2WMIA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 in complex with the a-trisaccharide blood group antigen.
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
582
structure length
572
Chain Sequence
b'VDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTENYWIWANDIENKAADYLKVSAKNGGYFIWAEQNNGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
molecule tags Hydrolase
source organism Streptococcus pneumoniae
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
total genus 221
structure length 572
sequence length 582
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmiA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmiA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmiA02
1QNRA 2DSVA 2VQUA 3BGAA 3W6LA 3CUJA 2BXYA 2QPSA 5A2AA 5I3DA 1EDTA 2PWDA 2V3GA 2OYLA 5FOOA 3OBAA 1X1HA 1LLOA 3TOPA 1JZ7A 2XYLA 1UR2A 3W28A 1EDQA 1CXHA 3VGFA 3ARZA 1F4HA 2O9PA 1FHDA 3PZNA 1R87A 5LA1A 4ATWA 3AIQA 1V3KA 1VAHA 4JFVA 5D9MA 2W62A 3IAPA 1CPUA 2DH2A 2YL5A 1DWIM 3ZMRA 3A4AA 5BROA 3PZVA 2WB5A 5A2BA 1E5NA 4B9ZA 3ZT6A 1KBBA 4GIAA 4DWSA 1CXFA 2WC4A 3ZJ7A 2ESCA 2O9TA 3WF0A 4ATLA 1VF8A 3OLDA 1JI2A 3CTTA 5A94A 3VUPA 4UFJA 4A3HA 1PBGA 1O7AA 2GFTA 4UOZA 3NSXA 3KWXA 3WF4A 2XVLA 4PRWA 3ZM8A 1X1JA 3AZTA 3CHFA 3KEHA 3SUTA 4LYQA 1WCGA 2AMGA 2DT1A 1TVNA 3FY1A 3G6LA 5ECUA 1CXLA 3OB8A 1UWTA 4EKJA 4D6JA 1PX8A 4D1IA 4WKHA 2JEPA 1KGUA 2BHZA 4KWUA 1EOKA 3AS0A 5CJ5A 2ZX8A 1MVYA 3CZJA 3ZIZA 2Y4SA 3WFLA 2VI0A 1G01A 4W7WA 2BHUA 1JNDA 1W9XA 3CIVA 1CBGA 3T0DA 1OB0A 1TA3B 2FH6A 3VGGA 2J75A 2FHCA 4FLSA 5TD4A 1UKSA 1CNVA 5CGMA 2VZSA 2PB1A 1QHOA 4QLLA 2WMFA 3CZKA 2CKRA 1UWIA 3L4XA 3OLEA 3K4AA 3VMNA 1TZ7A 4AZHA 1JYVA 4AIUA 3OGSA 2EEXA 4XZBA 1B1YA 1BPLB 1K9DA 1UD8A 4X9YA 3QOKA 4TX6A 1EQPA 3W29A 1W9DM 4AD4A 5AC5A 2PI6A 4AZGA 3VM5A 1XYZA 2JALA 2G3MA 1UH4A 4JL1A 1W9VA 2Z1SA 2Q1FA 3VGDA 4Z2HA 3DYPA 1IZKA 2WCSA 1H5VA 2X1IA 4UQCA 3U5UA 5M17A 1VFOA 3VGEA 3WNMA 4BS0A 4PMZA 3W6MA 1H49A 1VEOA 2BVTA 3CLWA 2WNWA 1EGUA 1KCLA 4CGTA 1XH1A 2XWEA 3VIPA 3ZR6A 2QPUA 4PUEA 1J0ZA 4TTGA 3ZO9A 1LL6A 3PTQA 1DWHM 3EDFA 3GXDA 1EO5A 3QR3A 4MB4A 1BVNP 5LA2A 3AIWA 1I75A 1QI2A 1E40A 4H8UA 4AD1A 1W1TA 1E1FA 1VBUA 1NP0A 1EHNA 1ZJBA 3ALGA 1QI5A 4DUXA 3MUAA 4D6IA 4CU8A 2BRPA 4M82A 1X6LA 4W5UA 1E43A 1OIFA 2WHJA 1BYDA 1I8QA 2W92A 2D1ZA 1R8LA 4A4AA 1M53A 1OJMA 2WWDA 1CXEA 3RILA 2DT2A 4HMCA 3WH7A 2JF7A 3PZ9A 3W38A 4E8CA 5EMYA 4V2XA 1LL4A 2XSBA 1RWFA 1TMQA 1KBKA 3TA9A 3CHDA 2X0YA 3TTQA 1JZ8A 1H11A 3WFZA 5I6SA 4NRSA 2PWEA 1QI0A 1UR8A 4LGXA 2ZXDA 2BVDA 4B3KA 4GZJA 4J27A 1E0XA 4BQ4A 1PAMA 1VENA 2WVVA 4HOZA 3BAXA 4KMQA 3NDZA 2G3NA 1GQKA 4ZEPA 1QNOA 2V3FA 3WF2A 4WIWA 1XSIA 3GXIA 1JZ5A 1CEOA 2XWDA 1C3FA 3A47A 1JYXA 3N11A 4TUFA 4XUYA 1Y7VA 1VFMA 4AZ7A 1HJSA 3T2OA 4P7QA 2IUZA 2X2YA 1J0YA 1JYWA 3AICA 2J77A 2YA1A 1TG7A 3U7BA 2CIPA 4AZCA 1GOMA 1HM3A 1AVAA 1E4LA 5JBFA 2YL6A 3PZGA 4X0NA 3LPGA 4OKDA 5A8OA 3VD7A 1FH8A 5DT7A 7CGTA 3I3BA 3AMKA 1ZB5A 3L4ZA 2WCOA 1C92A 2QHAA 2G4FA 3AYRA 4QDMA 4Z2GA 1HN0A 3MMUA 4UZSA 1WNOA 2CKSA 1U2YA 3SCTA 4H41A 5DF0A 1CYGA 3GNPA 1V6YA 3OGRA 3UEQA 1EXPA 1CECA 1VFFA 4OJYA 3ZOAA 1DWGM 1W3JA 3GXFA 4MAVA 3VD9A 3EBVA 1ISXA 4MPKA 3EDKA 1E6NA 2V3EA 1BYBA 4BZYA 3SCWA 3VU2A 1JFXA 3CZEA 4TOQA 5CPQA 1J0NA 1JZ2A 1K6AA 1PJ9A 2FDMA 3OLGA 3ZR5A 1E9LA 1R7AA 2JIEA 3S6TA 5EFFA 2W63A 3GYCA 4D1JA 3SUVA 4LYPA 2GSJA 3WH5A 3AS2A 4W7VA 1BYCA 1GQIA 1ZBKA 2WLYA 4PSPA 1BFNA 4CCDA 1E72M 3EYPA 3FHAA 3BH4A 1V02E 2X0HA 3WDRA 1B3WA 1JXJA 1E3XA 1RH9A 2QLYA 2BY3A 1WZKA 3UERA 4U3CA 4PCSA 1UR0A 4Z2LA 4ACZA 4MNJA 3FW6A 3BXWA 1QHPA 2WYSA 2ZWZA 1SR0A 5AYBA 5F7UA 3POHA 3VIHA 4DM2A 3WQVA 1W2VA 3WDHA 2QF8A 1UH2A 3GH4A 1J12A 3WDQA 5GNXA 5FD0A 1H2JA 5IDIA 1H3GA 1WAWA 1Q6DA 3MUIA 3K4DA 3VIKA 4AZ5A 4NZCA 4X0VA 3PZMA 1MFUA 1HKJA 1PPIA 2ZXBA 3DECA 2DSZA 3AISA 2VJXA 1GOOA 4ZE4A 4W8BA 4D6EA 4JKMA 3LPOA 4FMVA 1KGWA 3BMWA 4JCLA 4PEEA 2BRVX 3VDBA 3D3AA 1ZS2A 2VUYA 3RIKA 3AZRA 2JEQA 1E55A 1JAKA 3OGVA 3AMDA 3EDEA 1BTCA 2DPEA 1J0KA 2PWHA 1RD6A 5CG0A 1KWKA 2E9BA 4HU8A 4D6HA 5E6ZA 2XFYA 5BRQA 3VM7A 4QCFA 3PN8A 4LQ1A 2OYMA 3CHCA 3AHVA 3RM4A 1JDCA 4DUWA 5A6JA 1UR1A 1VJSA 4MTVA 1N7RA 4AEEA 4PBGA 2WPGA 3PZOA 1OD8A 3LPPA 2VRJA 1UWSA 3BLKA 2J7EA 4KRUA 4BQ5A 2VCAA 1EOMA 1BGAA 1DWFM 2WKLA 3EDDA 5E70A 1UD4A 4UNIA 4BCEA 1GVYA 1HJVA 1E6XM 2WZEA 1KR1A 4WKAA 4F9JA 4P8VA 1HF6A 3ARUA 4TTUA 3CUHA 1UWQA 1OGBA 3ARXA 4HMEA 2E3ZA 1HL9A 1J10A 1OINA 3WENA 5GNZA 3AJ7A 3ARQA 2VCCA 1AQHA 3WL0A 4Z2IA 3N18A 4MJ4A 1NARA 4UFMA 2VO5A 1LWJA 4PMQA 2WMIB 2WK2A 1QI3A 1HVQA 1ZU8A 1HJUA 3K1DA 4PYSA 4W8AA 4JFSA 4GI6A 5CLTA 4B15A 1MYRA 1J11A 2CPUA 1UWRA 4XB3A 3W37A 2DIJA 2CHOA 4FLRA 1GOQA 2XVNA 2DGAA 3NYDA 1V6UA 3T09A 4A3YA 2D0FA 4N0RA 1CGVA 1X1NA 2VNCA 3WUGA 1LQ0A 4CU6A 3AMCA 1P6WA 1KCKA 2OLHA 4HA1A 4PN2A 1WDSA 3AYSA 5D8WA 4HPGA 1VFUA 1MW2A 3T0BA 5IFPA 1KXQA 1GUVA 3W25A 2WHMA 1E0VA 3AHZA 3QHNA 4GINA 5ABFB 2A3BA 1HP4A 5A8QA 1G5AA 4AISA 3G6MA 1V02A 1XV8A 1E6QM 4Y7EA 1LWHA 1UHVA 4JIEA 7A3HA 4H8HA 2XIBA 1RWHA 3GXMA 3MO4A 2XSAA 4CKQA 1QBAA 1HNYA 4OBSA 3GBEA 4H8VA 1OGSA 3VNZA 3L4WA 2WMJA 2GDVA 2YDSA 2A3EA 1UR4A 4B9YA 4QP0A 2J7FA 2WXDM 1K9TA 3BAJA 3WH9A 4V27A 3HU7A 4NF7A 1G9HA 3E1F1 1EDGA 3WDJA 4FK9A 2E24A 5A6BA 2XG9A 1B2YA 2VZUA 2V5DA 2GDUA 3CPUA 1H4PA 3DHPA 1CGYA 1AQ0A 2X8RA 5HOSA 4UOJA 3PBGA 3ZQ9A 3CZ8A 3ZJKA 2WSPA 1QI4A 4E4PA 2X09A 4OZOA 1WZLA 2JIWA 2EBNA 1FH7A 2DIEA 2CYGA 4IPLA 1W1YA 3ECQA 3RDKA 3FNDA 3MV01 2W67A 4AYSA 4OIFA 4RL3A 4PMUA 2WMIA 2YL9A 3K8MA 1CGTA 1G0CA 5BXPA 1W2PA 1HN1A 4TVDA 3T2PA 5JIPA 4U33A 1GVIA 1C8YA 4JCMA 3VNYA 1GNXA 4YHGA 5IHSA 4WKFA 1XHGA 1JF5A 3ZJ8A 4PCTA 3KL3A 2C7FA 4JAWA 2B31A 5CPTA 2J7GA 1HKKA 3THCA 1TR1A 3T2QA 2OWXA 2HISA 3AROA 5I24A 1OSEA 1BF2A 2WZHA 1V6WA 2IXVA 4HZ8A 5AC4A 5IXEA 1ISZA 2WVUA 3WIJA 3PTKA 3WMSA 1RWCA 4J3XA 4D72A 3VIGA 4JFUA 4Q7NA 1V6XA 1W9UA 2Z1KA 3WQ4A 1CZ1A 2VT0A 5D9OA 3AHXA 1NWRA 1V3MA 1L8NA 2QMJA 1A3HA 1E70M 2QMKA 1NWTA 4H2CA 2YBTA 2G3IA 4AY1A 1GOWA 1G94A 3M7SA 3KL0A 4HPHA 2BNJA 1B3VA 5HDRA 4WK9A 2WHLA 4PSRA 2EPNA 2WCGA 2XFRA 2ZUSA 3CGTA 1VB9A 4UFKA 3BCDA 3F5LA 5CXPA 1NP2A 2Y2WA 5ABHA 2ZUUA 5DMYA 2UWFA 4ZENA 1IT0A 4E8DA 4ZFMA 1UKOA 2DH3A 1BVZA 2FHBA 2ZX7A 4YN5A 1UUQA 1J0MA 3SUUA 3GH5A 4W7UA 3SCRA 2CXGA 2XGIA 4PTXA 4AXNA 1JZ6A 1JL8A 4CVWA 1E73M 3D5HA 2XJ7A 3WSUA 1M03A 4DWSC 2J47A 1XRVA 2J7BA 1CLVA 2DDXA 4D6GA 1NM9A 1XH2A 4W87A 1XH0A 3SCOA 4U2YA 4PMYA 3WD0A 4D6FA 1B0IA 3WNNA 1OWQA 3HMCA 4UTFA 5A6LA 1EH9A 5FL0A 3UR8A 4PTVA 4JZ5A 4LXFA 1W32A 4UOQA 4JFTA 5CQ1A 2XIIA 1R7OA 3BSGA 1FH9A 1O6IA 3EDJA 5DT5A 1N82A 4P7RA 3GTNA 4RE3A 5GQBA 1RWGA 3VD4A 2CBJA 3APGA 3VINA 4PMNA 1ITCA 3OZPA 1F9GA 3WNPA 1XSJA 2J74A 4GQRA 3PZIA 2EPOA 2CBVA 3FAXA 1BQCA 3AXHA 4W5ZA 2RGLA 3EMCA 4ACYA 1EA9C 1JD7A 4M8UA 1UD3A 1US3A 4XV0A 1C7TA 2W5FA 1MQRA 4CUCA 3QGVA 1J0HA 1ESWA 3ARPA 3PTMA 4CN1A 1E4MM 1RW9A 3BSHA 2GJXA 8A3HA 2G3JA 2F2HA 3RPMA 3ZT7A 1GW1A 4W84A 6A3HA 4M80A 5A2CA 3B9AA 2ZIDA 4J28A 2XGBA 4GPNA 1OT2A 1ISYA 3WL1A 2WVVB 1CWYA 3NCOA 5A6BD 4M81A 3VIJA 4CCCA 1ECEA 1ZBWA 1XC6A 2WKGA 3IAQA 1AQMA 1NOFA 3NUKA 2E40A 1IZJA 4P7OA 3WNLA 3WH6A 2JF6A 1HJWA 3O6AA 1KXHA 5C8BB 5CSUA 1HP5A 5I0DA 3M6DA 2BS9A 3EMQA 2OYKA 3W27A 4HP5A 3N12A 1QBBA 4PMXA 1CGUA 1H1NA 3IJ9A 3TP4A 8CGTA 1WZMA 1F4AA 1JFHA 1F1SA 1MQPA 1TVPA 3AIBA 1CXKA 2WLZA 3VGBA 2BHYA 3GZAA 4FLQA 1W1VA 2CBUA 4JL2A 1UQYA 3AMLA 1B3YA 3OIHA 4JHOA 2OWCA 3L4TA 2WANA 1GQJA 4AIEA 2VX4A 4GXPA 1U33A 2C8NA 5GPRA 2VURA 3AZSA 5D9PA 4AWEA 1JD9A 3W26A 1V0NA 2PWGA 1LL7A 1D2KA 3K8LA 4C7GA 3W53A 3LPFA 5I77A 2BXZA 4GO9A 1B3XA 2MANA 4M56A 3WD4A 4J3WA 3BLPX 4W89A 2UY2A 1BLIA 5D9NA 2PBOA 3CO4A 1J9YA 1JZ4A 2XM1A 2VZVA 1M01A 1WZAA 1HKMA 1D7FA 2YIHA 3SCQA 3WF3A 3VPLA 1GPFA 1OJPA 4HZ7A 5DFAA 1XD1A 1KXVA 2VTFA 1EHAA 2BV9A 3J7HA 2G8ZA 2EXOA 5A6MA 2A3AA 2CITA 3EMZA 2IXUA 2YDRA 4EAMA 3CZGA 4AD5A 3CMJA 1W3HA 2JE8A 2Y5EA 3I3DA 5E6YA 3ZSSA 1G1YA 4HA3A 5A6SA 4LPCA 1I1XA 4W85A 4MADA 1E71M 5E9AA 2XUCA 4DM1A 1BGGA 2WVTA 2NT0A 4FF5A 5JBDA 2YLAA 1Q6CA 3WQ8A 4U3AA 2NW0A 4D6CA 2D0GA 1WPCA 1BG9A 1KXTA 4H7VA 1E5JA 3WBAA 1UD5A 1DWAM 2V38A 4UQAA 1GZJA 3F4VA 1XGZA 3F5JA 3RM9A 4EK7A 5HXMA 3PHAA 4CD4A 3WBEA 1CXIA 3BMVA 3MS8A 3SUSA 2ZWYA 1UYQA 2WDAA 2FGLA 1NQ6A 1UD2A 2EO7A 1KB3A 1ZBVA 1RPKA 1UA7A 3WQ5A 3UETA 4OBRA 2WAGA 2CERA 2WVSA 4U5KA 3MMWA 3GM8A 3SCNA 5A8PA 1ITXA 6TAAA 3U57A 1SYTA 1NOWA 2DT0A 2D23A 1HIZA 1KQYA 3MSDA 5HPCA 4HZ6A 4LX4A 3AIVA 4UFLA 2D3NA 2O9RA 5EB8A 1KR0A 5AY7A 1GOKA 2FHFA 4K68A 2PF0A 3WD2A 2E8ZA 3SCVA 1MW0A 2D22A 3WH8A 1PIGA 3POCA 2BFGA 4ZXLA 1SMDA 4QAWA 1DP0A 1MXGA 1RP9A 2YDQA 4WLCA 3ARSA 1UZ4A 2ZE0A 4P8XA 1OJNA 2UY3A 2GJXB 1E6PA 5CZKA 3VO0A 1DHKA 2YOCA 4UQ9A 1J0JA 5BXRA 2E4TA 1NH6A 2WW5A 5I5RA 3MUY1 4U31A 5LYRA 1Q6GA 1CGWA 2XFFA 1JG9A 1JDAA 1E4IA 4RE4A 1TCMA 1E15A 5I23A 2O9OA 1CIUA 3NJ3A 3ZT5A 2J8GA 2WMKA 2DEPA 1RWAA 4CD5A 4J3TA 1LG1A 3MUZ1 2TAAA 3VX1A 3PZUA 5A8NA 1XCXA 4EANA 2WC7A 3OA5A 4PMDA 2G41A 3WN6A 4AD3A 1VRXA 1LOHA 1YQ2A 3AXIA 3NIYA 4HTYA 2D20A 3N13A 1H0IA 1N7NA 3GBDA 4AZ6A 3AFBA 4AZIA 3ZJ6A 2VCBA 2XM2A 3CUGA 1ISWA 1UKTA 1S46A 4MDPA 1A47A 4U5IA 2J79A 1V08A 4AW7A 1W9PA 5DEZA 4PTMA 1V3HA 1VBRA 4MB5A 4GI8A 3MMDA 1GORA 3T0AA 3W0KA 4J3VA 3QOMA 3N9KA 5ABFA 4AZCB 4OOZA 1HJXA 5BWFA 1JIBA 2BY0A 4CCEA 1C82A 2CBIA 2WHKA 1HMWA 2Y8VA 3AI0A 1NWSA 3RJXA 4J3SA 2VMFA 5A6KA 2GVYA 1CENA 2VC9A 3WUBA 1H0GA 4W88A 2DSWA 2J7CA 3WQWA 3AHYA 2WSKA 4C7DA 2YKKA 1LXKA 2ZX9A 3L4VA 4F79A 4ML4A 2F8QA 2EPKX 3RCNA 3N15A 4AMCA 3O2LA 4S3KA 2OWWA 1HT6A 3S2CA 4HOWA 1YHTA 2ZXAA 3VDCA 1VEMA 4EE9A 2DSKA 4QLJA 1K9FA 3CMGA 2AAAA 1XD0A 2Q8XA 2CNCA 2ZUNA 3CBWA 1HKIA 2CEQA 5ABGA 1QPKA 1JYNA 1FOBA 2C0HA 4F8XA 5IFTA 1QOXA 3L4UA 1PX4A 3SCUA 1MW1A 2FGZA 2E22A 1CTNA 1LJYA 2J4GA 3WQ6A 3BCFA 2OSWA 2E9LA 1HL8A 3WEZA 3VGHA 1IV8A 2WBKA 2EJ1A 1VIWA 4HOXA 2CESA 3WNOA 1Q4NX 3ARTA 3M46A 3NDYA 4WSKA 2YL8A 4Z2KA 6CGTA 3N04A 3IJ7A 2OSXA 1UA3A 5A69A 4U2ZA 4F9DA 1H41A 4CVUA 2ZUVA 3VD5A 2A3HA 3VVGA 4XX6A 1GJUA 2VZOA 2VQTA 1PIFA 4MB1A 1MQQA 4JKLA 3VIIA 3DHUA 1C8XA 4UR9A 1C91A 3RM8A 5HNNA 1W9BM 1BHGA 1GCYA 1BG4A 5BCAA 3VILA 4CU7A 5CGTA 1GOIA 3BAYA 5I2UA 1C7SA 1FP9A 1D3CA 5BXTA 1NOUA 3W81A 2J62A 3CH9A 1MW3A 3I3EA 2WM0A 3VTRA 5C71A 1Q6FA 2WCAA 5A8MA 3B9DA 4OUEA 3BAIA 1W3LA 2VRKA 1HXJA 2VR4A 1V0MA 4AD2A 1QW8A 2HVMA 1HX0A 3WEMA 2YBUA 2J7DA 4QFUA 3WDPP 4GKLA 2XVGA 4KH2A 3VMPA 4IISA 3WMCA 3TONA 4IPNB 4PTWA 1AMYA 1DWJM 3WD1A 3M07A 5BXSA 4L4PA 1E0WA 5I78A 2UY4A 4BQ2A 1QVBA 1WE5A 4W93A 2W91A 1TFVA 1E6ZA 3VIOA 3CUFA 3L4YA 3ARVA 4NI3A 5A1AA 2VRQA 3B8SA 2D2OA 2BY1A 5A95A 1E3ZA 2D24A 1N7OA 1DTUA 1WDPA 2J7HA 3TTSA 3AIEA 2VVSA 1U30A 4ZXOA 3SURA 1UQZA 1OD0A 2UY5A 2VX5A 4C7FA 3WELA 1W1PA 1JGIA 3U7VA 3WF1A 4B16A 2X03A 1FFRA 2EPMX 2J25A 3BAWA 5EBAA 5E09A 2QV4A 1J0IA 7TAAA 4MNMA 1B3ZA 3THDA 1B90A 4HA4A 1E56A 1TUXA 3U5YA 3A6OA 4WF7A 3FXYA 4N42A 3GNOA 4M1RA 1UH3A 2EQDA 3VMOA 3AMGA 1JZ3A 1SFSA 2J78A 2GJRA 4AD0A 1OM0A 1C90A 5JIWA 1V6VA 2ZICA 1XCWA 5AYIA 2BVYA 5D4YA 4BA0A 1OGGA 4DWSD 2XPKA 3B9EA 3OZOA 3L2MA 5DO8A 3VIFA 3OG2A 5CPSA 4NSBA 3UG4A 4GO8A 1W3YA 1XSKA 3FHQA 5FIPA 5BRPA 4J3UA 5JBEA 3UCQA 1B30A 2A3CA 4TX8A 1UKPA 3CUIA 3A4XA 2VX6A 3HJEA 1KWGA 3TTYA 4CN6A 4P8WA 2XTKA 3BAKA 2DT3A 1FHLA 3QHOA 1ISVA 2WBGA 3VDHA 5M3WA 2AOSA 3LMYA 1PX3A 1J01A 1ODUA 4URIA 1BYAA 1ZBCA 4WJXA 3KZSA 5C70A 3N17A 4QCEA 3N1AA 2XVPA 3WKZA 1JI1A 3CHEA 4AZBA 1GQLA 3IJ8A 2WZIA 3DC0A 3GNRA 3WUFA 1KGXA 1GONA 2ZUTA 2GJPA 1PEZA 1WDQA 4MNKA 1R85A 1FA2A 2YA0A 1Q6EA 3ARYA 5BYWA 1KQZA 1UWUA 1WDRA 1CB8A 4S3JA 4W8LA 3MU7A 1JXKA 3RO8A 1UZ1A 4DUVA 3NSNA 1L0PA 5KZ6A 3W4RA 3AOFA 1CLXA 1NWUA 3VIMA 4M24A 1WP6A 1MWOA 2E9MA 1LF1A 2ZUMA 3WDIA 4W86A 3IK2A 2GK1A 4D71A 4GQQA 4YHEA 1E6RA 3AIRA 4R5EA 3VX0A 4E2OA 2VVNA 4UZUA 2WMHA 3MANA 3WUEA 1I1WA 2YJQA 4YPJA 1QNPA 3GDBA 4FLOA 1GJWA 5FCZA 2VZTA 4JHZA 1EQCA 4CD7A 1H09A 4MNLA 3WMBA 4MDOA 2CCRA 5HPOA 4B3LA 3AS1A 5FKYA 1W3KA 3AHTA 1N7PA 3SEPA 4P8UA 3OLIA 4L4OA 5M03A 2WWCA 1E1EA 1K9EA 2OSYA 3BC9A 5IHRA 4LYRA 1QW9A 1FP8A 3SUWA 3VD3A 2NT1A 5EFDA 3K8KA 4P7NA 1QHZA 5GNYA 1B31A 2E0PA 1OIMA 1UKQA 2YA2A 3VKKA 3AXXA 2GUYA 4V28A 2JFEX 2J8FA 1OT1A 4H04A 1UG6A 1M04A 1GHSA 3NSMA 4R27A 3AIUA 4Z2JA 4BQ3A 2O92A 4UFIA 4CD8A 2ZXQA 4CN4A 1V0LA 3VOCA 3MV11 4GI9A 1SMAA 1XYFA 3UG3A 3II1A 4J7RA 1LXMA 3W82A 5I79A 3KE0A 2PBGA 1DEDA 3WNKA 1JF6A 1UR9A 3HN3A 3WD3A 4IM4A 5A3HA 3TTOA 2BRWA 1HJQA 4ATDA 2YLLA 2Y24A 2XHYA 1CDGA 4KGLA 4HU0A 3ARWA 1FFQA 1Z32X 3VDAA 3ZSTA 1HM2A 1C8QA 2PWFA 3L2LA 3SCSA 3MSGA 1N7QA 1OBAA 3UG5A 4IUGA 3PZQA 4BF7A 1ZL1A 1E6SM 2X05A 3PZTA 1MFVA 2CETA 4TVCA 3IANA 2VL4A 5D8ZA 5CLWA 1WB0A 2W66A 2WC3A 3KL5A 1C93A 4PMRA 1BAGA 5LA0A 1JDDA 2FH8A 1QNSA 3GH7A 4D6DA 3MKKA 1B9ZA 1TA3A 1VEPA 2VR5A 4MJ2A 3UR7A 4AC1X 1GHRA 4UQEA 1PZ2A 2XVKA 4TXEA 2WMGA 4JFWA 4AEFA 2GK1B 4PMVA 4OOUA 1V3JA 1ZJAA 4ACZB 4GZEA 3A4WA 3ARRA 1BSIA 1MXDA 2EPLX 4ZE5A 4UQDA 5E0FA 2VX7A 1EO7A 2F61A 3A3HA 4PUDA 4DWSB 4KRTA 3AS3A 2VOTA 1JNEA 1RP8A 2PC8A 2ZOXA 5KEZA 1VJZA 4PMOA 4UCFA 5JUVA 4TVUA 3SCPA 1US2A 5HBFA 4RE2A 1V3IA 3CZLA 1X1IA 2E8YA 1OJOA 4CD6A 3FAWA 2DQXA 5CSYA 1LG2A 1X6NA 2CHNA 3QHMA 3JUGA 3DYOA 4Q22A 1CGXA 1TE1A 4WSJA 1WO2A 1EIBA 5FL1A 1V3LA 4NRRA 1UD6A 3WY1A 2V3DA 3F5KA 4F66A 1V0KA 3SIMA 1W91A 1JAEA 4GZIA 3FN9A 3DYMA 4UFHA 1UOKA 2V5CA 4UQBA 3RMEA 2Y8KA 9CGTA 4JKKA 4KGJA 2D0HA 1WKYA 3UESA 2W4XA 1E4NA 3K46A 3ALFA 3RJYA 3WEOA 4MAZA 2W61A 4AIOA 1HMUA 1EGZA 1M7XA 3W24A 1QNQA 1J18A 2NSXA 1OCQA 2ZUWA 4XZWA 5M5DA 2D3LA 2ZX5A 3T08A 1HVXA 2RGMA 4MB3A 5A6AA 3O9NA 1KFWA 2ZX6A 1ODZA 1R86A 5ABEA 1V03A 4QLKA 4P7LA 2BY2A 3AQUA 4M29A 2DSUA 5E0CA 4HMDA 1PZ3A
chains in the Genus database with same CATH superfamily
4H9MA 2DSVA 1XLGA 3EWDA 5I3DA 1IIHA 3UXAA 2PWDA 1X1HA 2YFNA 1PWLA 2QJNA 5K4ZA 1JZ7A 1XM3A 3AYVA 4S39A 4QE5A 3ABQA 3TSMA 2HDJA 3IJ6A 2V5KA 1R87A 3S9ZA 5LA1A 3DCPA 2YFOA 1VAHA 4JFVA 1CPUA 2PDHA 3ZMRA 2C0AA 3DFPA 3B8TA 2QDHA 4JY9A 2NLIA 3R4IA 1KBBA 3ZT6A 4DWSA 3UWYA 1QRQA 2ESCA 3UCDA 1AFSA 4B5VA 1VF8A 3TN6A 1JI2A 3SZ8A 2ABBA 4O1FA 3H2AA 1NF0A 3O7UA 3S4TA 3NVTA 4A3HA 1O7AA 4XZMX 1XUZA 3KDNA 5CPNA 4DX3A 4PRWA 3ZM8A 3NGFA 4E2VA 4YYFA 1X1JA 1EJSC 1WCGA 1GYMA 4C6CA 1TVNA 4EWND 3LUTA 3KOYA 2OODA 5IOBA 4S23A 3CQJA 4D6JA 3S1XA 1GPWA 4WDXA 1KGUA 3UD2A 2BHZA 2GQ9A 1XIJA 4KWUA 3NL6A 2ZX8A 1MVYA 3ZIZA 3OA3A 2QIWA 4N4QA 1XLKA 3DDMA 4DZIA 1DJXA 2EJAA 4L1GA 5TD4A 5K9DA 1UKSA 2CW6A 1CNVA 5CGMA 2PB1A 4NZ4A 1YW1A 2WMFA 3IUHA 3L4XA 3OLEA 4RDZA 3VKAA 1TZ7A 3QZ6A 3A5VA 4OFCA 1W5OA 2REQB 4DVOA 1UD8A 1Q6LA 4NQ1A 4TX6A 2DW6A 2JK2A 3UY7A 3W29A 2PI6A 1XYZA 3NURA 1ME8A 1FWTA 1UH4A 4JL1A 2Z1SA 4GD0A 2I57A 4GRSA 5BMXA 3VGDA 4Z2HA 3DYPA 5AFDA 2X1IA 4PEKA 3W2LA 5M17A 3TFXA 3LCHA 5G2HA 3SQSA 4XD5A 2WNWA 2VEGA 4NZJA 3ZR6A 2IPJA 3E2SA 2QPUA 4B91A 1J0ZA 3ZO9A 1LL6A 4H9ZA 3GXDA 4A3QA 2C1HA 1LQ2A 5LA2A 3RITA 1WYIA 3H54A 4DPPA 3ZXWA 4L9YA 1NP0A 4BF5A 1EHNA 4Q8PA 3VOHA 4F2BA 2ZTKA 4GUJA 3NQAA 3KVLA 3G22A 2PMQA 3ALGA 1QI5A 4DUXA 3W7KA 1TYGA 4AXKA 4IHCA 2BRPA 1X6LA 4PB5A 1EZWA 1A5OC 1E43A 4HT3A 1BYDA 3L68A 2W92A 4IJRA 3R58A 4FAMA 2WWDA 4FI4A 1IWPA 4D8OA 2DT2A 2WSRA 3PZ9A 5C2GA 5DX7A 5EMYA 1TMQA 1KBKA 4JNZA 1LORA 1WDDA 2DZTA 3CHDA 1JZ8A 3ZWSA 3M5XA 1RPXA 3HURA 2RDWA 4NRSA 3UZZA 3EOUA 1A53A 2R14A 4L5ZA 4S3FA 4LGXA 4ADTA 2BVDA 4INFA 4GZJA 3UPBA 1G4EA 1A4LA 1XLEA 3BAXA 3S5YA 1TJ2A 5LNUA 4XAZA 2GUUA 2QKFA 2OO6A 4Y9PA 4FNPA 1OX5A 1TV5A 3WF2A 5FEPA 2VFGA 1FXPA 3GXIA 4H9XA 2QCMA 5FJUA 2X30A 1U5JA 4FNQA 3DU0A 1BEUA 1GT8A 2Y70A 3QW4B 3TAOA 3QBUA 2OKTA 4H6RA 2RH9A 3UPMA 1TG7A 4WXYA 4NJJA 1ELSA 3HGJA 4GUGA 1E4LA 3EOSA 4X0NA 2YB1A 3HO8A 2YYTA 3LPGA 3MI2A 1XIDA 3AMKA 1WUEA 2QHAA 2DVUA 3AYRA 3GXPA 4JTQA 5E1QA 3HG5A 3WCZA 3VI2A 1O12A 4IZGA 3WLJA 4HVXA 2X7VA 3DKLA 3UCCA 3UEQA 5JH2A 1FWFC 5BNKA 1VRDA 4KWWA 3EBVA 1K8CA 4V1XA 4E38A 3EDKA 1SU5A 5BRBA 4LFYA 3WFAA 1RAKA 3N2TA 1JFXA 3VU2A 4TOQA 1L6FA 3W7MA 1J0NA 1XPGA 1M7PA 1TPVA 4H4IA 2PPGA 2FDMA 3KOFA 3BARA 3GNXA 4DIAA 4Z17A 4BKNA 3OIXA 5BOFA 3GYCA 4J1OA 4US5D 3C5QA 4UTMA 1BXCA 3SUVA 1GQIA 1OC6A 4CCDA 3S2LA 3W87A 2WZMA 4A05A 1E72M 4MSSA 4RDYA 1V02E 2VEIA 4I7WA 2FKPA 4ICNA 1B3WA 1QNVA 2Q3RA 4KWOA 2ZQ0A 1DJHA 1WXYA 2ZZ2A 4EF8A 3DN5A 3M0KA 1UR0A 2W6RA 3JRKA 5F1VA 2WYSA 5AYBA 5F7UA 3WBXA 1FY6A 3T81A 1EZ2A 2POTA 3UYIA 3F03K 3GR4A 3WDQA 3EAUA 4C1NA 1WAWA 5CCZA 1Q6DA 1LOLA 3VIKA 2PRHA 2YCLB 2NXGA 4NZCA 2PGRA 1VYPX 2B7NA 1PPIA 1KLZA 1AD4A 3LPOA 3IVTA 4RCXA 3FYPA 4PEEA 5KTLA 3VDBA 3D3AA 4GX8A 1ZS2A 3FJ4A 3RIKA 2Z1BA 3AZRA 1WQ5A 1JAKA 5G4HC 4DZ5A 4GY7A 5CG0A 1ZALA 3MKCA 1V93A 4XIAA 1G4SA 3GVVA 1ZAIA 4ZMGA 4XZNX 4JIQA 4D6HA 3CUXA 1DORA 3VZYA 3RM4A 2OYMA 3CHCA 2HE8A 1GZGA 4ORIA 5A6JA 1SJBA 4MTVA 3NQ2A 4A8NA 2WPGA 4GIEA 1OD8A 2O0TA 4LVFA 2VRJA 2OQLA 2GUBA 2J7EA 3A13A 4KRUA 4PCFA 4L6HA 3RN6A 4L80A 4A2SA 2QCCA 5KZDA 1DWFM 3P0XA 1UD4A 2D2GA 3IJLA 4NJIA 4L1WA 3O6DA 1KR1A 4GVGA 3LCIA 3TWBA 5K9CA 3CUHA 4O12A 1OGBA 3ARXA 4HMEA 3W71A 5C9RA 2ZC1A 3WENA 4AY7A 3ARQA 2VCCA 3WL0A 1ICQA 4Z2IA 3NTYA 4HSHA 3N18A 3SRDA 1UUOA 4B90A 3AO0A 3SGGA 2VO5A 1QI3A 2AKZA 1HJUA 3HFYA 3BUVA 4W8AA 1HL2A 5CLTA 4OTKA 3QR1A 1J11A 1LP6A 1F3WA 4JN6A 1BTMA 3W37A 4XB3A 1UW9A 2PD9A 3I65A 1Q8AA 1ECQA 4DQWA 4PN2A 1WDSA 4TIMA 1JUEA 5DBUA 5DRIA 1XLMA 2D73A 1OK6A 1VFUA 3T0BA 3B9OA 3W84A 3W1XA 1GUVA 2WHMA 1T40A 4GINA 5D30A 5ABFB 2P3EA 5A8QA 5LIYX 5AHLA 6REQA 4AISA 3G6MA 1V02A 2AL2A 2VGGA 1IXOA 1XV8A 4Y7EA 7A3HA 1LLWA 1T0OA 4AEOA 1FKXA 1KTBA 4I6KA 4IFRA 2HRWA 4OBSA 3CEPA 1MUCA 2GDVA 2A3EA 3O05A 4LCSA 1YDOA 2DV0A 2FJUB 3FJLA 3A12A 1K9TA 1XLHA 1HG3A 1G9HA 2DZUA 5A6BA 4N9EA 4O18A 4GIYA 3OZMA 5I02A 2E7FA 3CPUA 1EUNA 4Y96A 2R91A 4FA3A 3V36A 2X8RA 3GRIA 3OEXA 1JCNA 3PBGA 3ZQ9A 2VEPA 1QI4A 4Q4KA 3TN3A 3MDUA 4R34A 1KD0A 4OZOA 3L12A 2EBNA 3SDOA 3RDKA 3VAVA 4GFSA 2W67A 4RL3A 3OBKA 2PLJA 1JQXA 2WMIA 1PTDA 1ICPA 3K8MA 1CGTA 4U33A 3UVIA 4DF2A 3C61A 2C6QA 1ZGDA 1XKJA 2MNRA 4YHGA 5IHSA 3V5OA 3C52A 4F3HA 2RDXA 1TR1A 3TYBA 2HISA 4GVHA 2A1YA 1LUCA 3CEUA 3NXLA 5AC4A 2HJPA 8XIMA 3WIJA 4Q8WA 3PTKA 3WMSA 2EG8A 2DQWA 1HO1A 1K8ZA 3EOEA 3DHDA 3U4FA 2Z1KA 1CZ1A 6PTDA 1VFSA 3IUDA 1Z44A 4MKSA 1UIPA 1CT5A 1NWRA 1V3MA 2QMKA 1NWTA 1R9YA 4NAFB 3L23A 1OADA 4L6DA 3UWQA 3RYSA 3E0LA 4PULA 2JBMA 5AHIA 4F40A 3M7SA 4HPHA 4GQGA 4C6LA 2DZAA 3PY2A 1PTGA 5HDRA 4QIUA 2ALRA 1XLJA 4PSRA 2WCGA 4JQ4A 1FXQA 1M5WA 4UFKA 2Z1WA 5CXPA 2C71A 4E2DA 2UWFA 1M6JA 3BQ6A 5EL1A 2YXXA 2PP3A 4N9CA 3TSDA 4LCRA 3VOFA 4RXGA 3FA3A 4GYPC 3IIZA 2CXGA 4L64A 1YPXA 1OEPA 4I5UA 3UJSA 1QAPA 3LENA 2ADAA 4DI9A 4JR5A 1ZCCA 4AIBA 4D6GA 1XH2A 1J79A 1B3OA 1W5NA 4QJ5B 1XH0A 3AUJA 4PMYA 4LRTA 3OQ8A 1B0IA 3WNNA 4YTRA 4LVAA 3FA4A 4GA8A 1RBAA 4DLQA 1BWLA 3EOOA 1WDWA 1L2QA 4AQLA 3DGRA 3M0MA 3PFMA 3UR8A 4LXFA 3QVQA 3V4BA 1UMLA 4C1LA 4FXRA 3EWXA 3LK6A 1FH9A 4GNJA 2AAMA 1OCNA 4GACA 4NJHA 3UD1A 3APGA 1NDZA 4PMNA 2BLEA 1VPYA 3OZPA 3WNPA 2J74A 1XFBA 4GQRA 3UT0A 1FCVA 2EPHA 2CBVA 1VBGA 4MHBA 3TH6A 3FAXA 1BQCA 2RGLA 4I5XA 1JD7A 4M8UA 1EJWC 1RJRA 1AJ2A 3JW7A 1C7TA 3WQGA 1J0HA 3G1DA 1IF2A 2HTMA 1P0KA 2G3JA 2F2HA 2ZBTA 3ZT7A 1R3VA 4YIWA 4M80A 4J28A 3UR5A 1Q65A 4S2CA 2PDKA 4GPNA 3TMLA 3CM4A 2WVVB 2GGIA 1XXXA 3VKBA 3VIJA 4CQ9A 1ECEA 1ZBWA 1XC6A 2I14A 1NOFA 4GY1A 1AH3A 3LI1A 2DVTA 4AC7C 2GJLA 3WNLA 1S38A 3ISIX 3RLHA 2Y85A 1VHNA 3O6AA 1KXHA 5C8BB 5CSUA 3QV7A 1NQKA 1KFBA 2OYKA 3UWVA 2CLFA 1QBBA 4ONVA 3IT6B 1PVNA 2X0SA 3TP4A 1MQPA 4R53A 2WLZA 3VKCA 4FLQA 1DYSA 2C1GA 1VPQA 2CBUA 4JL2A 3GNDA 3AMLA 1B3YA 2QDDA 4JX6A 1OFRA 2OCZA 4QSFA 4QBXA 4GXPA 3R0DA 4EPKA 1NY1A 1T6MA 4AUBA 2TODA 5B7YA 1DIDA 3NEHA 4K8HA 1M1BA 4AWEA 2PWGA 1BVWA 1D2KA 3ZLHA 5IDZA 4KFOA 3BMXA 3OODA 2BXZA 2PDMA 4GO9A 3LGGA 2MANA 3BLPX 4ZR8A 1XBYA 2UY2A 1AW1A 2CLIA 2FQIA 2WJDA 4I5RA 1J9YA 1XPYA 1UOZA 1D7FA 3WZ0E 4POCA 3H7UA 2O56A 3URNA 1YE6A 1OJPA 1XD1A 1KFEA 5HINA 2BV9A 1ADOA 2DUZA 5A6MA 3EMZA 1Z3NA 1A5CA 5AVNA 3CZGA 1FRBA 4PZVA 4MUZA 2X1RA 2E6FA 3CMJA 2VD8A 3ZSSA 4WR3A 5XIAA 3DZ1A 3EEZA 4JTIA 4O14A 3STCA 4HNTA 4H83A 1E71M 2QUTA 2AQOA 1BGGA 2WVTA 5KZMA 2NT0A 4FF5A 5JBDA 1A0CA 1DE6A 2YLAA 1Q6CA 1YE4A 1XQLA 4O0ZA 1CI1A 4U3AA 1WPCA 4H19A 1XYLA 5LNRA 3SN4A 3WBAA 3W00A 4IFKB 1XGZA 5LHFA 3Q2DA 5G2WA 5HXMA 4FX6M 3PR2A 3BICA 5MF5A 3WX7A 1XLBA 2X2GA 3DFQA 3C6CA 2EO7A 1ZBVA 1A4MA 3UETA 4ZCWA 1EF2A 3KBTC 3GM8A 4C6BA 2DT0A 1FKWA 1TSIA 1KQYA 2XH4A 3N2CA 4FEZA 2O9RA 2A7RA 4K68A 2WSYA 3UXDA 2P76A 3SCVA 3W02A 4BHYA 3FDKA 3WMLA 4JNMA 5K2ZA 2D22A 3WH8A 1WKDA 3WJYA 1SMDA 3O0FA 4HIBA 4ADUA 5RUBA 2ZE0A 5EMUA 3QZEA 4N2YA 4C1NB 2PTWA 2YOCA 5BXRA 4DWDA 1J0JA 1MDLA 6XIAA 1LT7A 3AXKA 4DJFD 4KF1A 5I5RA 4ZQNA 1JG9A 1E15A 2Z28A 4FIRA 1CIUA 1T7LA 1UPPA 3K30A 3MPGA 2WMKA 3W1AA 2ISSA 3PPHA 1JCXA 3W7JA 1LG1A 3QM3A 1PS9A 3ONBA 4DN1A 3ITLA 5A8NA 1XCXA 1TX0A 4EANA 2WC7A 4DO6A 1I8JA 4KCTA 1X97A 3TNBA 4AD3A 1LOHA 2CZ5A 1YQ2A 1EFZA 2E5BA 3NL3A 2H6RA 1YPIA 4LC6A 2L5HA 1N7NA 4DJFA 3GBDA 3AFBA 4AZIA 2XM2A 3HA1A 3CUGA 1S46A 4MDPA 1A47A 3NQBA 4QAIA 3XIMA 2ZADA 4MYXA 1XP3A 5AHEA 1HKVA 4L6OA 1O95A 3UGVA 1V79A 1PKMA 1EWEA 2YGYA 4J3VA 3W0KA 1EYWA 4GUIA 2YXOA 1JIBA 5I3KA 2WHKA 2Z2UA 4K37A 2PLMA 4FXFA 3BG9A 2VMFA 2OO0A 4NZ5A 5AC8A 4J5NA 4D9PA 3ONCA 1MRQA 3RG6A 2CLLA 2J7CA 1DJQA 5FI8A 5G5IA 2QJJA 2YKKA 1LXKA 5KSWA 1K8XA 1PYFA 4F79A 5HA7A 4O4VA 2ACRA 3N15A 4S3KA 3LD5A 1HT6A 3S2CA 4Z1AA 1O5QA 1YHTA 2RKXA 2ZXAA 1VEMA 5F2LA 3V0SA 2QQ6A 2VXNA 4QLJA 4Y9MA 2PD5A 3R94A 3LHWA 1XD0A 2IQDA 3CBWA 1HKIA 1QPKA 1JYNA 3DX5A 1XDJA 1QOXA 3LLDA 1PX4A 5BOOA 1CTNA 3MVTA 1C29A 1LJYA 4DO7A 3MCMA 2E9LA 4HQVA 3W1TA 5J5RA 1TQXA 4MGGA 1BKSA 3TYAA 1VIWA 2QZRA 4AWUA 2CESA 2YSWA 3WNOA 4LW7A 4L9XA 3ARTA 3NDYA 2HMCA 1OFQA 2FFCA 2YL8A 3N14A 6CGTA 3H7RA 3IJ7A 4IT1A 5A69A 5DANA 4RPQA 2ZUVA 4XX6A 3GTXA 1IZCA 4B5UA 3N2OA 4LAOA 1FCUA 1MQQA 4JKLA 2BSLA 2I16A 1C91A 2R82A 4HHPA 4GH1A 3UD6A 1MSSA 4A2RA 4IL2A 3ZVHB 2G50A 3AWNA 5CGTA 3BAYA 2EG7A 4AHPA 1FP9A 3PB2A 4LYKA 4UC5A 4MKVA 2VC5A 3STEA 1EB3A 5C71A 3ITGA 2FIQA 3TR9A 1J96A 3WQOA 4IPPA 3UWZA 1JPIA 3H7VA 1Q4WA 2VR4A 4AH7A 1A0DA 3TROA 1A5NC 3MZ2A 4EIVA 1ZENA 2J7DA 4QFUA 1N8WA 3P60A 4UB9A 4ADSA 1R0MA 4IISA 4NNBA 3WK0A 3BV4A 3WMCA 4C6MA 4LAZA 3CB8A 1AMYA 2PWVA 2EAWA 2AL1A 3H53A 1DIOA 5BXSA 2UY4A 1LUCB 1QVBA 2PLKA 3AWOA 1WE5A 4QDWA 1H7NA 2XFWA 4B2DD 1HQTA 3BLIA 1QWKA 1P43A 5A95A 1DTUA 4H6EA 1J93A 4MMWA 2B7PA 1EA0A 5D2YA 4IMDA 4ZXOA 4WX2A 3SURA 2UY5A 3TJIA 1O68A 4BI7A 3O06A 5G1YA 1JGIA 3LCXA 1TJPA 3PG9A 2TSYA 1R3YA 3L66A 4RZ6A 2J25A 1Y65A 3PBYA 3HV9A 4C65A 4KKXA 3THDA 3DHFA 4ZZ9A 3FJNA 1TUXA 1XYCA 3GAKA 3O8AA 3C56A 1EC9A 3RHGA 4B2DA 3WJXA 3DIPA 2EQDA 2PWUA 3BW3A 1W3NA 5I3IA 3EB4A 4NHVA 2AGTA 5JIWA 4XZIA 1XCWA 2ZZ5A 4BA0A 3PUEA 2PDXA 3B9EA 1ENUA 1GVOA 3OZOA 5DO8A 3VC6A 3OG2A 5CPSA 1EBGA 3H4XA 4FSAA 1R47A 3ABSA 1LQAA 2OU4A 4WDWA 1FVPA 5J04A 4Z0SA 1BXNA 3SBFA 5TQLA 3N2MA 4TX8A 3CUIA 3A4XA 5CKSA 2JGYA 5DMLA 3QFEA 3N73A 2XZ9A 4HCLA 1ISVA 1TPEA 4DZAA 3AUOA 4Q4SA 4ZO9A 4UBPC 1S3TC 3LMYA 1IEVA 2PDYA 1ODUA 3BANA 1BYAA 2EG6A 4E2BA 3N17A 2V63A 4UMCA 4YNGA 4MWAA 1W31A 2C14A 4ILSA 3IJ8A 5AC6A 5CAKA 3WUFA 3AU6A 2IPGA 5HUOA 2GJPA 1PEZA 4ZOBA 4XG1A 3GVQA 3QQ1A 3GG7A 3LY0A 4IX2A 3C2VA 2FVKA 1WDRA 4S3JA 3MU7A 2V30A 3IIVA 1XIGA 3NO3A 1PKNA 3NSNA 1U5HA 3QV8A 1NWUA 1K03A 2CLEA 2Y1HA 1LF1A 1XCFA 3WQFA 1ZTVA 4W86A 3GVWA 3IK2A 4D71A 4YHEA 1Q6OA 4S3BA 2ZZ3A 2HV5A 4I9AA 3DG3A 4R5EA 2XN1A 4OE7A 4E2OA 2JKPA 3LSBA 3MANA 4GIRA 4XK2A 4EVZA 5CJMA 2QAPA 3V16A 4YPJA 5JQ9A 1KM5A 3EA1A 3WLNA 5ABTA 3GIQA 3GDBA 4FLOA 2Z00A 4JHZA 3Q65A 2ZDSA 4Z42C 4WY0B 4CD7A 4MNLA 4MDOA 2CCRA 2WQPA 3YPIA 3CQIA 3BURA 5E9XA 4V15A 1GVRA 2OZ0A 1HGYA 1R9ZA 4CNTA 4HNUA 3G3MA 1QPQA 1UC4A 5CC7A 4J40A 3CQHA 1E1EA 1OYAA 3BC9A 3LRKA 1TIWA 3A22A 1FP8A 4EXAA 1P1MA 1QHZA 2V9DA 2C19A 3NQDA 1QCWA 3JZEA 1EGMA 3NWRA 1B31A 9RUBA 1FWDC 1FDZA 3HF3A 3VABA 1VRAB 2YA2A 4FXSA 3VKKA 3NZ1A 3LOTA 4V28A 2ZE3A 3CNYA 2XIJA 2J8FA 4PUKA 2WNZA 3G5EA 5FF7A 3URQA 3KLKA 3NSMA 4R27A 4UFIA 3MV11 1IHIA 1XUUA 4XKYB 1ZSXA 4J7RA 1TZZA 1EX1A 4H9UA 1LXMA 3PBMA 4IGMA 1L6GA 4YTQA 3WNKA 1XRTA 1UR9A 3HN3A 3WD3A 2H3BA 4UNKA 1YX1A 3VOIA 3F7JA 2Y24A 2XHYA 3T6CA 4GC3A 4IICA 3W6YA 3ZSTA 1ZHAA 2HXTA 3GB6A 1X38A 1ZZMA 4PODA 1VP5A 2VEFA 1Z69A 3UG5A 2NXHA 3P67A 1VCGA 1ZL1A 1X39A 3AAMA 3PZTA 3OHMB 5FSDC 4IH3A 3OJGA 3KL5A 5LA0A 1BAGA 4WGXA 1JDDA 3GH7A 4RV8A 1B9ZA 2PODA 1F6PA 1CX9A 1GHRA 4UQEA 2ICSA 4DJFC 2XVKA 3T55A 4OUIA 1JPDX 1ZJAA 5HATA 4ACZB 5T26A 3PQIA 4K1GA 1NFPA 1KKOA 3C0LA 4GHRA 4Q4QA 2ZDRA 3I68A 3HPZA 4MLRA 2GSHA 3K13A 5HR7A 3AS3A 4O15A 2VOTA 4PUUA 3H23A 1PDZA 1FWAC 5F4WA 1VJZA 4UCFA 4C6PA 4TVUA 2IQ0A 1RZMA 1US2A 3ANVA 5HBFA 5MKGB 4RE2A 3V0UA 4HN8A 1F05A 1Z89A 3GG0A 2CHNA 3UFYA 3QHMA 2W27A 5C55A 4Q22A 4LALA 2B7QA 2FZ9A 1UJPA 3QMRA 4NRRA 2UBPC 1FDYA 2V3DA 4TV5A 4F66A 4RNFA 1ONEA 4RX0A 3SIMA 2VOMA 4Y6GA 4HJWA 4GZIA 5LXEA 3FN9A 3DYMA 5I07A 1UOKA 2V5CA 1FHVA 3RMEA 1SQ7A 5GJNA 2UV8G 3KDOA 4N6FA 3Q58A 4JKKA 2D0HA 4JTRA 1WKYA 4NI8A 1R6WA 3WEOA 4FO4A 4IIBA 5K7JA 3UNDA 4AIOA 3S9IA 3HTWA 5HANA 3UZYA 3S1UA 4J2MA 3W24A 1MEIA 2QCDB 1Q7ZA 4E8GA 1OCQA 6XIMA 1JGMA 4XZWA 1FWCC 4EPBC 2OQHA 1Q3NA 5M5DA 3KS6A 3T08A 4LF1A 1I45A 1ZNNA 3PNUA 1TJ0A 4MWAD 8RUCA 2RUSA 2PDJA 3PG8A 3IIXA 5CPOA 4O13A 2DSUA 5E0CA 1PZ3A 3CAKA 4O50A 3W6LA 3CUJA 2BXYA 2QPSA 4RKAA 4L65A 5LNWA 3OBAA 1XDMA 3TOPA 4LBRA 2XYLA 3E74A 5H8MA 1CXHA 5EMMA 3ARZA 1FHDA 4H6KA 2ZZ1A 4XD6A 4F2UA 3GR7A 4ATWA 3GVRA 5E93A 5D9MA 1S1PA 1DWIM 1P0EA 3TLLA 4CQ8A 2R24A 5BROA 2WB5A 4YXGA 4A8LA 4Q8VA 1E5NA 3MDWA 3PULA 4JNYA 1D8CA 4HPXA 1REQA 2ZYFA 4UTWC 4GIAA 2CC0A 4UCGA 4MJMA 3WF0A 5TF0A 4ATLA 3D6NA 5A94A 1OX4B 3JU2A 2ATMA 3PM6A 1UZHA 4PB4A 5FJPA 1SJCA 4UOZA 3NSXA 3DEQA 4C6FA 4QJ4B 1FTXA 3G3DA 5AOUA 4LS1A 3NQCA 3B04A 2OFJA 1FWRA 4M0XA 1S2VA 3EKZA 1U1HA 2GGGA 4E5TA 3G6LA 5ECUA 3OB8A 4EKJA 3FLUA 3TLQA 4G7EB 3UPWA 1UASA 1OFEA 3W1LA 2Q02A 2A21A 3M1ZA 4D2JA 3AS0A 3RRXA 4MPQA 3UQNA 3WFLA 1SZGA 1JNDA 1W9XA 4JICA 1CBGA 3PF3A 1P4CA 3HQPA 4NJKA 5HMFA 4ZOAA 3FK4A 4FLSA 3FX4A 1QJWA 2HK1A 4K38A 3R11A 5E5CA 1ALDA 3A4JA 4ZODA 3H70A 3SJNA 4C60A 1YTDA 4GFIA 4XZBA 3QOKA 4ERGA 5AC5A 4AZGA 4JTSA 3LU2A 4QEHA 2XH7A 3P81A 1BXBA 2Q8LA 2Q1FA 1C9WA 3G0UA 5SWUA 1OZMA 2WCSA 2Z6IA 4QM1A 3U5UA 3VZXA 2ACQA 4BS0A 4PMZA 3H21A 4CGTA 1W56A 5I09A 3QN3A 3MO7A 1M9HA 3IPWA 1H5YA 1FX6A 1UBSA 3PTQA 1EO5A 3QR3A 4MB4A 1Z9AA 3W07A 3RMJA 1BVNP 3AIWA 1RY0A 3W7IA 5EA9A 1W1TA 3QC3A 4PRTA 3V18A 1ZJBA 3OVQA 3V1HA 4IIFA 1OG6A 3M41A 3TV8A 4D6IA 4CU8A 5LGXA 3L9CA 4W5UA 5IBXC 2QGYA 1TREA 1OIFA 1I8QA 1R8LA 4A4AA 4JX4A 1M53A 4ASTA 1CXEA 3MSYA 3WG6A 3W38A 2OTDA 1NIUA 4YCPA 1RWFA 2FZ8A 1GYNA 3O3RA 3E0IA 3MZNA 1AA1B 1KTCA 1UR3M 5AHMA 1G7UA 5K4XA 4NAFA 2H90A 3LXCA 2PCEA 1R3WA 1UR8A 1X98A 1E0XA 4XZLX 3B40A 1P6CA 1FWWA 3MUXA 3IIOA 2WVVA 2DVXA 3GVGA 2H8ZA 3RX3A 1PTAA 3CASA 1EIXA 2V3FA 1YXDA 1XSIA 1JZ5A 2XWDA 3A47A 4AX7A 4TUFA 1Y7VA 3T2OA 4RK8A 4P7QA 4WSHA 2V81A 1A5KC 4AAJA 2C1IA 5D05A 1JYWA 3AICA 1OCBA 2J24A 3OVGA 3KOWA 3ZZ1A 2BZNA 1GOMA 1AVAA 1IT8A 4G56A 4LRSA 3OTRA 5JBFA 4G5DA 5AC7A 5DT7A 3ABOA 3I3BA 3O6CA 3E02A 3WQDA 4QDMA 2FDSA 1TV7A 3T0TA 1AQFA 1EC7A 1HN0A 1SVDA 3UJRA 1IE7C 5D37A 4DXXA 3N4FA 3GNPA 4DF0A 4WD0A 4YU1A 2INFA 1KV5A 1EXPA 3R25A 4OJYA 3GZ3A 5AHNA 5HMDA 1JCYA 3WJZA 5LIWX 4IGNA 3MBDA 4S3AA 5REQA 4MAVA 4X60A 4MPKA 3KS5A 3UWWA 1AG1O 3E2QA 1BYBA 1K1DA 1Q63A 4EF9A 3B0PA 1VLWA 4UMAA 3S8HA 1E9LA 3H2MA 1Y5VA 3S6TA 5EFFA 3SSZA 1RHCA 2GSJA 1R3QA 3EX4A 3AS2A 4UMBA 4NYYA 3VNDA 3PBWA 4PSPA 1A5BA 3GU1A 2AQWA 5H8PA 3DFYA 3W88A 1E3XA 2QLYA 2BY3A 1QW7A 1EP2A 4PCSA 1NELA 3KRZA 7ODCA 1N8FA 4C6JA 3FW6A 3BXWA 3TQPA 3LBCA 1SR0A 5EBUA 3TEVA 1GKQA 4DB7A 3WQVA 1W2VA 1HO4A 2ACUA 2QF8A 4Q8OA 3UWUA 1XYAA 2ISWA 3IEBA 3T7VA 3EB3A 1H2JA 4IOTA 3SY8A 3W7QA 3MUIA 2NQ9A 1DL3A 2Y8UA 4AZ5A 4AVOA 3S42A 2HCVA 4FR1A 3S5OA 2VJXA 4ZE4A 3TE9A 4D6EA 3ID7A 4ERIA 3CK5A 1KGWA 4O11A 2BRVX 2I5IA 2HPIA 5FAJA 2YYUA 3G24A 2V5LA 2Y7GA 1AK5A 1JR1A 2PU0A 3EDEA 3P61A 4AG0A 1BTCA 2DPEA 3G1HA 3CAVA 4WQ6A 3B0YA 3HQNA 5CC5A 3MP3A 3PN8A 2VFIA 4DUWA 1DHPA 3PZOA 3MHGA 4IGSA 1W54A 2YCIX 1VLIA 3NA8A 2Z1XA 1KRMA 3KOXA 2WKLA 1M41A 3DI0A 3P14A 1HJVA 5BOEA 1H7XA 3NZPA 4FIQA 4PB3A 4F9JA 4KWSA 4TTUA 4IIEA 1CW2A 2NWSA 3IGSA 2Z2BA 4QS6A 2E3ZA 3P8IA 1XF0A 4M3PA 4KCUA 1GEQA 2V2CA 3QKEA 1J2BA 4L7ZA 3E96A 4K8EA 3DERA 3DBNA 1RVKA 3P82A 1XICA 4ALDA 3K1DA 3U2CA 4JFSA 4GI6A 4HK6A 1MYRA 1VS1A 1EKOA 3GUGA 6TIMA 2X40A 1KTNA 2CHOA 4CQCA 4A3UA 4A3YA 3T09A 2D0FA 3F59A 4WJ8A 2OELA 1X1NA 4O57A 3WUGA 1LQ0A 1R9XA 1TPH1 4JTCA 4HA1A 1GW9A 4NNAA 3TNOA 3OO2A 1KXQA 3W25A 3TKFA 1PE1A 3PJWA 4US5A 2VFFA 3R0UA 2A3BA 1HP4A 1M68A 1TB3A 1D8WA 2BOGX 1LWHA 4QROA 1UPMB 2XSAA 1TMHA 1Q2SA 2PCQA 4ZSUA 1F3TA 1UJQA 2KX9A 1HNYA 3THUA 4H8VA 1OGSA 3VNZA 2YDSA 2WMJA 2PDUA 3CL8A 1V7AA 4NF7A 4ZOEA 3WDJA 3MJYA 4O8AA 2H9AB 4FK9A 3LCWA 2XG9A 2J13A 5XIMA 1QO2A 1ML1A 1H4PA 1TIMA 1CGYA 1O94A 3DHPA 3FVMA 2ZRYA 3G1SA 3CZ8A 2VDGA 4XAPA 5CSSA 4JD4A 4E4PA 4WOQA 1RA0A 1WZLA 2JIWA 1NFBA 5DELA 3GNNA 4TO8A 1W37A 3VFCA 2ASHA 2CU0A 3FNDA 4AHOA 3ITXA 4AYSA 4OIFA 2XN2A 4C6OA 4XAYA 4TVDA 3RLUA 4JDBA 4JCMA 4HPNA 4WKFA 1JF5A 2QUVA 1DJZA 3LXBA 3KL3A 1M3UA 2C7FA 4JAWA 2B31A 1HKKA 3T2QA 3NO1A 3PJUA 4H2HA 1OSEA 2WZHA 3LM7A 3IJDA 4TV6A 2WVUA 3QMTA 1LT8A 4YWIA 1RWCA 3VE9A 3D46A 4D72A 1C9DA 3QKZA 4GYFA 4ICCX 4JFUA 4Q7NA 1V6XA 4CNNA 2RHGA 3W70A 4OGZA 5D9OA 1O66A 1OHLA 3L5MA 3MHFA 1F6YA 2QMJA 3LN3A 4H2CA 4KRZA 2G3IA 1AL7A 1YNQA 1MEWA 4N6EA 2QVHA 3O63A 3C4UA 1EXBA 3MHUA 1UB3A 1F3XA 4FB7A 3NQVA 4PTNA 5H1WA 2ZUSA 4IX0A 1VB9A 4PR4A 2E6YA 3O6YX 2Y2WA 2ZUUA 5DXXA 3VNKA 4XBKA 4OHQA 1TRIA 1JPMA 1YYAA 3VNIA 3BPWA 2DH3A 4IP5A 2FHBA 4YN5A 3HG3A 4LUTB 4W7UA 1H7RA 3GHTA 2XGIA 4PTXA 3LG3A 1JL8A 4CVWA 5FJIA 2XJ7A 1VFTA 1O5XA 4DWSC 1GVQA 2RJHA 4YWSA 3M9YA 3U9IA 4MZYA 3K5XA 1CLVA 4TX9A 4MWAC 4JIPA 4K2SA 3IJQA 3G0XA 5LXXA 4M5PA 1RQHA 4ZO8A 4P61A 1W5MA 3XINA 2QULA 3WD0A 4D6FA 4PUWA 1H51A 3C0QA 4Q32A 1EH9A 3CQ0A 1SZRA 4JZ5A 3W1QA 1XGEA 4UOQA 4JFTA 1KM3A 3USZA 3C86A 4EXQA 3R10A 5CQ1A 1R7OA 3K4WA 3SI9A 5DT5A 3GXTA 3GFXA 1RWGA 3VINA 3NG3A 3DKJA 1XX1A 3I10A 1A3WA 1XSJA 1XS2A 2EPOA 1MNZA 3UJEA 1KKRA 4ZB0A 2QUNA 5IRPA 3LI0A 1VR6A 2GVJA 2R6OA 3V5FA 4CUCA 3ZS4A 3W7NA 3ARPA 4ZTXA 4CN1A 3BGJA 5LZLA 2GJXA 8A3HA 2A85A 1GW1A 1RJPA 3M0JA 3ZWTA 3A5FA 3B9AA 2P8CA 2XGBA 5PTDA 1K7XA 1CWYA 3NCOA 5A6BD 1MZRA 4FS9A 3DENA 2J9XA 1AQMA 3WQEA 1BWVA 1CCWB 1JDEA 1IZJA 1SUXA 3RK8A 4CEXC 7REQB 1HUVA 2A7NA 3RXZA 4BI6A 1NVMA 3OYXA 2JF6A 2OG9A 4IPIA 2FB3A 1HJWA 2OQYA 2Z7GA 1HP5A 2PDFA 3M6DA 2BS9A 3EMQA 3W27A 4HP5A 4IMFA 2VKZG 4PMXA 3TYEA 4MYAA 1WZMA 4MWAB 5A5WA 4LANA 1K7FA 4H3DA 1TX2A 1CXKA 3VGBA 2BHYA 3FEQA 4JQ3A 3OIHA 1H50A 3L4TA 5IBXA 1DJGA 4AIEA 2NV1A 4KEVA 3NPXA 2C8NA 5GPRA 3OU8A 4UTLA 2VURA 3AZSA 2Q01A 1JVNA 1ZCOA 3TU9A 4LF2A 5D2TA 5EKYA 1BRLA 5K9XA 3LERA 3TW9A 3LPFA 5I77A 3U2EA 1K4GA 2XIOA 4M56A 3TCSA 3RPDA 4Q4MA 5KINA 4Q6JA 4KBXA 1BLIA 3CO4A 4DJDA 1JZ4A 1HKMA 3SRKA 4BFAA 3KP1A 4X9SA 1PHQA 3UG8A 3IV8A 1FUYA 3J7HA 3HGOA 3NGJA 1YADA 4M1BA 4QISA 3RPTA 4RW3A 4EAMA 4KW2A 4J3ZA 5D33A 1A0EA 1EJTC 2OEJA 4QX4A 4PL2A 3I3DA 5E6YA 4LAUA 2PSNA 4HA3A 5A6SA 4OV4A 1I1XA 2SFPA 4C5ZA 4W85A 1XDLA 2R94A 4MADA 3VOJA 4S3CA 3T1GA 4M19A 5CSRA 1OCJA 5D38A 2D0GA 3HG4A 5F2MA 1UD5A 2FZBA 4CQAA 5FJTA 3LLFA 3H8AA 1JRBA 3TW7A 3F5JA 3AC0A 1UWAA 4CD4A 5B7ZA 3GX9A 2B7OA 1T99A 2WDAA 2BBFA 5TAOA 1NQ6A 1UD2A 1OFDA 2PTYA 1KB3A 4HNOA 1UA7A 4LUJA 4M7TA 3E38A 1VFHA 2WAGA 3LXAA 2CERA 2WVSA 4OQVA 2B0MA 2I9UA 4NYUA 1P6BA 6TAAA 4DPQA 1NOWA 2D2HA 5AKQA 3MSDA 1DJWA 3G1XA 3S1WA 1J5SA 4O17A 4LX4A 2PRLA 5DY3A 3B05A 2FHFA 3WD2A 4A8IA 2E8ZA 4E3TA 3HG2A 4XIMA 2PDLA 2Z1VA 1S2UA 2ZTJA 4QAWA 3HOJA 3N4AA 1RP9A 2ZRVA 4WLCA 3ARSA 2UY3A 1E6PA 3NPUA 3MT1A 1XIBA 1DHKA 3QQWA 4L56A 3N2BA 5A6TC 4XO7A 5I03A 3I7RA 4WRHA 3I7QA 1Q6GA 4FNTA 1A5MC 4TR9A 2PEVA 1XBZA 1JDAA 1E4IA 4E3VA 5T91A 4XD4A 1VC4A 4GH3A 3SFKA 3U3HA 2GL5A 3DESA 2DEPA 4IFKA 1XLFA 1LLZA 4J3TA 1B4KA 3VX1A 2FJKA 4LUSB 2G41A 3WN6A 4IF2A 2D20A 1ZRQA 2WJZA 3FEMA 3P84A 1R3TA 2QYGA 4ZB5A 2V5BA 4AZ6A 3ES8A 3ZJ6A 3E5PA 5M1TA 1ISWA 1S2CA 4X61A 4HHLA 2YXGA 2J79A 1ME9A 5DEZA 5G2IA 2PTDA 4PTMA 3IGHX 5C9WA 1V3HA 3WK3A 1H1YA 4S38A 3MMDA 2CZFA 4GLEA 4I7UA 3QOMA 5G1TA 3WLQA 4JBRA 3TCEA 4AZCB 3LS9A 1QATA 1HJXA 1N8IA 4CCEA 2ISDA 2CBIA 4IIDA 1JULA 5U4NA 1TWDA 2OLSA 3TVAA 3KVJA 1RCOB 3T07A 3ABZA 4HNNA 2VC9A 1H0GA 4DUOA 3GFYA 4W88A 3T8LA 2DSWA 1XL9A 3WQWA 4MF4A 2WSKA 1QDSA 3L4VA 2F8QA 2EPKX 1SW0A 2OWWA 1US0A 1UMYA 3GIYA 3M5VA 4HOWA 5CZ0A 1GVEA 2CZEA 1K9FA 5CAHA 2BWGA 2Q8XA 4RLIA 2CEQA 5ABGA 1VQTA 2NV2A 3N29A 4JX5A 2C0HA 3NZRA 5LIKX 4F8XA 3L4UA 5CBJA 1XLLA 2J4GA 3TC3A 3WQ6A 1R2SA 1EGVA 2JKAA 1XBXA 3WEZA 2QS8A 2X7WA 2P8BA 1O1ZA 3OVPA 2DORA 2VENA 3WBWA 3TYZA 1T96A 3MVIA 1I2QA 3TYUA 4YVXA 4REQA 2NQHA 2ANUA 1WOBA 3CB3A 1K7EA 4Z2KA 2I7GA 1OFBA 2OSXA 7REQA 4JEJA 4F9DA 4CVUA 3VD5A 3VVGA 3E0WA 3SRHA 4CQBA 1E9ZB 5I3JA 2VQTA 1PIFA 4R9XA 1A5SA 2X42A 3WBYA 1R3RA 1C8XA 2P50A 1P7TA 2DW7A 3QXBA 2FTPA 4I8YA 3RM8A 3VYLA 1W9BM 4I3GA 1BHGA 5BCAA 3VILA 4CU7A 3QF0A 2A7PA 5I2UA 5BXTA 1JQVA 2V6AA 2J62A 3CH9A 4PUMA 1MW3A 4V1YA 3F4NA 4GJIA 3VTRA 4G7EA 2WCAA 3PS7A 5A8GA 3B9DA 2CWNA 4IWWA 1W3LA 2VRKA 1V0MA 2A0NA 1HX0A 4JYFA 5XINA 3WEMA 2YBUA 4N4PA 3WDPP 3ABXA 4KH2A 3W86A 1X7IA 3TONA 4PTWA 1PKLA 1N7KA 4QNWA 5I3HA 3M07A 3WD1A 4L4PA 4HCDA 1SJDA 2V5JA 2ZRZA 2Q71A 3PP7A 2QCHA 4F2TA 3L4YA 3CYVA 3LA4A 2VRQA 4QDPA 3O07A 1N7OA 4C6NA 1MZHA 2VVSA 1U30A 1UZDA 3BG3A 1F73A 2PAJA 3ANYA 3R1ZA 4JTGA 3T8QA 4C7FA 3WELA 3M47A 1W1PA 4A29A 4QR6A 3U7VA 3NOYA 3KCOA 3UW6A 2X03A 5H6HA 1LRTA 3BAWA 3NM1A 3LDVA 4WXZA 3S0CA 1J0IA 7TAAA 3WLSA 1MDRA 1DQWA 2V4IB 2FB2A 1K3UA 1YTKA 1E56A 3A6OA 3FXYA 4FZIA 3GDLA 3VOGA 3ITCA 4HU3A 3GS6A 1SFSA 2J78A 4I9TA 1JPKA 2VGFA 4WVXA 4AD0A 4UR7A 1XISA 4EPEC 1V6VA 3R12A 3U48A 2VDIA 2Y7EA 3UWEA 4DWSD 2NQZA 3ZVHA 3VIFA 4PCNA 3UG4A 4ZQRA 4GO8A 1PZ1A 5FIPA 2BP1A 4J3UA 3CU2A 2Y62A 2Y63A 1RSCA 2A3CA 3VE7A 4ENLA 2FGBA 1V4YA 3IVUA 4GGHA 3QPEA 4UTIA 4P8WA 3VKJA 3QHOA 1SJAA 3I6RA 3VK5A 4JTDA 1XC4A 3TOYA 2VYOA 4GJ1A 2CHRA 1QUMA 1G69A 1OC7A 2J9ZA 5H2ZA 2YCKX 3QSTA 1ZJIA 1O1HA 3W73A 2ZA1A 2QJGA 3N1AA 4FNSA 4AZBA 1GQLA 1D3GA 5HMEA 1EPXA 1B9BA 4RJEA 4LEQA 1GTEA 2YA0A 3ARYA 2ZRUA 2PDIA 2FTYA 3BE7A 3LHVA 1Q13A 3WK2A 4NZ1A 1I9CB 3V0TA 1UWUA 4W8LA 3GKFA 3RO8A 4M6UA 1L0PA 3N4EA 3W4RA 5KZ6A 3H26A 3PSVA 2VC6A 1CLXA 2PLCA 4B5TA 4EACA 2E9MA 2ZUMA 4LAMA 5CGQA 1XLDA 1J8VA 3QMSA 2G5WA 1E6RA 3A23A 3VX0A 3GUWA 3B4YA 4IJBA 3TUUA 4O54A 1YNYA 3EX2A 1I1WA 4F0LA 1QNPA 1TRDA 2F6XA 2OPJA 3I6EA 3WMBA 5D32A 2PZ0A 3CWOX 2J88A 1MXSA 1W3KA 1N55A 3SEPA 4BF9A 3B8DA 2A3LA 5M03A 1K9EA 5IHRA 3BZJA 4WUIA 2YCLA 1QW9A 4KIEA 3SUWA 3CH0A 4PCPA 4GJJA 9XIAA 1ONWA 4ICMA 2FZMA 4DNHA 1U5VA 1D3HA 5G4WA 3UJ2A 3M7WA 1W1ZA 4YTTA 3QTPA 2JFEX 1ZP3A 3LBOA 1OT1A 3ENLA 1UG6A 4LT9A 5CC3A 2E77A 1GHSA 1SR9A 4Z2JA 3AIUA 4O1DA 2O92A 4CNSA 4CD8A 2ZXQA 4CN4A 1V0LA 1R2TA 3LV6A 4GI9A 1XYFA 4J4KA 3R8GA 3W82A 3F4WA 5I79A 1YDVA 1ZFJA 2GSEA 2Z25A 1MO0A 1JF6A 1VYSX 1V77A 3FFSA 1B5TA 4ATDA 2YLLA 3W1MA 5MKGA 3VDAA 3STPA 1HM2A 3SW6A 4GYJA 3CAQA 3IWPA 1RXOB 2ZVIA 3SCSA 3KUMA 4IQJA 4H8NA 3AU2A 4KIRA 4E6MA 1YEYA 1NTHA 3GWQA 4IUGA 4BF7A 4KT2A 4CCZA 1E6SM 4XVEA 5D8ZA 1IGWA 1R46A 5CLWA 4PMRA 1C93A 1DTNA 5AZ1A 4DAIA 1F3EA 1OYBA 1DIEA 3S47A 3REQB 2BXVA 1PCKA 5LGZA 1VEPA 4MJ2A 3UR7A 3DXIA 1S3HA 4TXEA 3NZGA 2GK1B 4LNYA 2YX0A 4ERAA 4OOUA 2FLIA 4XZ9A 1GGOA 1EJXC 1FCQA 3ARRA 3H22A 1TUFA 4UTKA 2OR2A 3GD6A 3RAOA 3T42A 1EO7A 2F61A 4PUDA 2HEJA 3KRBA 1K8YA 3M5ZA 1A80A 3MCOA 2PC8A 1PWMA 2QV5A 2OEMA 1LWIA 2ZOXA 1IEWA 4PMOA 1E0TA 5JUVA 2WJEA 1MNSA 3EWUA 3CZLA 6REQB 2BODX 4CD6A 3FAWA 3WLTA 1AH4A 1LG2A 3DG7A 1REQB 1XBVA 4H9YA 3QQ0A 1B54A 1ZPTA 1EIBA 3BL3A 2OT1A 1P0NA 3WY1A 3F5KA 1F76A 1V0KA 1JAEA 4L1XA 3BJFA 4EXBA 4AX6A 1LROA 4PTDA 3RFAA 1E4NA 1KM4A 3RJYA 3S5NA 4MAZA 3RCMA 3LTPA 4K7YA 2C15A 3KM8A 2WNNA 3M0HA 4JOMA 3S5ZA 4YJ5A 2Q3OA 1OX6A 5BWAA 5GJPA 1K77A 1RQEA 3UY8A 1DXFA 1KFWA 1ODZA 1R86A 3BLDA 5GVJA 4B5SA 4LY4A 4P7LA 1OFAA 3BJSA 4GMEA 2GGJA 3RNDA 4PUNA 1QNRA 1F6KA 2VQUA 3BGAA 1A49A 4C6KA 5A2AA 3S46A 1EDTA 4GNKB 2V3GA 5FOOA 2E5DA 3BLOA 1LLOA 3RU6A 1KNWA 2PF8A 3T9PA 1UR2A 4MM1A 3LMZA 1F4HA 2POZA 2O9PA 3BVJA 3PZNA 1W17A 3GHUA 4H9TA 3AIQA 4MY1A 3FOKA 2W62A 3IAPA 2DH2A 1ZAJA 4JTFA 2PDQA 1QOPA 1R38A 1QU4A 3KX6A 3KAOA 5A2BA 2P0IA 4YS1A 2B81A 4CEUC 4ORMA 5EYWA 1CXFA 3URBA 5C2CA 3WLRA 3ZJ7A 4W9TA 4PUJA 2I17A 1Y5WA 4KEUA 3W23A 3CTTA 3EEGA 2HNEA 4I9JA 4UFJA 3AALA 4PBEA 2DIKA 2V69A 1TTPA 2GFTA 3SQMA 3QY6A 3ATYA 1W8GA 3WF4A 2XVLA 5FA5A 4TMCA 3CHFA 3KEHA 3KCLA 3STGA 4LYQA 3FGCA 2KAUC 3W2MA 2WOQA 3EX6A 2R1MA 3FY1A 1CXLA 4V33A 5FSEC 3NQMA 1PX8A 4D1IA 2J66A 5DCBA 3UZJA 4AB4A 4QJ1A 1YPFA 3MSRA 1EOKA 4US6A 5CJ5A 1E1CB 5D2WA 2Y4SA 2VI0A 1G01A 4W7WA 3CIVA 1XJBA 2VP8A 1TA3B 3KVMA 2FH6A 2FHCA 1OC5A 5C9ZA 4ML9A 4Q8TA 2O4MA 3QPYA 4OU1A 2EHHA 4QLLA 2CKRA 1UWIA 3K4AA 3VMNA 1JYVA 4DJED 3OGSA 3O1NA 2E25A 1B1YA 4X9YA 3HZ3A 4NG3A 1TV2A 1EQPA 4AD4A 1W9DM 1P0DA 4DNMA 1Q5MA 3VM5A 2JALA 1LYXA 2G3MA 4EX4A 5CZSA 1W9VA 1HKWA 4LBSA 2OVLA 4P5UA 1VFOA 3R2GA 1IR1A 3WNMA 1XIFA 1FDJA 3W6MA 3BK0A 1H49A 2V2DA 1EGUA 1KCLA 3HJZA 4C6QA 4HSOA 1TWZA 2XWEA 3VIPA 3HPXA 4PUEA 3CL6A 3L21A 1DWHM 2OX1A 3EDFA 4Y9AA 4MJZA 3DFSA 4MOZA 1JPHA 1I75A 1QI2A 4LNCA 1H7PA 3H2NA 1E1FA 3T44A 1KW1A 2NUXA 4Z1DA 5T9BG 3B9NA 3IV3A 1FWEC 4KFPA 5FF3A 3HV8A 4GX9A 4M82A 3E2RA 1J6OA 4IIHA 2EKGA 4NX5A 4AFYA 2HE5A 5DN1A 4KWVA 1X8CA 1TO3A 4Z08A 3G1FA 4RNJA 1K70A 4CLMA 1K4HA 3PUOA 3ICJA 1OJMA 3HB9A 2PTXA 4HMCA 3WH7A 3PPFA 2XSBA 4GGBA 1G7VA 3TA9A 3TTQA 4DEFA 1P1XA 1G4PA 3COTA 4LBUA 1LM1A 4QS5A 4XD3A 2PWEA 1MUMA 3RU8X 1QI0A 1Z6KA 3HPFA 3TSBA 2ONEA 4B3KA 4BQ4A 4KPLA 5LIUX 3NNTA 1VENA 3ORWA 4O1AA 1K02A 3IIPA 3HBLA 3C3NA 4QEEA 3QC0A 4ZEPA 3QW3A 1M7OA 4XZHA 1QNOA 1C3FA 4HTBA 4M6VA 1JDFA 1JYXA 3N11A 2YEPB 3BTNA 4AZ7A 1HJSA 5ENLA 1X6UA 2IUZA 2X2YA 1Q8JA 4QXIA 4PH6A 4JYDA 4ZTYA 2YA1A 4EAYA 2CIPA 1HM3A 1TPFA 2G96A 4YMZA 2YL6A 1VIZA 3DAQA 2PZNA 4G1KA 3VD7A 5A8OA 1FQ0A 5LIXX 7CGTA 2NVAA 1ZB5A 4NXSA 3L4ZA 2WCOA 1AD1A 3RF9A 4JIRA 3EWZA 1FWHC 4OBTA 1U2YA 3LZ3A 3DG6A 3SCTA 4BK9A 4H41A 1L2UA 3QR8A 5DF0A 1CYGA 3PBUA 1AJ0A 1V6YA 1LOSA 2XSXA 3R0KA 1Q6QA 4YVVA 3GC5A 4UTTA 1VFFA 3ZOAA 3VNJA 1DWGM 4J2PA 4UTWA 3GXFA 1HW6A 1ISXA 2NUWA 2V3EA 3CZEA 5CPQA 4F0MA 4HK7A 1JZ2A 1K6AA 1PJ9A 3PWIA 1DQXA 1R7AA 2JIEA 4QE4A 2W63A 4UWMA 4LYPA 3WH5A 3N34A 4W7VA 1XRSA 3TJ4A 1ZBKA 5D04C 1QOQA 4ZL1A 2WLYA 4JTEA 1HFBA 3LCLA 1DQUA 2W3ZA 1JXJA 1RH9A 1WZKA 3G1RA 1E0UA 3Q37A 3B0XA 4HK5A 3UERA 5B80A 4U3CA 3KWSA 3TZNA 3DFTA 1UC5A 4Q8NA 1OK4A 2YW4A 1QHPA 2ZWZA 4LTSA 3DUGA 1TTQA 2YCEA 4DM2A 4XBSA 2QDGA 3WDHA 1UH2A 3GH4A 1J12A 2NUYA 2O7QA 4KFNA 2H3DA 4GK8A 1VH7A 3P74A 3CXOA 3PWAA 1HKJA 3R79A 3DECA 2BASA 2Y5JA 2IS7A 3AISA 3V7PA 4JKMA 4FMVA 4FALA 2VEMA 4HZMA 1TMLA 1S1RA 2VUYA 2QJMA 2JEQA 1RV8A 4QJ3B 1E55A 4LVDA 3OGVA 3ITVA 3AMDA 4YCOA 1RUSA 4XAGA 1NAL1 1T41A 1JRCA 1Q2RA 1RD6A 1KWKA 2E9BA 3IRSA 3CWHA 4HU8A 1SO5A 3GIPA 4AYGA 1UP3A 1ZQ5A 2XFYA 5BRQA 1XINA 3VM7A 4LV9A 1VJSA 1N7RA 4ZQCA 3LPPA 1WV2A 1UWSA 3NQ6A 3EZ4A 4H1ZA 3U2OA 9XIMA 2ON3A 4BQ5A 3EDDA 3OQEA 1Z42A 4BCEA 1WA3A 2VDHA 2PFHA 1E6XM 1PDYA 1HF6A 3ARUA 4RDWA 1WXZA 1OINA 5GNZA 3AJ7A 1TELA 1AQHA 4Y90A 3OHIA 3GDKA 1GQNA 4HB7A 2WK2A 2GGHA 4HYRA 2NVDA 2QXWA 4B15A 1W6TA 1KFLA 5EPDA 3GYEA 1MI3A 2I5GA 3LQGA 1QWGA 1UWRA 4AY8A 1EJUC 4Y8FA 3V75A 3VZZA 3CIXA 4FLRA 1GOQA 5FF0A 2XVNA 1V6UA 4TMBA 5HJYA 3LHUA 5DQPA 2R1NA 2C13A 2PS2A 4E4UA 3AMCA 3NPVA 3W1RA 3AYSA 5D8WA 4IJCA 5HQLA 5IFPA 2DZXA 3W7PA 3QJAA 1E0VA 3AHZA 3QHNA 3NEVA 1UP2A 4NUWA 3VXGA 1LOQA 4YYCA 2XIBA 3BWWA 1VCFA 1XWYA 1RWHA 4UTHA 3GXMA 4HBKA 3MO4A 5AYZA 4CKQA 1QBAA 4DF1A 3KTSA 1WXJA 3GK0A 3C2FA 4KETA 2J6XA 4DO5A 2VZKD 2Q8ZA 3TWAA 3QRHA 3TN4A 4QP0A 2J7FA 2WXDM 3WH9A 4V27A 1EDGA 2I5QA 3H2EA 3MB9A 2E24A 4LUYA 1B2YA 2VZUA 5E0KA 3OOQA 1UIOA 3P80A 1AQ0A 1S39A 3TAKA 4UOJA 1YBQA 3ZJKA 3P0WA 2QAFA 1SSGA 2DIEA 1V5XA 3FVDA 3CHVA 3ECQA 3MY9A 5I3GA 1H60A 3P93A 2YL9A 2GLKA 2ZFAA 1G0CA 5BXPA 1W2PA 1HN1A 3PPCA 4ZSTA 1GNXA 1VZWA 3ZJ8A 4NVTA 4PCTA 3WLMA 3HPAA 3THCA 1GG0A 3DBPA 4JDYA 3AROA 1V7YA 1BF2A 5DLCA 4HZ8A 1XFCA 2W79A 1TPWA 3UXIA 1AUSL 4JIHA 1TTIA 2VT0A 5CBBA 3ZFHA 1EYEA 3AHXA 1L8NA 1TV3A 4G6CA 1E70M 2YBTA 3NR0A 4AY1A 5M2FX 1G94A 1TPB1 3KL0A 5LKYA 4JTJA 2WHLA 1Z7AA 2EPNA 4KEZA 1X7FA 3CGTA 3BLFA 5C7HA 1C8VA 1NP2A 5DXYA 3L67A 5KITA 5ABHA 2G0WA 4ZENA 4E8DA 1UBPC 1XGDA 3MMTA 4ZFMA 2PU1A 3NZQA 2ZX7A 1UUQA 1J0MA 2VEKA 2Z24A 3GTFA 4JS3A 4PGLA 1TCDA 3GH5A 3SCRA 1R30A 1E73M 1R3SA 3D5HA 3ABRA 3O16A 1M03A 2B4GA 2J27A 1EF3A 1XRVA 1EP3A 1AW5A 1RCXB 1RD5A 3DC8A 2DDXA 3AXMA 3S83A 1RY8A 3W9ZA 2VZKB 3EB2A 1S5TA 1OWQA 3HMCA 4UTFA 3NOEA 3NQ8A 2F84A 2FZNA 3IACA 2Y5SA 2ZRWA 2GVLA 2P1FA 4FOKA 2V68A 3BSGA 3R8RA 3EDJA 4P7RA 4RE3A 5GQBA 3VD4A 2CBJA 1ME7A 3G2GA 3N9SA 3WLLA 2IMRA 1XYBA 3PZIA 1S5WA 3APYA 3AXHA 1QPOA 5LSMA 1UD3A 2XH0A 4XV0A 2DFAA 3MWAA 1E4MM 3BSHA 3FKRA 2TMDA 3RR4A 5F2GA 4FOUA 2ZIDA 1TE6A 2FPVA 3OBEA 2QJHA 3S1VA 1RK5A 3LRLA 4HGXA 4CCCA 3WYZA 2WKGA 1W1B1 4GKTA 3NUKA 1OF6A 1XR2A 4XVDA 3SGUA