA 3AYRA 2D2OA 4PRWA 4UQDA 4PMVA 2BNJA 3ZT5A 2WKLA 3NSXA 1RWAA 3L4WA 1I1XA 1H0IA 1PBGA 4D1IA 1O6IA 4P7NA 2XG9A 3BMVA 3KL5A 1E4NA 2JF7A 1VRXA 4HA1A 1CXFA 4U5KA 2BVTA 3SCTA 1UKSA 4ZFMA 3ZOAA 4UZUA 1EGZA 2X2YA 4AWEA 5DMYA 4TTUA 2CITA 4W84A 2XFFA 1CXHA 3EYPA 3QHOA 2XVPA 3BH4A 2E22A 3QGVA 4U3AA 1G0CA 1OM0A 3VMNA 2EQDA 5BXPA 1WB0A 3WBAA 1TUXA 2FH8A 3QHMA 1V6VA 2D1ZA 2D3NA 1OJOA 1TE1A 3WNKA 4CU7A 3OLDA 1LQ0A 2CXGA 5I78A 5GPRA 1E6QM 2CBJA 3PN8A 1J9YA 4JFWA 3IAQA 2UY2A 1BG4A 1LL4A 1RWFA 3BAIA 2WMGA 4AD4A 1MQPA 5JIPA 2E9BA 3KL0A 5DT5A 3CHCA 3RJYA 3W6LA 5A8QA 2CPUA 1Z32X 3VD5A 1G01A 4WJXA 1VFUA 4OKDA 1QBAA 1MW2A 3CUIA 3CZEA 3VOCA 4MAVA 4IPNB 2WM0A 1OINA 3ZT6A 2X1IA 4AD1A 1PX8A 1E1FA 1E4LA 1W9BM 3WUBA 2VQTA 4AY1A 2QMJA 3MU7A 2V3DA 2CKSA 2XSBA 4P8UA 1JZ4A 3NUKA 1UD4A 1C91A 1YHTA 3LPGA 5A6SA 3B9AA 5I79A 1X6LA 2DT2A 4AEEA 4XUYA 5M5DA 3T2PA 1E70M 2VZTA 1CEOA 3T0AA 3ARRA 5CXPA 2EO7A 1EHNA 4ZE5A 3VMPA 1E3XA 2EPLX 5A6KA 4B9YA 4MDOA 4MB1A 2VOTA 3THCA 1C8XA 1ZU8A 4J3VA 1HIZA 4W5UA 3W53A 4OIFA 2JIWA 1E55A 3NSMA 2Q8XA 4M24A 4M81A 3WH6A 1WDSA 4PUDA 1QNRA 5M3WA 2DT3A 2V38A 3WNNA 3RJXA 4GZIA 2HVMA 1DEDA 3VIFA 3OA5A 1MYRA 4LGXA 1VIWA 2WBGA 1YQ2A 4PMUA 1GJWA 4QLKA 4UTFA 4J28A 5AC4A 4C7FA 3AQUA 1H49A 1Q6FA 2W66A 3ZR6A 1CGVA 1JL8A 1H11A 4W8LA 1KFWA 4PMOA 3PZNA 3I3BA 2A3AA 3THDA 1PZ2A 2CBIA 1N82A 1WDQA 2OSYA 1VEMA 2XVNA 3GXIA 4U33A 5BXSA 3WSUA 3W4RA 4YPJA 1CXLA 3D3AA 1LG2A 4A4AA 2XVGA 1RP9A 3BCDA 4JIEA 5BWFA 4W7UA 3WNOA 3AS1A 4UNIA 3DYMA 1M7XA 4LYRA 5C8BB 2CHNA 4D6HA 5CGMA 3SCSA 3U5UA 3TTYA 2EPNA 5EB8A 2VRJA 1V3KA 1JI2A 3SUSA 3ZR5A 1KXQA 4CD6A 2YJQA 1B1YA 1C92A 1CECA 1W9VA 1M04A 4AIUA 4F79A 1UR0A 2AOSA 1CYGA 1W3KA 5E0CA 2VTFA 1X1JA 3N9KA 1MXDA 4UQAA 5HPCA 3PZTA 2VZOA 4RE2A 2DEPA 2WSPA 4JKKA 3PTQA 3AS0A 4M29A 3WNLA 4R5EA 2DSZA 1QOXA 3PZMA 1XH1A 4QDMA 5DO8A 3LPPA 2XUCA 4GZEA 3BC9A 4CN1A 1LWJA 2YA2A 3T2QA 3WF4A 3ZO9A 3WDPP 3L2MA 3OG2A 1SR0A 1WZAA 3N18A 3AIVA 1MW0A 2XIIA 1J11A 5I0DA 4BA0A 3U7BA 1WP6A 1R86A 4XV0A 2CBUA 4M8UA 3WFZA 3WQVA 3HMCA 2GVYA 1D2KA 4J7RA 4W93A 1DWIM 2VRQA 3GBDA 2W5FA 5FIPA 2QV4A 4U3CA 1VJZA 3MKKA 3NYDA 2F2HA 1C7TA 1FH9A 1V0KA 4H41A 1DTUA 4AEFA 3ZSTA 2VX6A 1GONA 1ISWA 1HJVA 2ZX8A 1FP8A 1QI3A 5AYBA 3A47A 2EXOA 4AD3A 2IXVA 2JEPA 3VIKA 2BRVX 1UH2A 3OGRA 1XCXA 2DDXA 4P7LA 1ISZA 1GOKA 4AZ5A 3BLPX 3AZSA 6CGTA 2BY2A 2XYLA 2RGLA 3AJ7A 4JFSA 3SURA 4AISA 4D72A 4Z2IA 4OBRA 4PCSA 3VIMA 4NI3A 3WUGA 3PZGA 5HBFA 3WN6A 2BY0A 2O92A 5A6MA 2VRKA 3CUJA 3OGSA 5E09A 1FA2A 2FHFA 3DHUA 3O6AA 1N7NA 1C93A 3ZJ8A 5A94A 1PAMA 4HMEA 5FCZA 1JYVA 3W29A 3K8LA 1J01A 3W26A 2A3BA 3MUAA 1XCWA 1N7RA 2E40A 2XHYA 4IISA 4UOZA 4JKMA 4PCTA 1JDAA 3VNZA 2AMGA 3HN3A 2VUYA 3WF2A 4DM2A 5GNXA 1O7AA 2D3LA 1UR4A 2EPOA 1EXPA 3D5HA 2E8YA 5A1AA 4OOUA 3VX1A 2WVTA 2XWEA 4AZGA 2PF0A 3MMDA 5AY7A 3T08A 5LA1A 4PMRA 4ACZB 4QAWA 4ATDA 2D23A 3PBGA 1KWKA 3MANA 2BHZA 2GDVA 2J4GA 1HP4A 4DWSB 4CD4A 2NT1A 1NWRA 4JFUA 3CO4A 5E70A 3T09A 1J0YA 4M1RA 3K4AA 1Q6DA 2VL4A 3WY1A 1GZJA 2Y4SA 8CGTA 4TVDA 2VX5A 2GJXB 2J7CA 4HZ7A 1PX3A 1W9PA 2EEXA 4HZ6A 1R87A 1NP2A 3UESA 1JZ6A 3OLEA 2DT1A 4WSKA 1GOWA 4S3JA 1MQRA 1UD2A 3SCVA 1BFNA 3BSHA 2ZICA 3FHAA 3WF3A 1GJUA 3MS8A 4RE4A 2VCCA 1UWRA 1B0IA 1EDTA 3EDJA 3FXYA 3AHYA 3SCUA 2C8NA 2VURA 3UG5A 1UKQA 3S6TA 1U2YA 2J47A 2OYKA 5A69A 5IHRA 1NOUA 2J8GA 4YHGA 3HJEA 3L4YA 2XVKA 4YN5A 2WBKA 2VMFA 1HJUA 1E3ZA 1EDGA 3VGEA 4D71A 1BPLB 1E0XA 4PEEA 5EFFA 2FHCA 4NZCA 4EK7A 1CWYA 3N17A 1WCGA 1AQHA 2YBTA 1V02A 2ZX7A 4S3KA 1XSJA 4JAWA 3VDCA 1V3JA 3N11A 1UZ4A 2C7FA 1G5AA 3WD3A 1JZ2A 2WMJA 1JI1A 4F9JA 1WZLA 2YIHA 3N04A 4AZHA 2G4FA 4XZBA 1HKJA 1KWGA 1KGXA 2W67A 2WXDM 1Q4NX 3N1AA 4MB3A 1E5JA 1QNPA 3IJ8A 3WUEA 1WKYA 2C0HA 2OSXA 2O9TA 5A8NA 5TD4A 3PZOA 1JZ8A 4WLCA 5BROA 4QCEA 5LA2A 4DWSD 1OIMA 5HPOA 2WHJA 3MO4A 1B30A 4DM1A 4PTXA 3K8MA 4PMNA 5JIWA 1TG7A 2CYGA 4ACZA 4FF5A 1HP5A 1QI0A 2QF8A 4HOWA 3M46A 2XGBA 3SCQA 1DWHM 1SMDA 1JYXA 3ZT7A 3CZ8A 3PZQA 4DWSA 3WH5A 2X03A 4AC1X 1B3WA 1CNVA 5I3DA 1X6NA 1XHGA 5EFDA 4MNLA 1V3LA 3LPFA 5CG0A 1E6NA 2GJXA 1CLXA 3BLKA 4ZXOA 1J0MA 5BRQA 1GOIA 4P7OA 2VCBA 2WMHA 4KGJA 2D0HA 2G3MA 1WO2A 3FAWA 5I6SA 4WKHA 4MJ2A 4UQCA 4AYSA 2PWFA 3DYOA 2J74A 1KQYA 1H1NA 3B9EA 2WHLA 5JBFA 3I3DA 3A4XA 1BYBA 1G1YA 2JFEX 3F4VA 1VEPA 2ZE0A 2J7EA 1KBKA 1ZS2A 3GNRA 4HMCA 4W86A 3POHA 1L8NA 1K9DA 2CCRA 3WQWA 3SUUA 5A8MA 2ZUWA 3MUY1 4N42A 3AFBA 3GXFA 1E5NA 2F8QA 2J7HA 5A2AA 4JFVA 1LWHA 2BRWA 2BXZA 4CCEA 3T0DA 1K6AA 4BCEA 1UA7A 1UUQA 3BMWA 2OYLA 1ECEA 4CD8A 3ALGA 4UOJA 3SCNA 3UR8A 1UWIA 1VEOA 2WVVB 3WDIA 2VNCA 2YDSA 1BSIA 2E0PA 4E4PA 4W88A 1EH9A 3CIVA 2JIEA 3VDAA 1CXIA 1DHKA 2ZUNA 1XYZA 1EGUA 1UR1A 2W63A 1JZ5A 3WNMA 1E73M 3WMCA 3SEPA 4GPNA 3OLGA 2WZEA 3L2LA 3WQ8A 1GQIA 2NSXA 4TX8A 3NSNA 2YBUA 3N12A 3CH9A 4XB3A 4QCFA 1W91A 2WLZA 3LMYA 1J0NA 2W92A 1CLVA 1MFUA 3POCA 3WNPA 2Y8VA 3W81A 4AW7A 1CENA 3K4DA 3GM8A 3GZAA 2OWWA 1JFHA 3VIOA 1D7FA 1OSEA 2XSAA 1CPUA 1BTCA 1RH9A 3VGHA 3ARSA 4W87A 2BS9A 2QHAA 1UR9A 4RL3A 3CUFA 2B31A 1V6WA 3M7SA 3VILA 5BCAA 3WF1A 1MQQA 3L4VA 2ZIDA 4OZOA 2VCAA 1MWOA 3O9NA 2UY5A 4U5IA 4H04A 4U2ZA 2BY3A 1JYWA 1OT2A 2CESA 5CPSA 4K68A 2E4TA 1E4IA 1W9DM 4TX6A 3MV01 1HXJA 1EQPA 2DSWA 2ZUUA 4JZ5A 1LXMA 1QHPA 3VGBA 2PI6A 1TZ7A 4C7GA 2V3GA 1QBBA 1OJNA 1UH3A 1EO5A 3CMGA 1L0PA 1OT1A 3CZGA 1NQ6A 1NWTA 3VM5A 4ACYA 2WCSA 2CEQA 1J0IA 3JUGA 2ZUMA 3L4ZA 3VIIA 2WW5A 1WPCA 2O9RA 4X0NA 2DPEA 2ZX5A 3FHQA 4A3HA 2V3FA 4GKLA 1TVNA 1V3HA 4AZIA 4ML4A 3AROA 2WC3A 2VZVA 3AXIA 1E0VA 5HNNA 1ITXA 3VO0A 3AMGA 1Y7VA 2YL5A 4CCCA 1RWCA 3VVGA 3S2CA 4HOZA 3PZUA 1JXJA 4J27A 2WYSA 2YL8A 2YLAA 1E6PA 4FLOA 2X0HA 1BVZA 2VO5A 3K46A 1E6RA 1JNEA 1OD8A 1R85A 2WVVA 3II1A 4TVUA 3VGGA 3ZQ9A 1QI5A 1V3MA 4HA3A 4OOZA 3WELA 5A8PA 4AZ7A 3GTNA 1V3IA 1ISVA 3CTTA 3WQ4A 2WHKA 2DQXA 1RWGA 1GOOA 3GNPA 3K1DA 1WAWA 3NCOA 6A3HA 3PHAA 3VDBA 1VFOA 4MNMA 2RGMA 3SUWA 2AAAA 3ARTA 1ZBVA 1Q6CA 4AD5A 4FLQA 2QPUA 3BXWA 4MB4A 5A95A 2E8ZA 5EBAA 1HJXA 1DWJM 3VIHA 3GH4A 1XD1A 3T0BA 3WEMA 3E1F1 4V28A 4JHZA 2O9PA 5EMYA 1M03A 3CZLA 5A3HA 3W38A 1ODUA 4AD0A 1PZ3A 1UD5A 2ZX9A 3RMEA 4W89A 1KCKA 2FGZA 1C3FA 1ZBCA 3TTQA 3ARPA 3OZOA 5ABGA 1WNOA 4PTMA 1E6XM 6TAAA 1HNYA 2WC7A 3AIWA 5FKYA 2J25A 5CQ1A 2WC4A 4W8BA 3I3EA 1CZ1A 1E56A 4CCDA 4YHEA 4FLSA 1OB0A 1DWFM 4MB5A 3KEHA 1LLOA 1C8YA 4KRTA 1N7QA 2CERA 3W27A 1PIFA 2WVSA 3B9DA 5A6JA 1GQJA 2PWEA 5E0FA 1NH6A 1XC6A 3AZRA 2Y5EA 3GXMA 1IV8A 4TTGA 1EOMA 3BAXA 4UFJA 3QOMA 2E24A 2QLYA 1E1EA 3CZKA 3PZVA 3AMKA 1QHZA 1JAEA 3VD4A 3RO8A 4PTVA 1CGWA 1BYDA 4X9YA 1XSIA 2DH3A 4H8HA 4NRSA 1XV8A 4W7WA 1LL6A 1OGSA 1B31A 5JBDA 4HZ8A 1PIGA 3W0KA 3B8SA 4R27A 4PMQA 4Z2LA 2PWDA 2ZOXA 4PMXA 3CHEA 1GOQA 1OGBA 4CN6A 2DIJA 2CIPA 3WQ6A 1BYCA 2XM2A 1VBUA 3MSDA 2J8FA 3PTKA 3WH7A 3WQ5A 1VENA 1FH8A 1QNQA 2W61A 5DEZA 2UY3A 3W6MA 3ARVA 4LPCA 3GBEA 2GJRA 4W7VA 3CUGA 3VM7A 2VR5A 1UYQA 1RP8A 3IJ9A 3VD7A 1RW9A 1W2VA 2A3HA 1H41A 1XH2A 2Z1KA 3ARUA 3NDYA 1QW9A 1V02E 3BAYA 3AXXA 3WF0A 1C82A 1HJQA 1QVBA 4JCLA 2WCOA 5A2CA 3A6OA 1D3CA 3SUVA 2GJPA 1W32A 1TFVA 2VC9A 1G9HA 5GNYA 1OCQA 3W24A 3WDRA 1XRVA 4F8XA 3DYPA 1HN0A 5M17A 3AIEA 2Y8KA 1B3VA 1FOBA 3FNDA 5C70A 4V2XA 1K9FA 1EQCA 2VQUA 5ABFB 2XPKA 3W82A 4TOQA 4AD2A 3RIKA 1H5VA 3ARQA 3PTMA 4AZCB 3A4WA 1QNSA 3WFLA 1ISYA 1XYFA 4JL1A 1DWGM 1BG9A 2BFGA 4GI9A 2BY1A 1H3GA 4H8UA 4MNKA 1UWSA 3WD4A 3VDHA 1ZJAA 4BF7A 5AC5A 1HMUA 2X05A 4LX4A 1KGUA 4RE3A 5D9MA 7TAAA 2WMIB 3EMQA 2CKRA 5A6AA 2PBOA 3WBEA 3AHTA 2GDUA 3SCOA 4CVUA 4GI8A 3SIMA 4WKAA 2G3NA 5LA0A 1A47A 2BHYA 2VX7A 4D6FA 1TCMA 4GINA 1CBGA 1J10A 2O9OA 4CU6A 2WNWA 2WAGA 5CLWA 5GNZA 4HPGA 1UWTA 1F9GA 4UZSA 2J79A 3NIYA 2VVSA 2YDQA 2G41A 2WMKA 1BLIA 3PZIA 4LYQA 1B2YA 2V5DA 5A8OA 1MW3A 3OLIA 5JUVA 2NT0A 4LXFA 2WLYA 4AZ6A
chains in the Genus database with same CATH superfamily
1BAGA 3G1SA 2AGKA 3NAVA 2QCNA 2DW7A 3IJDA 2BVWA 2G97A 1GEQA 1QU4A 1FCVA 1A5UA 1TPEA 4UR9A 4X0VA 2YA1A 1CGTA 3LQGA 2HISA 1DXFA 4PUUA 1JCJA 4GX8A 3FN9A 3F5KA 4DIAA 1EGMA 1A5KC 4U4MA 3AS3A 3G5EA 2F61A 1HKKA 4NZ4A 3STEA 2J77A 4GHRA 2XGIA 4P8WA 1WZMA 1PTDA 4UTTC 4AVNA 4GXMA 1JFXA 1B5TA 2WPBA 4I7VA 5ABFA 3SQSA 3D3FA 1XIIA 3LM7A 3FA5A 1B3YA 1E72M 1ZLPA 2W27A 3R43A 3W9ZA 3S2NA 1W9UA 1OFBA 2Y24A 2OWCA 4NXSA 3CGTA 4WF7A 2V5CA 6ENLA 2O7SA 3N4FA 1NFGA 3LK6A 4NSBA 4HYRA 1TR1A 3NGJA 1SW7A 1MXSA 3HG4A 1EKOA 1I6NA 3PJWA 3NQMA 3V36A 4NUWA 4S1FA 3LCXA 1F76A 2GDQA 3GHUA 3LHYA 4B9ZA 1R9YA 1HM3A 4LAUA 1KCZA 5D04C 4BEUA 1KM4A 1XG3A 1AD4A 3M7WA 4U28A 4FB7A 4KKXA 1TWIA 1TX0A 3GSMA 1GQKA 4GQGA 1P0EA 3B97A 2DZSA 5D32A 5JBEA 4NZ5A 4QE1A 4DUWA 4PTWA 3SUTA 3MKCA 1JDCA 2PLKA 3KM8A 1DV7A 3LHUA 3RR1A 1QK2A 3GYCA 4WXYA 3WLTA 1VF8A 1JGIA 4ZXLA 1SMAA 3LHWA 5C71A 1UHVA 4LYPA 1J0JA 2ZX6A 3LUTA 4CQ8A 1GT8A 2FYMA 4Q4PA 1XLHA 1L6YA 3S4TA 5D02A 6REQA 3MBDA 1A5MC 4WOZA 3PG8A 3CO8A 1J93A 3R8RA 4JTGA 3KCOA 2VDGA 1UQZA 3O1NA 3VTRA 4ERAA 3D47A 1X8FA 3UVIA 1HVQA 2CLIA 4PN2A 4B5NA 3OTRA 3GUGA 5A6BA 4PSRA 3QZ6A 2HE8A 1MZRA 4Z2GA 4E8CA 1YADA 4WSHA 3HA1A 2OKTA 1FKXA 3ZJ6A 5F4WA 2Q01A 1W1ZA 2DVTA 2QAFA 3AMLA 3O6CA 1U1JA 4MIMA 4YTTA 4XK2A 3H2MA 2YXXA 1E0WA 4P8XA 2P8CA 3FYOA 1ONRA 1F05A 1X96A 3R8GA 5KITA 4OT7A 1SGJA 5FSDC 4H8VA 5T9CE 1QNOA 3A3WA 1H50A 4IPLA 4F2UA 4ATWA 3GG8A 3LCLA 3PWIA 3ECQA 4FPSA 1JPKA 1EIBA 1KXTA 4TVCA 2Q3OA 2VVNA 1I9CB 5FL1A 2ZE3A 2UY4A 4PYSA 4ZOEA 1FVPA 3L4XA 4HPXA 1PEZA 5E6YA 3GNOA 3G8EA 1LRQA 3GR8A 1AMYA 2PDHA 3CT7A 2RUSA 3LLFA 5I2UA 3CL6A 3WL1A 1IQ8A 4HA0A 1JXKA 2D73A 3VNYA 3EMCA 3R11A 3H24A 9CGTA 5DCEA 2PDBA 3AZTA 2OWXA 4TO8A 3W1AA 4DX3A 1UWAA 4ZZ9A 1HKIA 2VR4A 3ZM8A 2P53A 3MVIA 2V3EA 3M0VA 3ITTA 4DBWA 5HMEA 1WDRA 4PUEA 4TQTA 1WBHA 4MADA 3M0LA 3DC0A 5AHMA 1GW1A 1S2TA 2WK2A 1BQCA 4PMDA 4I7WA 4JTHA 4GYKA 1EHAA 4FNQA 1X1IA 4FSAA 1TV2A 2XFRA 1SZRA 3VMOA 2CZDA 1TIWA 1KBBA 2J7FA 2PP3A 2Z27A 1KB3A 1I45A 3M0JA 2VFDA 1HJSA 5CPNA 3N14A 2D0GA 4R85A 3S6OA 3DFSA 3VD3A 1JRBA 2QXWA 3MCNA 5D2TA 1LF1A 4JOMA 3BCFA 4Z2HA 2XWDA 4D6JA 2DUAA 3BQ6A 4Z2JA 4WZHA 1O60A 3PUEA 1QO5A 3SRKA 4IIEA 3LLXA 4RDZA 2HPIA 2OSWA 3VIPA 5HMFA 2ICSA 4B4FA 3L5MA 4L5ZA 4NJGA 1XD0A 1KFEA 3K5XA 3OHMB 2B0MA 3WEZA 1Q45A 4U2YA 4IUGA 1OC7A 4B5TA 1ZB5A 3P74A 1DWAM 3TTSA 2BZNA 3RM8A 1XS2A 3MVTA 3M5ZA 5HJYA 1RV8A 2QPSA 1Y5XA 2BP1A 5LNSA 4D6CA 1Z9AA 4M56A 3M5VA 3QH2A 4U10A 3DUGA 1HN1A 3WKZA 1G6CA 3DESA 2D20A 2DZXA 2PP1A 5DFAA 4DUXA 2ZYFA 2CBVA 1QT1A 3S5OA 3BOXA 4KEUA 4PC8A 4LBRA 3LCWA 3UZZA 4ZMGA 3CMJA 2EG7A 3NQ7A 2P3ZA 1GHSA 3EPNA 4BQ2A 3UR5A 2HK0A 1JF6A 4NYUA 3DENA 1TTPA 3OVQA 3SRFA 4MPKA 2A3CA 1IZJA 3JR2A 4GY7A 2PDKA 4Q8OA 3BG9A 2FZ8A 4JHMA 2C14A 2ASHA 2FH6A 4XVEA 1O1HA 5BW6A 3MP3A 3QBUA 2GYIA 1F74A 1OF6A 3R89A 4M80A 1MW1A 2G0WA 3LENA 4OJYA 2OEMA 5HMDA 4NNAA 3A4AA 1RA0A 2QVNA 4GI6A 3EKGA 4UCGA 4DLMA 3VIGA 1YBQB 1ISXA 4B3ZA 4AVFA 3F5JA 4UQ9A 4QLLA 3A3HA 4UFHA 4XKYB 2P8BA 1BEUA 1TPUA 3HM7A 6XIAA 3HQOA 4RCXA 1YKWA 4IHCA 5ABEA 3QKZA 5J8LA 3UZYA 1GUVA 1OGGA 4QLJA 4XZMX 4Y9NA 1XIHA 2W3ZA 5D8WA 1JD9A 1UR2A 4Q8UA 1UIPA 4TIMA 4BWLA 2CWXA 3VZXA 1GG1A 1P6BA 2J78A 3DZ1A 5D9OA 1VPYA 2YA0A 4WQ6A 3DG6A 1BGGA 3RDKA 3T07A 4ML9A 1C8QA 2NW0A 1T0OA 1KLZA 4ICNA 3NJ3A 1TPH1 3LHVA 1VFMA 3NM1A 4JTSA 3VGFA 2VGIA 2FB3A 1TMHA 4BK9A 1VFFA 3TE9A 3KUMA 3SIZA 1IWBA 3OB8A 2GJNA 1UB3A 3FJLA 1GK8A 4NIRA 2Q8LA 4GC3A 4XTDA 2QZRA 4H9YA 4XWUA 1ALDA 5H2ZA 3UWWA 4Y9OA 5MHBA 3VX0A 2VJXA 2VEKA 5BYWA 1IXOA 4O52A 1XDJA 3CUZA 4LFYA 4FMVA 3HFTA 5BOEA 3BOFA 3M0MA 2ZA3A 5JH2A 1WUFA 4CNTA 1C90A 3W7RA 3KBNA 1RCQA 3ARWA 1UZHA 3TJLA 1FCBA 4MDPA 4D8LA 1CGUA 2Y70A 3WBYA 1S2UA 3DECA 5CPTA 4V1XA 3GD6A 3WLHA 3MO7A 3EWDA 4F0KA 3G1HA 3TW9A 1EWEA 1SO5A 3A9BA 4EXQA 3O06A 2VM8A 4HN8A 2B7PA 4P7QA 3AHZA 4UCFA 4PUMA 2BOFX 3U5YA 4DXKA 3M0KA 3MYOA 1RY8A 1SJAA 3KBJA 4EF8A 1W3NA 4ZENA 4UWMA 4KWUA 4YTSA 2VWTA 3R0KA 3MUZ1 4X60A 4EACA 5CKSA 3DBNA 4HMDA 4QDWA 2V0TA 3R6IA 3QRHA 1N7KA 1GWJA 3C6CA 2PTZA 3E9AA 1OD0A 1FFRA 1G67A 2PCQA 2WDAA 3C0SA 4O17A 1M53A 1UPMB 3QTGA 5LNUA 1I75A 1K7EA 3V3WA 1UMYA 3H54A 2HNEA 3V0UA 2BOGX 3LNPA 5HK4A 1GVYA 4PE8A 3PK7A 4N9BA 1QAPA 1HVXA 1KTBA 2EPMX 4D6EA 1G4SA 1IGSA 2FKPA 2QVHA 4NAFA 5DMNA 4L4OA 2CC0A 3ARZA 1GCYA 3DFOA 1ZP3A 3T81A 7CGTA 3N2XA 3B0YA 4PGLA 3T4CA 3Q2DA 4JBRA 4BQ5A 3HPSA 1Q8JA 1A3HA 9RUBA 1EFZA 3RNDA 2ZXBA 3RUBL 2BVYA 5EMMA 1KKOA 1O1ZA 4DF0A 2WQDA 3R0DA 4DF2A 4TUFA 4E2BA 4CD5A 2NXIA 3W07A 3OZPA 1AL7A 1UPPA 3M0XA 1XH0A 2ZXDA 6TIMA 3QZAA 1TREA 2WKLA 3UCCA 3N34A 3WQDA 1I1XA 1H0IA 3R12A 3VABA 4XD5A 1LLWA 1CXFA 2H6RA 3ZOAA 4MOZA 2X2YA 5CEWA 2CITA 1FY6A 4W84A 2XFFA 3NPWA 5DBUA 3QHOA 2ZC1A 2E5BA 4HNCA 4U3AA 3DFHA 1IXQA 1OM0A 4AIBA 4WR3A 2BLEA 3WBAA 1TUXA 3SI9A 1A49A 4ZB2A 2ZZ1A 3GFZA 2D3NA 1TE1A 4ZQCA 5GVJA 3TJXA 3IRDA 2GWNA 3ELFA 4CU7A 3TU9A 4GY0A 4YMZA 4IZGA 1E6QM 2QEZA 2Y5SA 4DJEA 3IAQA 1UP3A 4C1KA 5F4SA 3E0LA 3C86A 3CAVA 3BAIA 1E51A 3GU9A 3TDFA 1POKA 3CH0A 2E9BA 1KFCA 5EMKA 5C2GA 5KZDA 3RJYA 3W6LA 4GUGA 3CUIA 3CZEA 3PJXA 1FWEC 3EX2A 3ZYZA 3ZT6A 2Y7DA 1PX8A 1KRBC 3VDGA 1E4LA 2XISA 3H70A 3CYVA 1L6WA 3WUBA 3NZGA 3SSZA 5REQA 3FS2A 5CBBA 3GTIA 4K8GA 3N2TA 4EVZA 2CKSA 4JTRA 4KFOA 3LPGA 2E6YA 4NG3A 4K6AA 3UFYA 4L64A 5M5DA 5B7ZA 2DU2A 1YW1A 1CEOA 3T0AA 3USZA 2PTYA 2EO7A 1FBAA 2JK2A 3QMTA 5FACA 1E3XA 5C9ZA 1EB3A 4MDOA 4GUHA 3W1RA 4PULA 4HU3A 1WAUA 4IGSA 2FDSA 4MZ1A 4L4LA 4FP1A 4W5UA 4OIFA 2V63A 4MVAA 4RXFA 1YDYA 3BLOA 4M81A 1BXCA 1WDSA 4H2HA 2A21A 3O05A 4PUDA 5FAJA 4NQ1A 1PKYA 2V38A 3QQ1A 2YB1A 1TELA 3NZRA 4K36A 3IS4A 1VIWA 1YQ2A 3CK5A 1T40A 4HSHA 4WJEA 4C7FA 2W79A 4DAFA 3N25A 5B80A 3MCMA 3L65A 4NZJA 5HR6A 3I3BA 5BMXA 1DOSA 2XVNA 2IPJA 1UJQA 4N9EA 3WSUA 4IOTA 3TWAA 4QSFA 4YPJA 1TX2A 1TIMA 1M9HA 5BWFA 2NX3A 4S3AA 3LERA 3SCSA 3OYZA 2VRJA 2X16A 3FA4A 3ZR5A 3GVRA 4Q3MA 1B1YA 4JQ3A 1C92A 1XLKA 1M04A 3VCNA 1UR0A 2AOSA 4DJDC 5BNKA 1CYGA 1DJWA 1W3KA 4US6A 5E0CA 3KCLA 2Y63A 1X1JA 3N9KA 1MXDA 4UC5A 5HNUA 1SVDA 5HPCA 2GVLA 1T8QA 1SO6A 4JKKA 1V93A 1XC4A 7REQA 3AS0A 5I3KA 4M29A 1QOXA 3UY7A 4QDMA 1PWMA 2J6VA 5DO8A 4LS2A 4V1YA 2XUCA 2CWNA 3BC9A 1LWJA 2YA2A 4Y8FA 2Z25A 4AFYA 4E4UA 3WDPP 1HO4A 1MW0A 1L2UA 1S5VA 1XUUA 3QMSA 3KVMA 1WP6A 2ZRWA 2KXRA 3WFZA 1Q66A 3WQVA 3KBVA 1ZFJA 2V30A 3I7QA 4O1BA 2P5NA 4U3CA 1OJXA 4IXXA 4WVXA 1C7TA 5LIXX 4NVTA 1DTUA 1KO0A 1TPVA 3A13A 4LCQA 3UD6A 3MPGA 3UXIA 3S9IA 4MGGA 3R94A 3UZJA 3VIKA 3EOUA 5EMJA 1UH2A 3OGRA 4P7LA 1N8FA 3DOPA 2NQHA 4FEZA 4NX0A 2RGLA 4AISA 4MHBA 3S6DA 4D72A 2QUVA 3HF3A 3CV2A 4PCSA 4L9YA 4I5XA 2TSYA 3PZGA 4KRZA 3WN6A 2BY0A 3CUJA 5C0QA 5K9CA 2OQLA 3G3DA 3MW7A 3DI1A 4WEVX 2FHFA 3GNDA 3O6AA 3O6DA 1FCUA 1C93A 2ZRYA 3ZJ8A 5A94A 1PAMA 4WRHA 4XO6A 5FCZA 3WBWA 3FA3A 2O56A 3BV4A 4Y6GA 3MUAA 2GWGA 1N7RA 3VKDA 4IISA 1JCNA 3M0YA 1JQVA 3GG7A 5C2CA 4N2YA 5XIAA 3L66A 4GBUA 1JCLA 2XZ7A 3K1GA 1IT7A 3E5PA 1O7AA 1D3GA 1Q63A 1UR4A 2D3LA 3IIZA 4GFSA 2WVTA 4AZGA 2PF0A 4ACZB 1XLLA 3W85A 4XZLX 2DV0A 1XWYA 3RX4A 3FX4A 5T91A 2J4GA 4CD4A 1H7NA 2NT1A 2Z1BA 1NWRA 4JFUA 4A2SA 4MYAA 3T09A 3W1MA 2RDWA 2GJXB 2I5IA 2C0AA 4TX9A 4LU0A 4DRSA 1RALA 2LLEA 3TZNA 1IXPA 3UESA 1JZ6A 5A6TC 3OLEA 4BI7A 5CPLA 3JVAA 1H61A 1GOWA 1OF8A 4FZIA 5CJMA 2Z29A 2DIKA 1BFNA 2ZICA 4AQLA 1F3XA 3WF3A 1XUZA 4ZA0A 4C1NB 4M5PA 3SCUA 3PWGA 3W6YA 3UG5A 1B3OA 1PHQA 3S46A 2J47A 2HS8A 1OFOA 3VKBA 2YZRA 3L4YA 3BWWA 4JN8A 2DQWA 3W1NA 4YN5A 3IIOA 1HJUA 5IBXA 3BLLA 3VGEA 4D71A 4PB5A 2V2DA 4LF1A 3PNZA 5G5IA 1HG3A 3VI2A 1RJQA 3JZEA 3N17A 1AJ2A 4JAWA 3VDCA 1R9ZA 1V3JA 3N11A 4Z08A 1UZ4A 4AX7A 2HS6A 3LRKA 3WD3A 1JZ2A 3BOLA 5D30A 5K4XA 4AZHA 2G4FA 4DJDA 2GGHA 4YU1A 2WJZA 2WXDM 3AUOA 4MB3A 3QV6A 2I14A 1DTNA 2O9TA 1JCTA 2ANUA 4UTKA 3URQA 4Y9AA 1IF2A 1M3UA 3W02A 4PTXA 4JTEA 3K8MA 4GC4A 3CV6A 1ML1A 1P1XA 2VHLA 1QI0A 4LUJA 4ZB5A 3M46A 1DWHM 1SMDA 3S1WA 3PZQA 5EU9A 4JTJA 4DWSA 3WH5A 4AC1X 1CNVA 1GVRA 2SFPA 3E2QA 4M1BA 1R3QA 2CXEA 4K8EA 4FF7A 5E1QA 2BXVA 4ZXOA 5BRQA 4E3VA 1NU5A 1GOIA 4MF4A 2VCBA 2FJUB 5U7SA 2WMHA 2ZVIA 1DIKA 4ENLA 2I9EA 2G3MA 2ZRZA 5LIUX 4AYSA 2J74A 1KQYA 5JBFA 4L6DA 3F4VA 3CV7A 2ZE0A 4MJZA 1R3YA 4ES4A 1R30A 1ZS2A 3GFXA 4JNMA 4HMCA 3WQWA 2QCHA 5A8MA 3ABOA 3MUY1 4N42A 3AFBA 3GXFA 3VAVA 1E5NA 3QF0A 1AW2A 1VKFA 3WO8A 1K6AA 4GUIA 1UUQA 4JPGA 4ZB0A 2A7NA 4S2BA 3D6NA 4RR4A 3I6RA 3W7HA 4O53A 4DYEA 2WSRA 2ADAA 5LKYA 2VNCA 5K2ZA 2E0PA 3QTPA 4RLIA 2Y7EA 3E0IA 1DHKA 1FWDC 2ZUNA 3M64A 3GG1A 3H8AA 2C16A 4JIPA 4YYFA 5FJPA 3SEPA 3W7IA 2A0NA 2B81A 4GPNA 4GCAA 1GQIA 1XLDA 4FAMA 2NSXA 4TX8A 3NSNA 3VZZA 1XQKA 3POCA 1CENA 4YWSA 3K4DA 3BZGA 3GM8A 1CPUA 1XLMA 4OTKA 3W7NA 1V4YA 2VEFA 3RLHA 5AB3A 3RITA 3M7SA 3CEUA 3WF1A 4DEFA 1MQQA 3IGUA 4XUGA 3L4VA 4OZOA 2YFOA 2VC6A 3O9NA 2UY5A 1Q5MA 5CGQA 1OT2A 1GZGA 2RKXA 2E4TA 4I8YA 2DZTA 2YXOA 3MV01 1EQPA 5FESA 1WXYA 3VNJA 3Q67A 1LXMA 1R2SA 3QQWA 4DPPA 3GHSA 1MEWA 4Q4QA 1OJNA 1UH3A 4LC8A 2VFHA 3CZGA 1NQ6A 1HQTA 3VM5A 2VELA 4Q33A 1IEXA 4ACYA 2DZWA 2AL2B 3IIXA 1Z89A 2DPEA 4X0NA 1TRIA 3RHGA 3UZ5A 3NVDA 3G0UA 2V3FA 1TVNA 4LJ3A 4ADTA 4FALA 3AROA 4JR5A 3E96A 3AXIA 3R25A 3XINA 4I5UA 3O0FA 3VXGA 1RCOB 1Y7VA 5HANA 4R7WA 3OOQA 1GJPA 2JGYA 1JXJA 2YL8A 8XIAA 4FLOA 1BVZA 3LTSA 5AVHA 3DEQA 4GGBA 4A21A 5D2WA 1YX1A 4RZ4A 1QOPA 1ISVA 3CQ0A 2DQXA 1RWGA 2WNZA 1GOOA 2ISSA 3GNPA 3ARTA 3BXWA 1NDYA 3EXSA 5BU9A 2XIJA 1LQAA 1DWJM 3E2RA 2ACSA 3T78A 3RYSA 2ZZ7A 3INPA 2J9ZA 1QK0A 3W7JA 2VC5A 4I5RA 3W38A 4H9UA 1PV8A 4AD0A 4H9MA 1PZ3A 1UD5A 2WZTA 3LLDA 1RLDA 1A0EA 2D2GA 3AAMA 1ZBCA 4MPQA 1D8CA 4ECLA 2WM1A 1AH0A 4IP4A 1E6XM 4HJFA 1JDEA 4D2JA 3LOTA 3W2NA 3DIPA 3AIWA 3WQPA 3CYJA 5FKYA 3C2YA 4BEQA 5CQ1A 5I09A 2E1WA 4W8BA 3I3EA 2IMRA 3TSDA 4WX2A 5HNRA 3KEHA 1VP5A 1C8YA 3TYBA 4KRTA 3LSCA 1ME8A 3W27A 3ZXWA 4LF2A 2F2KA 2PWEA 3NQ6A 2Y5EA 3N2MA 3M5YA 3MHGA 1K02A 4WJ8A 3E02A 1EOMA 1R2TA 3QOMA 1GTHA 3QM3A 3PB0A 3PZVA 3AMKA 1QHZA 4IQJA 1XLGA 4BHYA 2R24A 4UMAA 1NFPA 2YYUA 3OBKA 2DH3A 4W9TA 4XG1A 2F7FA 1A3XA 4RW3A 1XV8A 4HZ8A 2HRWA 1C9DA 3F2DA 4CEXC 3E74A 4A05A 3B9NA 4Z2LA 4GKTA 3UJ2A 4ZBCA 4PMXA 3P93A 1VBUA 1EX1A 1TPFA 3WH7A 3WQ5A 3P5ZA 4NJKA 1OQFA 1VENA 1YXCA 1QNQA 2W61A 5DEZA 2UY3A 2ZRXA 3B03A 4FNSA 4TMCA 2ZVRA 5BOOA 1RP8A 3OHIA 2E1DA 1RR2A 2INEA 4PBEA 1IXNA 3AXXA 3WF0A 1P7TA 4GIEA 1P1MA 3A6OA 4JD4A 3M16A 3SUVA 1W32A 2VC9A 3W24A 4DPQA 1B3VA 4AUBA 1RVGA 2VQUA 1CB7B 3GVGA 4HSOA 4FOUA 3W82A 3RIKA 4PMJA 4AZCB 5DCDA 3WFLA 3GRIA 1BG9A 2BY1A 1GYMA 3WD4A 4BF7A 3PTDA 2GJLA 4O4WA 1LOLA 4O1AA 1ZAHA 1SSGA 1I2QA 4F0MA 4GUFA 4H9XA 4AG0A 3QYQA 4WKAA 1K8CA 2G3NA 1A47A 1MNZA 1W1B1 4D6FA 1TCMA 1CBGA 2PAJA 1J10A 3V75A 1Q65A 3Q58A 1UWTA 4GACA 3H2AA 4V33A 4PL1A 4WDXA 2E68A 4CQDA 2YDQA 3KW3A 3UCDA 4GJ1A 1OG0A 2V5DA 2QQ6A 1UZDA 3HV9A 3PUGA 3BLEA 4DUOA 2AQWA 3A5VA 3GVWA 1F6YA 1H51A 4HD5A 3AXMA 2W9MA 2R1KA 4CNPA 3UEQA 4O1CA 4Q7IA 2E6DA 4JEJA 1S39A 3PPCA 3EBVA 2GK1B 1YPXA 1U5HA 3JRKA 2PDFA 2G3IA 3K8KA 4AXNA 3IACA 1R3VA 3TYDA 4KMQA 2V81A 2WCAA 2B7QA 3VC6A 2V5KA 3YPIA 1UCWA 2PWHA 3BSGA 3PSVA 3KBSA 4Q32A 1F4HA 1V08A 2PPGA 3NL5A 2NWSA 4UMCA 2G8ZA 2VGGA 2AQOA 4DNHA 2QDEA 3NVTA 3AS2A 3I4KA 5M03A 4QS5A 2YEPB 3L4TA 1LOHA 3OEXA 2VZUA 2Z6IA 1AZ1A 4Z1CA 1RPKA 3E3HA 2QGHA 1JQXA 2MANA 1SFSA 3BZJA 3GYEA 3NDOA 4PBGA 1UIOA 2VYOA 1UQYA 4JDBA 2XH7A 4DZIA 2ZUTA 1HM2A 2BSLA 3NDZA 1RD6A 5CZJA 5IRPA 4B2DD 3AHXA 5DLCA 2UBPC 1IIGA 3H12A 4ATLA 4NAEA 1XKJA 3NNTA 3A64A 3V16A 2VFEA 2VZSA 4C1NA 4B5XA 1OBAA 3NEVA 4CVWA 3TK7A 3UQNA 7A3HA 4HU4A 4KQNA 3B04A 1NELA 3CQIA 1UASA 2AKMA 3CL7A 1HL2A 3FJNA 5H1WA 4N9DA 1NWUA 1FRBA 2GFTA 2J75A 5DMLA 1F2JA 2QGYA 3W1TA 1TMLA 2X0YA 3ATYA 1EC8A 4YL2A 3P7YA 1C7SA 3R13A 3Q65A 3KTCA 3AIBA 4GO8A 4M3PA 2QMKA 5A6BD 3HMJG 3CWHA 4LEQA 4YWIA 1Q6EA 2C1IA 4J35A 4R88A 3FFSA 3IGSA 2ODOA 4RV3A 3BSMA 4EPDC 3AJXA 4OV4A 1JDDA 2GUYA 2IKGA 4CQ9A 3MA8A 1OIFA 3U4AA 8A3HA 5I23A 3LV6A 3C5QA 2BMBA 3LRLA 4JTTA 5I77A 4HTYA 1S5TA 4HNNA 4O4VA 2X09A 3A12A 1PKMA 4UQBA 3S1UA 5D05A 1KR0A 3E49A 1FFQA 4JN6A 4JQ2A 3EOSA 4UTHA 4LOCA 4C6KA 1OX4A 3O6YX 4PMZA 1JJKA 3HQ1A 5AYIA 1TA3A 4POCA 1P43A 1GEHA 5C7VA 4NXKA 4UFIA 5DX7A 3LS9A 1TJ1A 2YSWA 1A4MA 3IAPA 1ZTVA 2ONEA 1XM3A 3U2ZA 2E77A 1QWGA 1D9EA 3QFWA 3UY8A 2DIEA 3W73A 3KL3A 2QR6A 1SU5A 4D8ZA 1MVYA 3DN5A 3UR7A 3BICA 3WEOA 1A50A 1XDLA 1HL8A 4Z1YA 2YKKA 3K30A 1XIGA 2YCJA 2WWDA 1UH4A 1LOSA 1JGMA 1JNDA 1F4AA 3ONBA 2Y6ZA 4OU1A 3MUIA 2W91A 2BASA 3GUWA 3RPDA 4QHRA 2BHUA 1Q6GA 4N7QA 5FA5A 3P67A 4F48A 1FWJC 3HB9A 2NQJA 2J8TA 2WHMA 3NOYA 3S2JA 4HK5A 1BKHA 1XXXA 5KEZA 1L2QA 4D6GA 2WV8A 4QJ4B 2R1LA 2PC4A 4C7DA 4QISA 2NV9A 2OG9A 1TV4A 3TUUA 4FLRA 3EX1A 5LYRA 2XFYA 4H3DA 1KM6A 3EEZA 3LN3A 4MWAD 2UWFA 5HDRA 2PU1A 1AH3A 4NILA 2QCCA 4AWSA 3UWQA 1JD7A 4CN4A 4C5YA 2OO0A 4UB9A 5LGXA 1PZ0A 1Y0EA 3TP4A 3VGDA 2Q1FA 3VFLA 4OBSA 5HXMA 5DT7A 1M65A 5AECA 3BO9A 1JZ7A 1HKVA 5IFPA 3URBA 4YYCA 3PJUA 3G1DA 1WE5A 3S1VA 1EBGA 3DERA 2RDUA 4O1EA 2XM1A 1TPDA 1KFJA 1P6WA 5D9NA 4UBPC 3UG4A 2XGZA 1F6KA 2UV8G 2DGAA 3C2EA 3F03K 3N9SA 1LXKA 3AU6A 3AC0A 1ZBKA 4W8AA 4CKQA 1GORA 4AXKA 1QW8A 4LB3A 4GIAA 3WUFA 1EBHA 4OVXA 2D69A 2Y2WA 2FZNA 5IDIA 4B16A 1IR1A 3H26A 4HK6A 1E43A 3NPVA 1EO7A 2QIWA 1R8LA 3ZMRA 3C3UA 4J9JA 1TV3A 3MP4A 2B7OA 4YNGA 3SDOA 4PBFA 3H2EA 4WUIA 3SADA 4NZ3A 2PS2A 1ZBWA 1JAKA 4JFTA 3GLCA 2VX4A 2PD5A 1VBRA 3EPMA 2JKEA 3KBTC 1W5QA 4GO9A 4R53A 3MHFA 3KE0A 4H9VA 4IT1A 4PFHA 3GIYA 4H2CA 4A35A 3DG3A 3SCRA 1JZ3A 3IGXA 2EKCA 1REQB 4O10A 3N6HA 4XD6A 4E6MA 3HPFA 2PTXA 2E3ZA 5LIYX 3RPMA 3CHDA 2WB5A 4FXFA 3QC0A 2IUZA 3S47A 5AHLA 1V03A 4JQ1A 1UD6A 4ZO8A 4IG2A 1THFD 1W9XA 2C79A 2RFGA 3PBVA 3CPUA 1O0SA 1KV5A 4HQVA 1D3HA 1XFCA 3VKKA 4GISA 1TJPA 5I3FA 1F3TA 4AC7C 3NQGA 1LM1A 3OGVA 4BKNA 1V0MA 1NJJA 4YVVA 2FTWA 4JHOA 3O2LA 3OP2A 1FUYA 3ITCA 1ONXA 1G94A 4S3CA 4GQQA 2JBMA 1CXEA 4C60A 3FAXA 3DU0A 5D33A 1RJRA 4QE4A 3VFCA 4A8RA 3VINA 3S42A 5AHIA 2BGNE 4O50A 4DF1A 5EMLA 4Q22A 2H8ZA 1JUKA 5HQEA 4ERIA 2Z6JA 1DORA 1ICSA 3DG7A 4KCVA 4TXEA 1N8WA 2NLIA 3M6DA 2CHOA 1DXIA 2NQZA 3WDJA 3L0KA 1AQ0A 1XLIA 1HL9A 1IHIA 1VJSA 3KZSA 1V77A 1IZKA 4J3SA 3AHVA 1R7OA 3CAKA 5GQBA 2VDHA 3IIVA 3AOFA 3G1YA 1TMQA 3W75A 2CHRA 1V51A 2ZWYA 4NJJA 1ICQA 2HQAA 4BJHA 3U9IA 3UXLA 4K3ZA 3SQMA 3QR3A 1K9TA 3A9IA 3LXBA 3W25A 1LBFA 2JALA 3PBMA 5LGZA 2IXUA 5I24A 1QW7A 2VWSA 4Q6XA 2ZKMX 4G7EA 3VOFA 3P8JA 5JU6A 2CLLA 3G6LA 1ITCA 1Y8BA 3TA9A 1B3ZA 3UWYA 1AJ0A 1T96A 1AL8A 3W76A 1X8CA 5ABHA 4RNJA 1UD3A 4R3UA 1CDGA 1V6YA 1AVAA 3U7VA 1B3XA 3AMDA 1SW3A 4K8HA 4U31A 3N3TA 5CAKA 2YL9A 3GHTA 1WKEA 2Y1HA 1KFBA 1U30A 3CUHA 3EDKA 3VKJA 3P61A 3WDHA 1X1HA 1P5BA 2YLLA 4J40A 3REQA 4GXPA 5IXEA 1SUXA 3TYCA 1QO2A 2PC8A 3E6EA 5CZKA 3IJLA 1W3LA 3GO2A 3CV1A 4GWEA 3WQOA 4C91A 4DLQA 4WIWA 3KDOA 4QG9A 4H7VA 1EPVA 3LBMA 4BQ4A 5EMUA 3TMLA 3WMSA 1FWNA 1X6UA 3FV9A 1CIUA 2HDJA 1BYAA 1ME7A 1NOFA 4E38A 5CLTA 3FSTA 4W85A 3IK4A 1JG9A 2ZXAA 1J12A 1UA3A 2INFA 1ODZA 4QS6A 1E6SM 2PLJA 1E9LA 3O8AA 3QMRA 3T4WA 4JL2A 4JNYA 1KCXA 3KCJA 1JPHA 2RJHA 4QIUA 2ZZ3A 2EPKX 3RILA 1P0KA 1UROA 4TMBA 5E6ZA 2ZWZA 3U57A 3VNKA 1F5ZA 1UR3M 2REQB 3RG6A 3S1XA 3B0UX 2QJJA 1P48A 3AYRA 3DGRA 3SY8A 1RBOB 3WJSA 2TRSA 4PMVA 3ZT5A 1W5MA 3HO8A 4P7NA 2XG9A 2RAGA 1FDYA 3BMVA 3T05A 3I6TA 2JF7A 3GX9A 3MJMA 4HA1A 3P62A 3IJ6A 3K2GA 3U3HA 2FVLA 1OEPA 4ZFMA 3PFRA 3CLMA 3EOEA 2AKZA 5DMYA 5DXYA 1CXHA 3HJZA 4OWGA 5HNTA 1C9WA 4LVGA 1UC4A 1OC5A 2XVPA 3QGVA 5CC3A 1G0CA 4UNKA 1UW9A 1SZEA 2EQDA 4PRRA 4DJED 3HPXA 1V6VA 3FEQA 4RXGA 3AU2A 1OYBA 2D1ZA 1S5NA 1XRTA 8XIMA 2O7QA 3OLDA 1LQ0A 2CXGA 4XZ9A 1KKRA 3BJTA 4Q8TA 2QULA 3DXIA 2QT3A 2ZA2A 5LXXA 4EIVA 2UY2A 1BG4A 5K9DA 3BGJA 1SZGA 4Q4RA 3UP8A 3UA4A 2W0UA 3WBXA 2VZKD 5HULA 3URAA 3F4NA 4AD4A 3PUDA 5EKYA 1FWIC 5DT5A 1LP6A 2EHHA 1T6MA 3KRSA 4GJJA 4L56A 5A8QA 1I2OA 1EJXC 1LBLA 1Z32X 3ZLFA 3FKKA 2GSEA 3KTSA 2GSHA 4MFEA 1VFUA 1GYLA 4OKDA 1MW2A 1YXYA 3VOCA 2R1PA 3CPRA 3NZPA 1VJIA 5G1TA 3NM3A 4IFOA 4Z0SA 3UVAA 3IUDA 2EJAA 4AY1A 2V8ZA 1FWBC 3CWNA 4IGHA 2QMJA 3C2FA 3RX2A 4EPKA 3BW2A 3QV8A 1ONEA 3EWCA 5FJRA 2XSBA 3NUKA 3IT6B 3CXOA 3ATZA 3USBA 3UU0A 1WKFA 3B9AA 2DT2A 3FYPA 2WOQA 1R46A 2VZTA 5CSSA 3ARRA 5FJIA 2QDGA 3VMPA 1EPXA 3DAQA 3PNUA 4B9YA 4MB1A 1H7RA 3NTYA 4L80A 1V6TA 3GTFA 2BGQA 3H7RA 3THCA 3UJFA 1ZU8A 1HIZA 2JIWA 4IP5A 3FDGA 1MEIA 1XIDA 1QNRA 2ZBTA 1F3WA 1I60A 1H5YA 2FLIA 3RJXA 3DX5A 4WY0A 1TB3A 1R47A 3VIFA 3HGOA 2WBGA 1K8YA 4PMUA 1MUMA 3I4EA 4CNNA 2NZLA 3IEBA 5G4EA 4UTFA 3EA3A 1DPMA 3AQUA 1H49A 3M1ZA 3OVRA 3RR4A 3ZR6A 4XIAA 3ITYA 4C6CA 1PVNA 2R91A 1KFWA 3LXAA 4PMOA 5I3HA 1PZ2A 2CBIA 1N82A 1DJQA 1VEMA 5KZEA 5E0KA 5BXSA 1TYGA 2HNHA 4M6PA 3W4RA 1NF0A 3D3AA 1LG2A 4ORMA 1AW1A 3AS1A 3TNBA 3DYMA 1M7XA 4N4QA 1BRLA 4D6HA 5CGMA 2WNQA 3V4BA 4MYXA 1V3KA 5AC7A 2R1NA 4CD6A 5AN7A 1YTKA 2Z2UA 1I0DA 4AIUA 1UJPA 1DQUA 1XLFA 2VTFA 2OU4A 3EX6A 3IVTA 4UQAA 2VZOA 4LH8A 2VP8A 3CS2A 3UT0A 2O0TA 4X2PA 4L6OA 2WSPA 3EKLA 4R5EA 5JH1A 3EAUA 1SW0A 1X1OA 3DFYA 2DZVA 5J5DA 3TW6A 3T2QA 3WF4A 1TV8A 3EWXA 2VC7A 3FVDA 3PSWA 5LIKX 3CHVA 1YRRA 3OG2A 3N18A 2Z2AA 3AIVA 2XIIA 3LDVA 3G1FA 1VLIA 4HBKA 3U7BA 3AUJA 3ZR4A 1A80A 1R86A 4XV0A 2QUMA 2CBUA 4M8UA 3HMCA 2GVYA 1FX6A 2VRQA 3GBDA 5FIPA 2QV4A 4JX5A 3VKAA 5EPDA 1W31A 5FI8A 2JKAA 2V5LA 2R14A 4KCWA 1O94A 3NYDA 5FJTA 2F2HA 3IJIA 3TYAA 4DO5A 2BTMA 1V0KA 3O0KA 3M5XA 4HSNA 4OUIA 1Q2SA 4NNBA 2VX6A 1NTHA 2PDMA 1ISWA 5C55A 2ZX8A 2Y89A 1QI3A 3BGGA 5LIWX 3VE9A 2IXVA 2DDXA 2PMQA 2FZBA 3W2KA 1TTJA 1B54A 1GOKA 3WLPA 4AZ5A 3W71A 4WY0F 1JCMP 1XBYA 5DY2A 4Z42C 2XYLA 3AJ7A 4WDTA 1R3RA 4NI3A 3WUGA 2I16A 2Z28A 5DRCA 2O92A 3U0HA 1NF7A 5ENLA 1U5VA 2ATMA 3OGSA 5E09A 1A5OC 4JTIA 4DZHA 1FA2A 4UTIA 4IH3A 3DHUA 1VFSA 1N7NA 4A6GA 3H7UA 2Z1WA 1QATA 1AA1B 3W29A 3K8LA 4JYDA 1RVKA 2A3BA 3K4WA 4GNJA 4DJFD 3H55A 3DBPA 3WLOA 2I9UA 1K1DA 5C7HA 4KFPA 3THAA 3TYZA 4GOAA 4A29A 4LANA 4LUSB 2AMGA 4LW7A 2G96A 1FWRA 4DM2A 1V5XA 3W2JA 5A1AA 4OOUA 4TU1A 2PA6A 1R3TA 4XVDA 3BLFA 1O5XA 1QXLA 3SGZA 4PMRA 1IE7C 4QAWA 2PTDA 3BMXA 4ATDA 3PBGA 2J24A 5CCZA 1BKSA 4BF5A 1S2VA 3MANA 3OJGA 3RCMA 2GDVA 2QCLA 1ZENA 4XTIA 1QPQA 2ZRVA 3CO4A 1YDVA 1W3IA 5E70A 1J0YA 3U8GA 1Q6DA 3MI2A 1WOBA 4Y8EA 3EOLA 2VKZG 5HMSA 1W1A1 3ME3A 1PX3A 3L68A 2EEXA 4HZ6A 5CPMA 4I7UA 4O0QA 4H4IA 2AQVA 2DT1A 3W7MA 3CPGA 4S3JA 1Q6QA 2DZAA 3EWZA 1MQRA 4AEOA 1UD2A 1F07A 3ICJA 3SCVA 1REQA 3DI0A 3C61A 3QPEA 2VCCA 2Q02A 2VGBA 3UXAA 1EDTA 3ZWSA 4RK8A 2C8NA 3MJYA 1UKQA 1BTMA 3S6TA 1O4UA 1ZP4A 2J27A 5A69A 1NOUA 2J8GA 1F9CA 3HJEA 1X38A 1WA3A 2PU0A 4Q8PA 3U4FA 4EF9A 2VMFA 5DBTA 1EDGA 2QF7A 2MNRA 3MQTA 1ZCOA 1E0XA 4EX4A 3M43A 1OK4A 2FHCA 4IICA 1AQHA 4S3KA 1XSJA 1XLJA 4C6JA 3T1GA 4QSHA 4XD3A 3TTEA 1AQFA 4QXIA 2GZXA 4O8RA 1PCWA 1W5PA 4AMAA 4XZBA 4YJ5A 5EBUA 1HKJA 2PEVA 1KWGA 2XN2A 2H9AA 4KIEA 3N1AA 3S83A 1E5JA 1QNPA 1KBIA 1EIXA 3WUEA 2OSXA 4NP7A 4DO4A 4G9PA 1JZ8A 3PZOA 4XZIA 3PB2A 3N3MA 5CZSA 4RW5A 4QCEA 4DWSD 4REQA 3W1XA 4X63A 2DUZA 2CW6A 3MO4A 1B30A 4DM1A 1Q6LA 3W72A 1TG7A 3EXTA 2DFAA 1VS1A 2P0OA 4Z1BA 3SCQA 3LGEA 4CQAA 5ECVA 3CZ8A 4UTLA 2CLMA 4AX6A 3WLQA 4UR8A 4GYJA 4JTQA 3W87A 1HTIA 1B3WA 2HXTA 1X6NA 2YYTA 4S3FA 5G1YA 4DI9A 4BI5A 4MNLA 1FDJA 4MWAC 2QJMA 5CG0A 1RBLA 1B57A 4MLJA 4AY7A 3QW4B 4KGJA 4IFKA 2NXHA 4QG6A 3SRHA 4YCPA 3FAWA 3GDMA 2OEJA 4GH1A 1KFLA 2PWFA 3W83A 3EWWA 3A4XA 3I3DA 1BYBA 5TF0A 1OFAA 3SM0A 1K4HA 4GI4A 4G7FA 1K3UA 4C90A 1AFSA 2IQTA 3LBCA 3W2UA 1S1RA 2A7PA 1W5NA 2ZTJA 2PGRA 4AVOA 2ZUWA 4B2DA 4MY9A 5G2IA 5A2AA 4DO6A 3UXDA 3WFAA 3IVSA 2J6XA 2BXZA 4CCEA 4BCEA 2QCDB 1OZMA 5AFDA 2IS7A 3BDKA 1J5TA 2FIQA 4CD8A 3ALGA 4UOJA 1QCWA 3UR8A 1WKDA 1UWIA 2YDSA 2Z2BA 3HG2A 2YCLA 3NO1A 2VGFA 2JIEA 3UGRA 3M6YA 1Y5WA 1SPQA 2W63A 1E73M 5C9WA 2WZEA 3L2LA 3WQ8A 1E1CB 2Q71A 1PZ1A 1KFKA 1QASA 3N12A 3CH9A 4XB3A 1W91A 2WLZA 3IPWA 4DBDA 1MFUA 3O07A 3DHDA 2Y8VA 3CB3A 3ITVA 2OWWA 1JFHA 4L1WA 3KFTA 3N2BA 3D46A 1K6WA 3KXQA 3IV8A 3N6QA 4W87A 3BK0A 4IQLA 1UR9A 4RL3A 4DXVA 1EX5A 2PWUA 5H8PA 2OX1A 2ZIDA 2OXNA 2VCAA 2VUNA 5C9XA 2CLFA 4A2RA 1R2RA 2V2HA 4U2ZA 4YVXA 2CESA 5CPSA 5LHEA 4TX6A 4XAFA 1HXJA 2DSWA 2ZUUA 4FIQA 4G1NA 3B0PA 5CG7A 1ZCCA 4AH7A 1DE5A 3UW6A 2PI6A 3RLUA 4C7GA 2V3GA 1G4EA 1I8JA 4AHQA 1QBBA 4GUJA 4O1DA 5K9XA 1ZZMA 2REQA 1L0PA 1OT1A 1LRNA 2HVOA 2QCGA 5BWAA 2FTPA 4XBJA 1J0IA 3AALA 3BUVA 1A5NC 1Q7MA 3NQDA 1Q6RA 2O9RA 3GHRA 3W88A 4FHAA 2ZX5A 4GKLA 4BWLC 2HROA 1V3HA 3FGCA 1ITXA 1YDOA 1P4CA 4KEVA 1QWKA 3AMGA 2VEIA 3VNIA 2R94A 1RWCA 5EYWA 1YEYA 2V6AA 3S2CA 3QXBA 5LHFA 3FXGA 4IMDA 2YLAA 1E6PA 2X0HA 3H2CA 3U48A 1R85A 2WVVA 4TVUA 1X98A 3VGGA 5E9XA 1QI5A 3FJ4A 3WELA 4J4KA 3GTNA 5EL1A 1V3IA 4PA8A 3CTTA 3SR7A 5C5YA 4HB7A 1PTAA 3K1DA 1EUAA 3NCOA 3VZYA 1VFOA 3LV5A 4MNMA 3SUWA 1ZBVA 1Q6CA 4AD5A 4PZVA 4MB4A 1RCXB 3CTLA 5A95A 2E8ZA 5EBAA 4HNVA 3WK0A 1HJXA 3VIHA 2PLCA 5D03A 1ZPTA 3T0BA 3E1F1 2QAPA 3SN1A 4JHZA 1A5LC 5MKGB 5EMYA 4MWAA 1M03A 1WDWA 2ZX9A 3NQFA 4W89A 5D2YA 3ITXA 1IEVA 2WJEA 3FEMA 3TTQA 1MUCA 1O12A 5ABGA 2C13A 1WNOA 3WX7A 1RQEA 4J5NA 2YW3A 6TAAA 1HNYA 4FXSA 3STFA 3VNDA 2NQ5A 2J25A 2CFFA 4G2DA 1F73A 5G1MA 3MT1A 1MO0A 1YYAA 3L0NA 2XH2A 2P10A 1GVSA 3KHJA 1LLOA 2XFWA 1N7QA 3W01A 1XR2A 1HW6A 1NEYA 4H8NA 4NY2A 2WVSA 1GQJA 3UWEA 1FHUA 1LT8A 1YPFA 1S5WA 1J8VA 3CU2A 4FS9A 4UFJA 1VYSX 1E1EA 3GAYA 3RU8X 1DIEA 4Z1AA 3CEPA 3TSMA 2YPIA 5CZTA 5H91A 1E0UA 1S2CA 4X9YA 1JPMA 3L5AA 4Q8MA 1XSIA 1LUCA 4JICA 4LUTA 2I1OA 3R2GA 1YXDA 1X39A 2GVGA 3OO2A 4W7WA 1LL6A 4ZQPA 1B31A 1FXQA 2XN1A 3I68A 3W0KA 3B8SA 4R27A 2PDIA 2PWDA 1PCKA 2FTYA 4LCRA 1OFQA 3PS7A 1GOQA 4B4HA 1BYCA 2J8FA 4F0LA 1SQ7A 5BOFA 3GW0A 4QG8A 2A5HA 3B0VC 4Q7BA 3W6MA 2PRHA 4LPCA 2QDHA 1K70A 1IWAA 2ZZ4A 1X97A 2VR5A 3RMJA 1YNPA 3MHUA 4FNTA 3IJ9A 2CZFA 3DFNA 1W2VA 2A3HA 4CEUC 3KP1A 1XH2A 2Z1KA 4FNUA 5I3IA 3GKAA 3PULA 3V1PA 3CQHA 5F2LA 4L1XA 1C82A 4IXHA 1QVBA 1I4NA 5A2CA 1R3WA 1ELSA 5GNYA 4IF2A 3TMQA 2HK1A 3FYYA 4WGXA 1HN0A 5M17A 3GAKA 4V2XA 1K9FA 4RPQA 5ABFB 3HV8A 1FWSA 4IMCA 4WD0A 4YIWA 2ZZ6A 2TPSA 4JIRA 4FA3A 1QNSA 3F4CA 4EAYA 1ISYA 2PDUA 1XYFA 1DWGM 1FWWA 1CCWB 2BFGA 1BWKA 4OBTA 3QFEA 4H6RA 3G3MA 2YXGA 1OYAA 4M7TA 3VDHA 4RE3A 2QKFA 4DJEC 5FEXA 2CKRA 5A6AA 3LNMA 4HHHA 4ZODA 2IKJA 4GVFA 3WBEA 2GUBA 2ZDSA 4WDWA 2X30A 3SCOA 4GI8A 1J5SA 1YDNA 2BHYA 3S9YA 1QPRA 1SM9A 4K7YA 4DYJA 5HQMA 2AAMA 2WNWA 2WAGA 2ISWA 5GNZA 4ZGYA 1KA9F 1F9GA 4Q8WA 3TN6A 3NIYA 5XINA 3PBUA 2VVSA 3G0SA 5HUOA 1BLIA 1XLCA 2EPHA 3ONCA 4GBDA 3NL2A 3NQ8A 4S2CA 5A8OA 2EF9A 4NJHA 3OLIA 3AWNA 2VEPA 3C8NA 2CLHA 2KZHA 1XP3A 3TQKA 4UR7A 1O68A 2WLYA 4AZ6A 4AHOA 2WZMA 1UKOA 1I8QA 1KW1A 1YNYA 3O16A 3ZVHA 4ADUA 1WDPA 1R6WA 3E0WA 1NY1A 1S2AA 3O63A 1ME9A 2ZA1A 3EB2A 6REQB 1NM9A 4V27A 3I7SA 4DBEA 3H22A 4H01A 2PWVA 2Y85A 4QNEA 2HBXA 3CUXA 1KTCA 5HQLA 2PB1A 4IIDA 3ORWA 1SYTA 1GVIA 1QI4A 3AI0A 4EAMA 3KP0A 3LCFA 3UERA 2JE8A 3WENA 4EE9A 5D4YA 2PBGA 3C3NA 2Z24A 3L9CA 3KWXA 3FLUA 4EANA 3SGGA 3TJ4A 3GU2A 1D8WA 5CAHA 2FMOA 3QZEA 2PDQA 1HT6A 1RSCA 3ITGA 4O0KA 2WMIA 2Y7GA 3WJXA 3APGA 1PL9A 3WH8A 3TV8A 3IGHX 1LTDA 2E9MA 3LCHA 3VIJA 3UJRA 2NUWA 1HGWA 2WPGA 3W7EA 1GYNA 1RBAA 4TR9A 4QBXA 3VNLA 3WYZA 2B7NA 2YDAA 3TQVA 4HT3A 4HU0A 1NARA 3AICA 7ODCA 3KRZA 5HWNA 4S3EA 1KBJA 4B3LA 3AYSA 1QFEA 1PXGA 3F5LA 1CB2A 3NL3A 2ZUSA 1V6XA 3TW7A 3SAZA 3CT2A 3A22A 4B3KA 3AXHA 2HWGA 3S9ZA 3OIHA 4S3DA 3TKFA 3TZFA 4GZ7A 1L6SA 3WL0A 4XQ6A 5C2XA 1EL3A 1S3TC 2JF6A 1BVNP 2BBFA 3HG3A 2DSVA 3S1GA 3T44A 1GPWA 1VBHA 4MY1A 3MY9A 3AMCA 1IYXA 2ACRA 1UP0A 4LUYA 5BXTA 2OYMA 2CLOA 1Z41A 1Z6KA 3B05A 3BGAA 4O28A 3AO0A 4DZ5A 1B4KA 3B8DA 5FD0A 1YTEA 1W6TA 4NI8A 5ECUA 1LOQA 3HPAA 1XPYA 3N19B 4E2OA 1PX4A 4DHGA 2RDXA 5DANA 5LNVA 1O5KA 2QCMA 1LWIA 3LTPA 1G4TA 4UOQA 4B15A 2PRLA 3QR8A 3ALFA 1ZSXA 4BR1A 4ICCX 2W62A 4RZ6A 2MUCA 3DFPA 4N02A 4GXWA 5I03A 1VRAB 4Z0JA 1PB0A 1KBLA 4E8DA 1JF5A 1XBXA 3FDKA 3IT4B 4MWAE 1W2PA 1OX6A 4WK9A 2P3EA 4D8OA 1DIOA 5DXXA 5BMWA 2XZ9A 4A3YA 4WXZA 1DL3A 2WMFA 5BZAA 5CH9A 1TWDA 4Y2WA 5CSUA 4AYGA 3RAOA 1GVOA 2D22A 3RLGA 2Y7FA 2VD8A 1B90A 1TJ0A 1LLZA 5F1VA 2J7DA 4GH3A 5E93A 3RM9A 1KV8A 1OJMA 2R9RA 3T7VA 1F1SA 4DJFC 4IPJA 3MMUA 3IUHA 1EGVA 1QPKA 1QR7A 2WJFA 2C1HA 2UZ9A 3W7DA 1HX0A 7TIMA 5A6LA 5FOOA 1EJRC 2OGYA 3ZFHA 1V6UA 3LPOA 2I56A 3QSRA 5C54A 4W5ZA 4O18A 1DJYA 1W1PA 3UCQA 3UJEA 4CUCA 1Z7AA 4JNZA 1XX1A 3PZ9A 3LHTA 3EXRA 2FHBA 1OY0A 2GVEA 2VFFA 1JCXA 3TQ0A 3GDTA 2DT0A 4MUZA 4LBSA 1W1TA 3WH9A 1JULA 3N15A 1DQXA 4FR1A 4HK7A 3V18A 4LSBA 3W3OA 3MMTA 2JEQA 1H7PA 3VOIA 3WD0A 4F0SA 1ZAIA 4YCOA 3HPZA 1VH7A 1ESWA 4JQAA 3VNMA 4M82A 4QJ1A 1A0DA 4UTJA 4BZYA 4D6DA 2DY3A 3W1UA 1UG6A 1EC7A 5IBXC 3KZPA 1DJNA 2I5QA 1UUMA 4UTMA 3EB3A 3WLLA 2IQ0A 2CNCA 5CPQA 4E8GA 4EXAA 5IM51 5CGTA 4QROA 3MMWA 1SJCA 1D7KA 4EPBC 2YCKX 1VZWA 4C5ZA 2EAWA 3QKEA 3Q45A 5FEZA 5FL0A 5BXRA 2CU0A 1XIEA 1MRAA 2OMAA 5AYYA 3TJIA 3QHNA 2KX9A 2PDPA 4HA4A 3VC5A 3SGUA 3R58A 5M2FX 3T2OA 3L67A 4QJ3B 3FY1A 2EG6A 4C6DA 2X1RA 4R7OA 4GE8A 1GVEA 4QEHA 1KM1A 1MFVA 1OX5A 4F9DA 4O12A 1UZ1A 2GSJA 1K7XA 4DWSC 4J3UA 1S46A 4GYFA 3ARXA 3TOYA 2WSQA 3C0QA 1CGXA 1O66A 2VI0A 3OODA 4HNOA 2BRPA 5CBJA 5T26A 4O16A 3VCCA 3OBAA 3VD9A 4Z2KA 1P0DA 4XZWA 3UNTA 2WWCA 3SY5A 1BF2A 1J2WA 3PG9A 3STCA 4B90A 4GIRA 3EGJA 4JXCA 4L4MA 2YOCA 2R82A 2DH2A 2NWRA 1FP9A 1PPIA 3PAJA 2ZTKA 5G4WA 4GX9A 2YCEA 3H4XA 2X7WA 1JYNA 4RKAA 4MSSA 3EDEA 1JUEA 4ZVJA 1FHLA 3STPA 1Q7QA 3VPLA 2NVCA 2A3EA 2F38A 4QR6A 2BXYA 3P82A 5FF3A 1ZY9A 1U22A 4H19A 3FCPA 5H6HA 1W3HA 3QR1A 3KDNA 2Z1SA 4HP5A 1KQZA 3EDFA 3MSYA 3BTNA 3UPBA 1BXNA 1KGWA 3NG3A 1E4MM 5I5RA 1QDSA 2FGLA 4IIBA 4HOXA 4CU8A 3WMBA 3B0XA 4CNUA 4FOKA 3NR0A 3AIRA 3STGA 3DFTA 4DJFA 3NWRA 1XF0A 4H6EA 3IV3A 4ALDA 3QLDA 4AIEA 1DJXA 3PFMA 3C2RA 3SY1A 4IP7A 4Y96A 2C19A 3NL6A 3ZJKA 2BG5A 4NL1A 1TQXA 4E2VA 3LI1A 2NVAA 1W1YA 5C9UA 4R33A 4LVFA 3N13A 4NAFB 1GNXA 2ALDA 4DB7A 5U4NA 3M41A 3P14A 4L65A 4ZL1A 1ADOA 4F66A 2BVDA 3APYA 5A2BA 3GH5A 3I65A 4F2BA 3UG3A 2FVKA 3GDBA 2PD9A 1ZNNA 3U2OA 1CB8A 1TTQA 1LLQA 3NOEA 4QE5A 3AIUA 1SR9A 3QY8A 4Q7NA 1SSDA 2AGTA 1V7YA 3F2BA 4J3TA 1DP0A 3W1PA 2QDDA 3BAWA 3JU2A 4XAYA 1G7VA 3H2OA 3AWOA 1YBQA 2Q8ZA 3RK8A 1M5WA 2QJGA 3A24A 4QTGA 1XSKA 3AISA 6XIMA 1MSSA 4KWVA 3TN3A 4JIQA 5LNWA 4XKYA 2CETA 1H63A 1VR6A 4XSLA 3KRBA 5DY3A 4GMEA 1MZHA 5FJJA 1HF6A 3KTXA 3TIMA 4IQEA 4J3WA 1UD8A 2IKIA 3GFYA 2IQDA 3CM4A 4UFKA 3KS5A 4IIGA 2C91A 3J7HA 3N4AA 1H0GA 5DQPA 1N7PA 2PP0A 3B8UA 1H7OA 2J9YA 1HGYA 3QOKA 1XLAA 2YGYA 3G18A 1TPC1 3H4GA 2VZKB 4UIOA 1H2JA 3F4DA 2GGJA 1BHGA 2PODA 4CGTA 3UYIA 3LEPA 3MC5A 4O15A 2J66A 2OZTA 3W37A 5REQB 1UP2A 1I2PA 3MWCA 4HU8A 1NDVA 4CQBA 2POTA 1GOMA 4FXRA 3KHDA 4F2TA 5CJ5A 1N8IA 1WV2A 4WSJA 3HGJA 4JY9A 1MNSA 2V67A 4LAZA 1KM5A 2OLAA 1N7OA 4UQDA 1VHNA 2BNJA 3PM6A 3NSXA 4EXBA 1RWAA 3L4WA 4KT2A 5I3GA 1O6IA 1WXJA 3GS6A 4GK8A 3UA3A 3HIJA 3RO6A 1E4NA 1XCFA 4HCHA 2IKHA 3IJQA 3PWAA 1OFPA 2P50A 4INFA 4O57A 1MRQA 1PKNA 1WQ5A 4AWEA 5ABTA 1RAKA 3E5BA 3W1LA 2VENA 2FVMA 3WJZA 1IEWA 4C6LA 3VMNA 4B5WA 3W2MA 1F61A 1W17A 1US0A 3WNKA 2DW6A 4GRSA 2I57A 1YE4A 4HMNA 5I78A 3NQVA 4A3UA 3LQLA 5D2VA 2FMNA 1JCYA 2FQIA 3V5CA 3THQA 2OB3A 4D9PA 1RHCA 2WMGA 2YX0A 3PPGA 1MQPA 3RRAA 3CHCA 3KVLA 1PDYA 2CPUA 2ISVA 4WJXA 4PH6A 1QBAA 3ZLGA 4IPNB 3QPYA 2WM0A 2DZUA 3CASA 2X1IA 2IPWA 4AD1A 4IPIA 1JR1A 3MUCA 1AW5A 3UF9A 3F7JA 1XKYA 4HGXA 1W9BM 4JTDA 2VQTA 7REQB 4ZOAA 1X7IA 3MU7A 2V3DA 4P8UA 4UMBA 4IMFA 1JZ4A 3H7VA 3KS6A 2J88A 1YHTA 3CB8A 3R4IA 3KOWA 5I79A 1XLEA 1H1ZA 4AEEA 3PBWA 3T2PA 1SO3A 2EG8A 1RK5A 3LGDA 1FQ0A 5CXPA 1I0BA 3CAQA 5EY5A 3GDLA 5A6KA 2A85A 1DJZA 3V7PA