2WMIA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 in complex with the a-trisaccharide blood group antigen.
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
582
structure length
572
Chain Sequence
VDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTENYWIWANDIENKAADYLKVSAKNGGYFIWAEQNNGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 221
structure length 572
sequence length 582
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmiA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmiA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmiA02
3UG4A 4PMOA 3VU2A 1KFWA 3LPPA 4E8DA 4KRUA 1JYNA 5A8OA 3AHXA 2BVDA 2QPSA 5A6BA 2RGLA 1EGZA 1K9EA 5AC4A 1WP6A 3W26A 3WUEA 1QHPA 1WZKA 1J0NA 3VGBA 1W9XA 2DDXA 2PWDA 1UR2A 4MJ4A 3VGGA 3AYSA 2CHOA 1L8NA 4FK9A 2XGIA 2G41A 1EOKA 3LPGA 5FL0A 3W29A 4TX6A 5CSYA 4W93A 1N7OA 4QP0A 5ABEA 3VOCA 1H09A 4URIA 1QI3A 5LA1A 4HMCA 1BHGA 3NCOA 2ZWZA 4D1IA 1HKMA 4ACZB 2YOCA 2YL9A 4J3VA 5GQBA 2WVVB 5FCZA 5BROA 4Y7EA 3UG3A 4MNLA 1WDRA 1H49A 1DEDA 2JIEA 1ISVA 1HXJA 4RE3A 2W66A 1Q6GA 4HZ8A 3EMZA 4PSRA 3ECQA 1GVYA 5HBFA 1OJOA 2DT0A 3WDPP 4W87A 4TX8A 2QHAA 3RM8A 4UFKA 2WZEA 4BQ3A 5AY7A 5FIPA 2QMJA 3ARRA 2YA2A 4IUGA 4L4PA 5GNZA 2EPOA 4CD6A 3U7VA 1LG2A 2XFRA 1DHKA 4ZFMA 4MNKA 2J47A 3CZ8A 4W86A 3IAQA 3AMLA 1NOFA 3L4WA 3OA5A 4MADA 2GDUA 2VTFA 4EE9A 3VIOA 3OGSA 2VX5A 1E4MM 5D9PA 1WDSA 2VZVA 2WZIA 1NQ6A 3WDJA 1HJWA 3UR7A 4JFVA 3NSNA 1XSJA 3AIRA 3WNLA 1V3LA 2VR4A 3PHAA 2C0HA 3AHVA 4A3HA 1G9HA 2V3DA 2WXDM 1KXTA 1E3ZA 1JD9A 1GOIA 3DHPA 4YHGA 3VMPA 2D2OA 1KR0A 3K8MA 2BFGA 2Y2WA 2X09A 1OSEA 3VGFA 1UA7A 1PAMA 1SFSA 3N1AA 3WL1A 1XH0A 3W82A 2D3LA 4N42A 1W9DM 1ZB5A 1CWYA 2CXGA 4KMQA 1JZ4A 2OLHA 3W53A 2VZOA 2X05A 3GNOA 2PI6A 2W92A 4CD8A 1B31A 1E6PA 3CUJA 1KQYA 4JHZA 4B16A 2VCAA 3SUSA 3SUTA 3WKZA 1JZ7A 4JAWA 4CN4A 5CZKA 1UUQA 1TZ7A 2D0HA 1CB8A 2UY3A 3CBWA 2VVNA 3BGAA 2CERA 4CVWA 5M5DA 4CU7A 1GOQA 1W2VA 4KGLA 1SR0A 2YLLA 3F5KA 3UCQA 1FHDA 3AIWA 1JD7A 1E0XA 1EDQA 1FP9A 4ZE4A 1J0IA 2IXVA 5LA2A 1BYCA 1H11A 2WHKA 2BRVX 1Y7VA 2HISA 3ZSSA 2D23A 2WVTA 4FLQA 4WSJA 3UETA 1BGGA 3BAYA 3LPOA 3B9AA 4E2OA 5ECUA 1V6VA 4FLSA 1FH8A 3U7BA 1US3A 3WH8A 4PN2A 4YPJA 3AHYA 1HT6A 5A6KA 5IHSA 1EGUA 3MSGA 2VRJA 1V0MA 3PBGA 1UD5A 1XC6A 4PBGA 1QI0A 4W5ZA 5M3WA 4P8UA 4F79A 2BXZA 3T2QA 1HJUA 2PWHA 1DWHM 2J7EA 2DSKA 2W61A 4XUYA 1MQPA 1W1TA 3CHCA 2BRPA 2J75A 5BYWA 1VFOA 1LXMA 1OGGA 1W9VA 2TAAA 3CIVA 1S46A 1R86A 4M24A 1BF2A 1LL4A 1W3LA 3AMDA 4W8LA 5EBAA 4AEEA 2WWCA 2WCSA 1XV8A 3TA9A 2J8GA 3W27A 1V6XA 1ESWA 1CTNA 4RE4A 4HZ6A 2D1ZA 4M82A 2B31A 4PMVA 1H1NA 5JBDA 1E6XM 2J7HA 3POHA 4V2XA 3CMGA 3ARZA 1OJNA 1BFNA 4TVUA 3VDHA 3TTOA 1WB0A 1W91A 4AC1X 3DYMA 1KCLA 4QLJA 1W1YA 3SIMA 2PWFA 1IV8A 3AMGA 5C70A 1HX0A 1V08A 3AIEA 3BAKA 3U5YA 3OLGA 3A3HA 1TCMA 2WDAA 4JKLA 2FDMA 2FH8A 3VKKA 3WUFA 1JIBA 3TTYA 2WHJA 3THCA 1QNPA 5BRQA 1JDAA 3VVGA 4GI6A 1W3HA 1LOHA 1GQJA 1JNEA 2VOTA 2VR5A 4AZ7A 1LL6A 4PUEA 4J3TA 2VCBA 2XUCA 1J12A 4MB5A 3W81A 3WUGA 3U57A 4FF5A 1GJUA 1UKQA 1ISYA 1XSKA 1WDQA 2WK2A 4J27A 4W5UA 3ZJ7A 1UWSA 2BY0A 3W38A 1KB3A 4GKLA 2J79A 3WBEA 1TE1A 1W3JA 1TUXA 3VUPA 1HJVA 3AXHA 1LLOA 1XD1A 1V02A 4GXPA 2XWEA 4PCSA 3WDIA 2WSKA 3NDYA 2OSXA 2BNJA 5D9NA 1EH9A 2WB5A 2VRKA 1DTUA 3WQWA 3JUGA 3OBAA 4HPHA 1PZ3A 4D6HA 3FHQA 1E0VA 4AXNA 1QPKA 1PX8A 4XZBA 3WNKA 1VEOA 1V6UA 2NW0A 1HL9A 1VFFA 2VZUA 1G01A 2WCAA 5IFPA 1QNSA 1E5NA 2CBIA 4E4PA 1OIMA 5CSUA 1X6LA 3CH9A 3PZQA 4DWSD 1MVYA 3WMSA 1JFHA 3N17A 2DT3A 3UESA 4V28A 3M07A 4Z2HA 3AFBA 2DEPA 5KZ6A 1J0YA 1JZ8A 1D7FA 4JCLA 2XPKA 3SCRA 1HP5A 1E1EA 4LPCA 4UOQA 4AWEA 1KCKA 1MYRA 2DIEA 3QGVA 2E3ZA 3AZRA 5E0FA 3EDFA 4C7DA 2EPNA 2WZHA 2WM0A 4LYQA 1FH7A 1AQHA 5A8NA 1YQ2A 3WF2A 3ALFA 4F8XA 3IANA 1FH9A 3N13A 3CLWA 1X1NA 5A6BD 2D0GA 3AHZA 1AVAA 2YLAA 3AXXA 1ZU8A 1UG6A 3W24A 4AZCA 4MB3A 1HVXA 2GUYA 1NP0A 1VJSA 1RWFA 3CZKA 2J8FA 1U2YA 3G6MA 4QCFA 2BVTA 1UKOA 2BRWA 1UWTA 4DWSB 4FLRA 4U5IA 2G3NA 3CZLA 1R7AA 3AYRA 2E9BA 5HDRA 1CXHA 1W3KA 4AZHA 3WD0A 4OJYA 3ARVA 1TA3A 1QW9A 2A3AA 3WD4A 1ODUA 1HF6A 2CHNA 4MDOA 3FXYA 1DWFM 1RW9A 3SCPA 1B30A 3IJ9A 1U33A 5GPRA 3GXFA 3WENA 5E9AA 4QLKA 1E56A 1R85A 2VC9A 2DIJA 4AD4A 2WSPA 3A4AA 3BCFA 1GQIA 1MXGA 2G4FA 2D22A 4LYPA 2O9PA 4BQ5A 1HNYA 2YIHA 4BQ2A 1JYXA 5D8WA 1NOUA 4UQEA 5A6LA 1JZ3A 5D9OA 1WAWA 3K46A 1UKTA 1EHNA 2CBVA 1VAHA 4MAZA 3WNNA 1J10A 2JE8A 4B15A 2VL4A 4JFUA 4OBSA 2OYKA 1OIFA 4AZ6A 5BRPA 2NT1A 1FFQA 1WZLA 1X1IA 1UWQA 2EBNA 3PTMA 3IJ7A 3RO8A 2E9MA 3PZGA 1F9GA 2CBJA 4H2CA 4UFIA 1W9UA 5CLWA 1UR1A 1I75A 1PPIA 1UD8A 2XM1A 1N7QA 3WNPA 2Y24A 2EXOA 3KL0A 3GBDA 2JEPA 2ZUMA 4HP5A 1XD0A 2WYSA 2VRQA 4E8CA 1G5AA 1LQ0A 1MW2A 3II1A 1BYBA 2VQTA 3PTKA 4PUDA 1EQCA 1QNRA 1I1XA 2WHMA 1VJZA 1GVIA 4CVUA 1ZBVA 1CXKA 4XX6A 1H0IA 5A2BA 1BLIA 1GOOA 1HMWA 1E71M 1PX3A 3K1DA 4A4AA 5EB8A 3MSDA 4ZE5A 1CPUA 3VTRA 1PEZA 3UERA 3N11A 3VINA 2DPEA 4AW7A 1G94A 3MMWA 1VFUA 4GI9A 3BCDA 1NH6A 4PMNA 2AAAA 1HJQA 1Q6FA 2JEQA 2XJ7A 3ARUA 3AS3A 3FW6A 1KR1A 5FD0A 3I3EA 4PMYA 2XVLA 5JIWA 1GQLA 2W4XA 2ZX6A 4ZXLA 1H0GA 1ISZA 2CCRA 1PIGA 3I3BA 4WKAA 3S6TA 1E4IA 3EYPA 2Q1FA 4TXEA 3VIMA 3AS1A 1FA2A 4AY1A 1B3VA 2WAGA 4IPLA 1QOXA 3VILA 5BXTA 4LX4A 3N18A 1AQMA 1B3WA 1VFMA 4D6EA 1CENA 2WC7A 1B9ZA 4LQ1A 1E6RA 1KBBA 3VM7A 2YL5A 1X6NA 5A94A 2O92A 4CN6A 1V3HA 1ZBWA 2Y5EA 1E4LA 2GJPA 4AYSA 2GJXA 5HNNA 2PWEA 1R7OA 2A3BA 1R8LA 1UKSA 1QNQA 1WNOA 1G0CA 1E6ZA 3VIJA 1JYVA 1RP8A 4UFMA 1KXHA 4OOUA 1VB9A 2ZX7A 4QFUA 1EQPA 1J0KA 1QI4A 3N9KA 2AMGA 1GHRA 4MB4A 4R27A 3WY1A 1Q4NX 1V0KA 4OOZA 4WIWA 2C8NA 3RM9A 2WMIA 3K4AA 1RH9A 1UHVA 4JL2A 1TMQA 1RWHA 3L4XA 3M7SA 3VD5A 3TONA 1BTCA 1A47A 3CO4A 1CDGA 5I0DA 1NP2A 3ZM8A 2CKSA 4PTVA 1CBGA 3WH6A 4P7LA 3B8SA 3BAIA 4J3WA 3NSXA 2W5FA 4FLOA 5DFAA 1WO2A 3CUFA 3APGA 3E1F1 2WANA 1JXKA 4GQQA 4K68A 1V0NA 1XYFA 4QDMA 1ODZA 1R87A 2YA0A 1EO5A 3T2PA 1DWGM 1K9FA 2HVMA 2A3HA 3W6LA 1OB0A 3AZTA 3GH7A 4PMDA 5CGTA 2YDSA 4UQDA 1A3HA 1V03A 2WMHA 4H8HA 1JZ6A 2X8RA 2V3FA 4HPGA 4WKFA 1QNOA 5FOOA 1HM3A 3L4VA 1BYDA 2DH2A 3MMUA 4MPKA 3WDRA 2JFEX 3CZJA 3T2OA 5E6ZA 2CITA 3EDDA 5CJ5A 2ZX9A 5E09A 1ZS2A 3NUKA 4TUFA 4UOJA 4U3AA 3WMBA 3T0AA 1V02E 2XGBA 4DUWA 1V0LA 2F2HA 4KRTA 2WMGA 1HN0A 4D71A 2F8QA 3VD4A 1XHGA 5A2AA 5I24A 1HKIA 2G8ZA 1N7PA 2C7FA 2BHZA 4MNJA 4OIFA 4YHEA 2WNWA 3OB8A 4CCDA 4F66A 4ML4A 3MMDA 1KXQA 4D6CA 1EHAA 1QBBA 1VRXA 3NIYA 2J7FA 4JIEA 5I23A 2VX7A 3MU7A 2WBGA 5DT5A 5JUVA 2NT0A 4J28A 4P7OA 1I1WA 1UWUA 4HA4A 3NJ3A 4UQBA 3FAXA 1Q6CA 1V6YA 1H2JA 1MFUA 2QF8A 4RE2A 5A6JA 1LWJA 2OSWA 4X0VA 4JL1A 1UR0A 2WLZA 4GINA 1LWHA 1V3IA 1CGYA 1GONA 1MWOA 1UH2A 1UZ4A 4Z2IA 2OYLA 3L4TA 3NDZA 1GW1A 1WDPA 3W4RA 1MQQA 3GM8A 3VPLA 2E8ZA 4CCCA 3WQ5A 1TFVA 1OWQA 2ZIDA 5CXPA 5IDIA 1MW1A 2OWWA 2XTKA 4HA1A 1J0MA 2E8YA 1FHLA 1CGWA 3SCNA 4MDPA 3DHUA 4TTUA 5ABFA 7TAAA 3VNZA 3ARWA 1KWGA 3HMCA 2V38A 4Q7NA 3SCOA 2J62A 3D5HA 1QI5A 3FHAA 1XGZA 1TVPA 3SCTA 5BWFA 1B0IA 3DYOA 1E72M 1WPCA 3ZIZA 4KH2A 1M7XA 2XYLA 2X0YA 4P8VA 3ARXA 4HU8A 2VCCA 4HMEA 5I77A 1K9DA 1OM0A 1EA9C 4U31A 2OWXA 4DWSC 2WMJA 3UG5A 5DF0A 5TD4A 1UR9A 1JYWA 4WLCA 1UD6A 1QI2A 1HN1A 4PMXA 2XIBA 2CPUA 3IK2A 5FKYA 4QLLA 5A6SA 2ZUUA 5BXSA 4JKMA 1JDDA 4HOWA 4M56A 5ABHA 1NWTA 3L4ZA 3BSHA 5F7UA 4AD5A 3WIJA 2ZUWA 4HZ7A 4C7FA 1B90A 4AZBA 1YHTA 3VMNA 1OGSA 4UR9A 1FOBA 4AISA 3AXIA 3RJYA 3CGTA 3F4VA 3SCSA 3WFLA 2X1IA 4PRWA 1RWAA 3T09A 5IFTA 2DQXA 2DSUA 2ZUTA 1UQYA 4GZIA 3SCVA 1AQ0A 3GYCA 3VD9A 2EJ1A 1MFVA 3ARQA 1C7TA 3ARTA 1DWAM 2GK1A 8CGTA 3EMQA 4AZCB 2V5DA 1E40A 1E6SM 2ZXBA 2MANA 2VVSA 4PMZA 5BXPA 1C93A 1O7AA 4TTGA 1JFXA 5A1AA 3AS0A 1GZJA 3GH4A 1TA3B 4XV0A 1VEMA 2VX6A 2EQDA 4PCTA 2QV4A 3LMYA 4BS0A 4ATLA 2FHBA 1N7NA 1C8QA 5CQ1A 2GVYA 3THDA 4WK9A 1OT2A 3KWXA 2WLYA 1UWRA 1CXEA 3RMEA 5C71A 3PTQA 2X03A 1KGUA 4Z2GA 1GOMA 4ATWA 3VDAA 4NZCA 1C7SA 1XH1A 2JALA 3RCNA 1I8QA 1Z32X 4XZWA 2YBUA 1SMAA 3S2CA 3A47A 1WKYA 1UH3A 4U2YA 3WH7A 1AMYA 2YDQA 1PJ9A 1IT0A 2WC4A 3ZJ8A 2PF0A 3PN8A 4B3KA 1VBUA 2ZX5A 2QPUA 4TOQA 4D1JA 2DSWA 4BF7A 4GZJA 1J0HA 4HTYA 3U5UA 2ZX8A 4UFLA 2DT2A 4D6JA 3I3DA 4GZEA 4CU8A 4ZENA 2CIPA 1UYQA 2DGAA 4EK7A 4U2ZA 5AYBA 3AMCA 2UY2A 5DMYA 3GXIA 4V27A 4JFSA 1DWJM 1GNXA 2BHUA 4S3JA 5HPOA 2EEXA 3MUIA 2WMKA 3G6LA 2ZICA 1P6WA 3AI0A 4WF7A 3UEQA 5I5RA 3AIUA 1CZ1A 2BV9A 2ZUVA 6A3HA 3L2LA 3ARSA 3RM4A 1QW8A 3FNDA 2BHYA 1XCWA 4MB1A 2ZOXA 4NI3A 1OD0A 1E6QM 2BS9A 2DH3A 1QBAA 4ATDA 3VX1A 1J0ZA 1CECA 2GSJA 1DWIM 1E9LA 1B2YA 2O9TA 1EDTA 1H3GA 1XYZA 3CZEA 1BSIA 4W8BA 1PBGA 4AIEA 5HXMA 1NWRA 1W3YA 1E0WA 2YA1A 3WNOA 4P7RA 2WPGA 4W88A 4M81A 3HJEA 3VM5A 4Z2KA 2D3NA 4B3LA 5BXRA 1JF5A 1JZ2A 1CGTA 4XB3A 2EPLX 4C7GA 5E70A 1E5JA 2WCGA 1OBAA 3SEPA 2ZUNA 1OJPA 1BVZA 1H5VA 2FGLA 1NWSA 2G3MA 4IPNB 3TTSA 1UZ1A 3KE0A 1EO7A 1M03A 1C91A 1VF8A 1UD2A 1J01A 1VENA 3UR8A 1ITCA 4JKKA 4W7UA 3WQVA 3EDJA 3MUY1 4PTMA 2XVPA 1LL7A 3CMJA 2ZXAA 5A95A 1W1PA 5IXEA 1X1HA 2G3JA 3VDCA 4GO8A 1V3MA 1HIZA 2ZE0A 3TTQA 2J78A 3PZ9A 2W91A 3VGHA 3O2LA 3AIQA 2D20A 3CHFA 1NWUA 4EKJA 3QHOA 3PZTA 1US2A 4CCEA 3WF0A 1CXIA 4UQAA 4Q22A 3K4DA 2PBGA 3GZAA 5CLTA 2CEQA 5I3DA 3GTNA 3TP4A 2GJXB 2FHCA 2VZSA 1KQZA 2WC3A 3NSMA 5A2CA 4NRSA 3ZR5A 1BQCA 5FL1A 5LYRA 4IM4A 1GUVA 1M01A 2XSBA 4X9YA 1XCXA 3OLDA 4OKDA 1XSIA 2ZWYA 3BMVA 9CGTA 2ZUSA 3BAJA 4PSPA 4NSBA 1JI1A 2NSXA 4OUEA 4NF7A 2WMIB 3OZPA 5CPQA 5A6MA 3AJ7A 4J7RA 2J77A 3MUAA 3OZOA 4H8VA 3SCQA 3OGRA 1UR8A 4Z2JA 3WF3A 3VMOA 1E70M 3N04A 1TG7A 3SUWA 3PZIA 3ZT6A 5BCAA 3QOMA 1TVNA 1KXVA 2X2YA 1VIWA 3CTTA 4CKQA 4JCMA 1JNDA 4KGJA 3ZMRA 4UFHA 4M80A 5E0CA 3RIKA 3WDQA 3WQ8A 1B1YA 3OIHA 3AZSA 1C90A 3CUGA 4D6GA 3AIBA 3MKKA 1V6WA 4L4OA 5IHRA 2E4TA 3QR3A 2CYGA 2VX4A 5KEZA 1B3XA 1BG4A 2E9LA 4BA0A 3VGDA 1VEPA 3OLIA 3CZGA 2W67A 1JI2A 3L4UA 5A6AA 2CETA 4GQRA 4R5EA 1HP4A 3WD1A 4D6FA 2WKLA 3WSUA 1ZJAA 4W7WA 1WZMA 3ZJ6A 4PTXA 4MNMA 2VT0A 4JZ5A 3SCWA 2XIIA 1RP9A 2OWCA 1M04A 5EFDA 5M17A 2XWDA 3RJXA 4H04A 5CG0A 3MUZ1 1SMDA 2AOSA 1JZ5A 2VUYA 3LPFA 4AD3A 2A3CA 1EDGA 4UQCA 1C92A 4D72A 3RPMA 3WH5A 1NOWA 2YL8A 5EMYA 2PC8A 1F4HA 3OGVA 4OZOA 1UWIA 2YJQA 3AISA 2BXYA 4AMCA 3VIKA 2IUZA 4J3SA 3IJ8A 3VX0A 4ACZA 5DT7A 2J74A 2WVVA 1KWKA 4S3KA 2VMFA 1MQRA 2WCOA 4W8AA 4GO9A 3A4WA 3FN9A 2UY5A 1FP8A 2Y4SA 4BZYA 2YL6A 3BC9A 3ZT7A 3QOKA 3VIFA 1CNVA 4KWUA 3MANA 3PZVA 2A3EA 1UOKA 1KGWA 2CBUA 1RD6A 2J7CA 1J9YA 4HMDA 2WBKA 3L4YA 5E6YA 3QHMA 5A8QA 4X0NA 1NARA 4H7VA 7A3HA 1UA3A 3O9NA 1J18A 1N82A 5ABFB 2W62A 2WWDA 3B9EA 1QHOA 2CESA 4CD4A 1W32A 3AHTA 3KL3A 4AZIA 2J7DA 4NRRA 4AD2A 4ZEPA 3RILA 3VIHA 1HVQA 1CGUA 3B9DA 1M53A 4HOZA 4HA3A 4H41A 4IISA 4U33A 2FHFA 1E3XA 1OD8A 2OSYA 5CGMA 4DUVA 3FY1A 1CLXA 4ACYA 3PZNA 4UNIA 1L0PA 1H41A 3WF1A 2WVSA 3AS2A 3PZMA 3TOPA 1QHZA 1JAKA 5A8PA 3CPUA 2VI0A 4CGTA 5LA0A 5EFFA 4YN5A 2JF6A 1GCYA 4AIOA 3MV11 3CHDA 2XVKA 3FAWA 1XRVA 4UFJA 1GOKA 3WQ4A 1ZL1A 2Z1KA 3A6OA 3WL0A 1HJXA 2VJXA 4JHOA 3BLPX 2CKRA 5HPCA 5CPTA 3MV01 4H8UA 3W6MA 5JBFA 2WVUA 4EAMA 2BY1A 2YDRA 1CIUA 4UCFA 1LF1A 2V3EA 1JGIA 2E40A 3K8KA 1J11A 1CLVA 4PTWA 3SUVA 1WE5A 1OCQA 1U30A 2EPMX 1CYGA 3VD3A 2UY4A 4ZXOA 2Y8VA 5ABGA 2D24A 1ZBCA 3N15A 2VNCA 4TVDA 5D9MA 3BH4A 1QVBA 1ZBKA 2ESCA 1C8XA 2XVGA 4QAWA 1MW0A 1JF6A 3MO4A 4W89A 4M8UA 4W7VA 2GK1B 5DO8A 4GIAA 3F5LA 2VURA 2EPKX 1LG1A 3SCUA 3BAWA 4DM2A 5AC5A 4M1RA 2OYMA 1LXKA 1DP0A 4GI8A 3DC0A 4PMQA 4N0RA 3ZJKA 2J7GA 5C8BB 2XHYA 4AEFA 4OBRA 1C3FA 2Z1SA 3OG2A 5A3HA 3WNMA 4JFWA 8A3HA 3PZOA 7CGTA 4PYSA 2DT1A 3HN3A 1VBRA 3VDBA 2VO5A 1EXPA 3T08A 2V5CA 3GNPA 4U3CA 3ARPA 1FFRA 1HM2A 4P8XA 2UWFA 1ISXA 1GHSA 3HU7A 5HOSA 1OJMA 1OGBA 3NYDA 3WQ6A 3BXWA 3KEHA 2E0PA 3O6AA 4EANA 2DSZA 2PBOA 1BAGA 3MS8A 3GH5A 2EO7A 3W37A 2VZTA 2WW5A 5AYIA 3WDHA 4DUXA 3T0DA 3ZT5A 4FMVA 1E73M 3VIIA 4UOZA 4HOXA 2JIWA 3AIVA 1OT1A 3SURA 2J25A 1BPLB 4CD7A 1UH4A 1K6AA 1W9BM 4PMRA 3W0KA 1D3CA 1IZJA 1EIBA 3BMWA 5I6SA 3N12A 4AD1A 4W84A 4D6IA 3K8LA 1E4NA 5I78A 1BG9A 4U5KA 1G1YA 3CHEA 3J7HA 2ZXDA 2DSVA 4CN1A 1TR1A 3AQUA 3WEMA 3VD7A 4MAVA 2XM2A 1HKKA 3WFZA 5D4YA 6CGTA 2QMKA 2J7BA 3GXMA 2GFTA 1RWGA 5D8ZA 1H4PA 3GNRA 2VQUA 4UTFA 1SYTA 1HKJA 1HJSA 2PB1A 1F4AA 3ZSTA 1B3YA 1NM9A 4QCEA 1Q6DA 4RL3A 2BY2A 1F1SA 1JG9A 4AZGA 2ZXQA 2W63A 3EDKA 2BVYA 3VIPA 5A8MA 1BVNP 2WMFA 3VO0A 4CU6A 4JFTA 3M6DA 1GORA 2GJRA 3EDEA 4F9JA 1CGVA 1JDCA 4B9YA 1GJWA 1ISWA 3ARYA 4P7NA 4BQ4A 1UQZA 3WD2A 3SUUA 4J3UA 5I2UA 1C8YA 5M03A 3KZSA 1ITXA 3EMCA 2BY3A 1ECEA 1MW3A 2Y8KA 4A3YA 3POCA 4W85A 1JL8A 1EOMA 1UR4A 2XFYA 1JAEA 3WH9A 4LGXA 1OINA 4D6DA 3AMKA 2XVNA 3KL5A 3WBAA 2JF7A 4PMUA 3WELA 3CUHA 3ZQ9A 3WMCA 4LYRA 3VGEA 4P7QA 3AICA 1GOWA 3DECA 1PZ2A 4CD5A 2XG9A 5GNYA 3BLKA 2WHLA 1V3JA 4LXFA 1E1FA 1RPKA 1W9PA 1O6IA 4PEEA 4B9ZA 4MJ2A 4AZ5A 1ZJBA 4HU0A 3EBVA 2O9RA 1UD3A 3ZR6A 1GQKA 5GNXA 4WSKA 4UQ9A 1MXDA 3ALGA 2XFFA 2E24A 4F9DA 3RDKA 1J0JA 4TVCA 1RWCA 1WZAA 1GPFA 1HMUA 1KBKA 1PX4A 1C82A 4WJXA 1X1JA 4GPNA 2O9OA 4AIUA 3WD3A 3AROA 1E6NA 3L2MA 4J3XA 3QHNA 4M29A 2RGMA 1IZKA 1LJYA 4DM1A 2YBTA 4UZUA 1CGXA 3WEZA 5A69A 3ZOAA 3GBEA 1HL8A 3PZUA 3CUIA 1BYAA 1PIFA 4UZSA 4CUCA 3VNYA 1B3ZA 1CXFA 2F61A 2QLYA 3F5JA 3BAXA 1UD4A 1E55A 3WF4A 1WCGA 5I79A 3WEOA 3WN6A 3WUBA 4BCEA 1Q6EA 2CNCA 2J4GA 2D0FA 2XSAA 1N7RA 2FGZA 3DYPA 1W2PA 5JIPA 1XH2A 2IXUA 1UKPA 1CXLA 2E22A 2X0HA 3GXDA 1W1VA 2GDVA 2G3IA 2YKKA 3OLEA 6TAAA 4DWSA 1E15A 1V3KA 3M46A 1K9TA 3AOFA 3W25A 4AD0A 3BSGA 2Q8XA 4MTVA 3T0BA 4WKHA 1JXJA 2FH6A 3VIGA 2V3GA 3IAPA 3ZO9A 1E43A 1BGAA 1D2KA 2WKGA 4P8WA 5CPSA 5DEZA 5JBEA 4Z2LA 3D3AA 3W28A 3A4XA 1CEOA 1KGXA 2PWGA 3GDBA
chains in the Genus database with same CATH superfamily
2OOGA 1UROA 4PMOA 1P0BA 1DKWA 4KRUA 3TMLA 3C52A 4A22A 2XGZA 3UXLA 4R33A 2RGLA 4IQJA 1UMYA 1EGZA 2MNRA 1F6YA 3MBDA 5CAHA 1UR2A 3KBMA 2CHOA 4F3HA 1LDCA 1O95A 2G41A 5FL0A 1YPXA 1TPC1 1H09A 4ZTYA 1UIOA 3WBYA 1NVMA 3NCOA 2ZWZA 4E2DA 4J3VA 1R30A 2WVVB 4HB7A 3DXIA 4Y7EA 4BJHA 3UG3A 3T44A 2HV5A 3EXSA 1WDRA 2DU2A 3P74A 1BSLA 3ZS4A 4DRSA 1RCOB 2OKTA 2R8WA 4O54A 4B4FA 5HUPA 1XBYA 2DT0A 1YDNA 3WDPP 3F4DA 1GVFA 4UFKA 3W87A 2WNZA 4US5A 5AY7A 1ITUA 2YA2A 1EUNA 3PUEA 2HSAA 4MWAE 1LG2A 4MNKA 4GX8A 2GPTA 2FPVA 1UUMA 3TUUA 3OA5A 4MADA 2YXGA 3QXBA 3S5NA 3E3HA 4QQUA 4AWSA 5D9PA 1WDSA 2VZVA 1LROA 2ACSA 3TV8A 1NQ6A 4ORIA 3WDJA 1HJWA 2HQAA 1JRBA 2BVWA 3AIRA 4POCA 3WNLA 4M51A 2FTPA 1W5OA 2BP1A 3PHAA 2C0HA 1KM2A 2R1NA 2V3DA 3DKLA 1E3ZA 4BY3A 2ZCGA 1JD9A 1XLEA 1ZNNA 2D2OA 2BFGA 3V0TA 4XISA 4H01A 1SFSA 3N1AA 3WL1A 2CZ5A 4N42A 4JHMA 2CXGA 3LZ3A 4KMQA 1JZ4A 1BKHA 2OLHA 4DLFA 2R1PA 3W83A 1F74A 4REQB 4RW3A 1SFJA 2XN2A 1E6PA 4NILA 4JHZA 1K03A 4B16A 2AQVA 2NQHA 1JZ7A 4LVDA 1CB8A 2UY3A 6XIAA 2HEJA 1A0CA 1IIHA 2QUVA 1YPFA 3U48A 4IFKB 4CVWA 4MZ1A 3G3DA 3N6JA 3P14A 3L5LA 1FWNA 3H23A 5HATA 5DCDA 2Z1BA 4S1FA 1K6WA 2GUUA 2IXVA 1JDFA 4K2SA 2BRVX 1L9WA 3T8QA 2WVTA 4PUWA 4FLQA 4IIHA 4WSJA 1SZRA 4C6BA 3LPOA 4QROA 3BG3A 1A5NC 4UTMA 3NQ2A 3PS7A 3UZXA 4JQ2A 2VRJA 3IJLA 4J2MA 3OHMB 5M3WA 4P8UA 4F79A 3INPA 3C0SA 3BLEA 2PWHA 4O1AA 1KFBA 2BRPA 2J75A 2PC4A 1IF2A 2TAAA 3AUOA 1YDOA 3R25A 3FGCA 4QHRA 1W3LA 5EBAA 1IT8A 1F73A 1XV8A 4UXDA 3TA9A 1V6XA 1OFAA 3C2YA 4XAFA 1CTNA 5JXQA 1MUMA 5G2WA 2GQ9A 3W7DA 4JYEA 1AW1A 4JTDA 1OJNA 1UIPA 4K36A 3VDHA 1DXEA 3EOSA 4XO7A 3TTOA 2VEPA 1FWCC 1KCLA 4O17A 1AJZA 3W7PA 2PWFA 1IV8A 3W23A 3U5YA 2VUNA 1XLGA 1TCMA 2ISFA 3TYDA 3HO8A 3TTYA 2WHJA 3G2GA 1A50A 4ROQA 1GQJA 1JNEA 1Q63A 4KRZA 4AZ7A 3QW3A 2VGFA 3FJ6A 4H9MA 1LRQA 2DFAA 3RLGA 4H7ZA 1WDWA 3NPXA 3T8LA 1GJUA 1XSKA 4J27A 4W5UA 2FFCA 2BY0A 2VFHA 3S2LA 4FALA 5LGXA 1N55A 4M7TA 1KB3A 4GKLA 4PUNA 3WBEA 4IQLA 3VUPA 1HJVA 3AXHA 1XD1A 4PCSA 1YKWA 2BNJA 2FYMA 3FJLA 1KV8A 3WBWA 3GU1A 4B92A 1PZ3A 3DENA 3FHQA 4GUIA 1QPKA 1PX8A 1XLIA 2GYIA 1FBAA 1SZGA 3BV7A 1V6UA 2DIKA 4IMEA 2YB1A 1F61A 3P61A 1E5NA 3ABZA 6REQB 2V81A 2G95A 3CJPA 1BRLA 3T55A 3CH9A 4LVFA 3UJSA 4DWSD 5MKGB 1MVYA 2DT3A 3UESA 4V28A 4Z2HA 3JR2A 1A49A 1J0YA 3DOPA 2QIWA 3R58A 4PL2A 1PKYA 1R2TA 3W00A 3UWYA 3SO7A 4MKNA 3N73A 5E0FA 2EPNA 1YRRA 2WZHA 2PDQA 3TR2A 3EB4A 4HU4A 2WM0A 4LYQA 3PFMA 3IS4A 1DQWA 2Q01A 3T0CA 2QCFA 2XIQA 3QPZA 1XI3A 4F8XA 1H7WA 2QCLA 4GZ7A 1FH9A 1HG3A 1X1NA 3GD6A 3AHZA 4IMFA 3G18A 2YLAA 4MUPA 2X40A 4ZGYA 4XUGA 3E2RA 2J8TA 1ZU8A 5LNUA 4IL0A 1UG6A 1W1IE 1NP0A 3C2RA 4B2DD 3CZKA 1VPQA 4L9YA 4AFYA 3BICA 2BVTA 3AYVA 4DWSB 3NXFA 3CZLA 4AZHA 3P84A 3DG7A 3QQ1A 3RR1A 4GK8A 2AL2A 3W1LA 1HF6A 4MDOA 1YE4A 3NA8A 1RW9A 1DIEA 1K7XA 4F2UA 3GXFA 4Z1YA 4JTKA 2JKAA 5H6HA 2BZNA 3BCFA 4RUBA 2DORA 3WLNA 2L5HA 3HV9A 2O9PA 2G50A 3G1YA 1EJSC 2O0TA 4BQ2A 1JYXA 3UWEA 5A6LA 4OVXA 1DOSA 1WAWA 1EP2A 3K46A 4UTIA 4O50A 3U9IA 1EHNA 3PF3A 1J10A 2ZBTA 5CG7A 1OIFA 4AZ6A 5BRPA 1S1RA 1WZLA 1X1IA 3PTMA 3VNDA 3U4FA 3IJ7A 1C9DA 3RO8A 2OKOA 2VKZG 4H2CA 4WDUA 5CLWA 3GLCA 1VKFA 2C15A 3B05A 2XM1A 3WNPA 5HINA 4BWLA 2H6RA 1HW6A 5I3KA 4IGMA 2EXOA 3BL3A 4LS0A 1EPXA 3I65A 3H8AA 2WYSA 3DFPA 1KM3A 1G5AA 1LQ0A 3UD1A 1BYBA 3ITXA 4AAJA 1EJWC 1UR3M 4I6VA 2Y85A 3RU8X 1WBHA 4F2BA 1GPWA 2PDKA 4ZZ9A 3HA1A 2F6XA 1Z69A 4WJ8A 3DDMA 1GOOA 1UUOA 1DORA 3K1DA 4XBKA 2J9XA 3QN3A 1V7AA 1Y5XA 3VABA 4MY9A 1PEZA 3FS2A 4HSNA 2WJFA 4HVXA 1LP6A 1NFGA 2RDWA 1GG0A 3MMWA 3BCDA 1TX2A 3AS3A 1V7YA 2D73A 3ARUA 5FJRA 1MNSA 2WSQA 2XVLA 1S2UA 1T6MA 3C86A 5B80A 5JH2A 1GQLA 4ZXLA 1H0GA 5EU9A 1PIGA 2NQLA 4WKAA 2G37A 4FIRA 2Q1FA 3NDOA 4HNNA 5AHNA 2WAGA 4IPLA 2F7FA 4LX4A 2KX9A 1AQMA 1AW5A 3RITA 2WC7A 4LQ1A 3EOLA 1KBBA 5HWMA 3STFA 2VC6A 5K7JA 1D7KA 1E4LA 1KM1A 3OJGA 3BLFA 1RP8A 3F2DA 4OOUA 3DFQA 4DAFA 4UWMA 2FJKA 2AQWA 3WY1A 2GWGA 4WIWA 2C8NA 3RM9A 1WKEA 2Q09A 4O1FA 1XLBA 3MP4A 4JTGA 1XLJA 1BTCA 4JEQA 3EB2A 4DXXA 3CO4A 3G3MA 1R46A 5I0DA 5AC7A 2Z1XA 3ZM8A 2CKSA 3KDOA 3MWAA 3WLSA 4P7LA 3NSXA 4FLOA 5DFAA 3E1F1 2WANA 4GQQA 4HJFA 3W7KA 2V68A 1XYFA 1EO5A 3T2PA 2HVMA 1TQJA 2VFFA 1OB0A 3W7RA 3GH7A 1IEXA 1Z8AA 1E0UA 3P93A 5CGTA 5I3IA 4RPQA 4UTLA 1Z48A 3Q37A 2HRWA 4M6PA 2WQDA 3VFLA 1JZ6A 3OQEA 2V3FA 1PZ1A 1PKNA 3KHJA 3QY8A 3TQPA 4FNQA 2DH2A 1FRBA 1YBQB 2JFEX 3CZJA 3KW3A 4GIYA 5E6ZA 3E0FA 2ZX9A 5E09A 1K1DA 4U3AA 3WMBA 3T0AA 3OZMA 1D8CA 3LDVA 5CJNA 4JTRA 1XHGA 5C2CA 4M6VA 3W75A 2V5KA 2XH7A 4CCDA 4F0HA 4I5RA 3OU8A 5EMUA 4D6CA 2OO6A 3R8GA 3SY5A 4FX7A 4OWGA 3RN6A 3EPOA 4DBDA 2VX7A 2QVHA 5JUVA 5JH1A 1W5MA 2NT0A 4P7OA 1FWWA 1JUKA 3FAXA 1Q6CA 3BJFA 1MFUA 2JBMA 2B7NA 3RGTA 3HM7A 4X0VA 1YX1A 1EC9A 3A64A 1LT8A 1FWFC 1UH2A 1MWOA 1TV8A 3K13A 3F2BA 2JKPA 4X9SA 3WLIA 1W8GA 5LSMA 3B03A 3CM4A 1OWQA 5FF2A 2QDGA 3N2TA 5IDIA 2OWWA 2XTKA 1TTPA 3OVGA 3P3BA 1FHLA 3F1QA 4HN4A 3SCNA 1Y65A 4GY0A 1TKKA 4CNUA 3GR7A 3JZEA 3SCOA 4RZ4A 3BSMA 1ZCCA 1DE6A 4Q4MA 4PH6A 3DYOA 3OYZA 3FJNA 1M7XA 5ECVA 2X0YA 1O60A 1V93A 4YU1A 4H6RA 3ARXA 2VCCA 4LCSA 3KTXA 5I77A 1R3SA 4JNMA 3GTHA 2WMJA 4GY7A 5TD4A 3V3WA 4KWSA 2WSYA 4G2DA 1HN1A 4PMXA 4BWLC 2OCZA 3BOLA 3NQCA 3IIOA 4WSHA 2ZUUA 1EX5A 3M0IA 1NWTA 3L4ZA 2WM1A 3W1XA 3FA4A 2VGBA 1U5HA 2ZUWA 4M5PA 2FVMA 3W7NA 4R9OA 4AZBA 2PP0A 3AYTA 4LNYA 1WBJA 1M7OA 3CGTA 1YNQA 4LY8A 2FMNA 3SCSA 4PRWA 1IEQA 1XC4A 1K3UA 3K4WA 4GVGA 3TN5A 4GZIA 4C6EA 5DANA 3SCVA 5F4SA 3VD9A 5L6UA 1RUSA 1IQ8A 4LB4A 1Q6QA 5CGQA 1VRAB 3GHTA 3TR9A 3EMQA 3NQEA 3NOEA 1KFEA 2MANA 3S47A 2VVSA 3TLQA 3SQMA 2VC7A 1JPMA 2ZA3A 4MG4A 1NEYA 4TTGA 3VNMA 1JFXA 5BOOA 3ORWA 5CZTA 3QR1A 4A29A 3GH4A 4DX3A 4XV0A 2EQDA 2QV4A 1JUEA 3ZR4A 4GACA 4ATLA 4WJEA 2HBVA 5CQ1A 5EY5A 2E5BA 3FSTA 4ROPA 1BWKA 4ZSUA 5CPMA 2W79A 2X03A 3W1PA 1GW9A 3DN5A 3VDAA 1OFPA 1VHNA 1LQAA 4XZWA 3A13A 2YBUA 2OZ0A 3A47A 3F4CA 4I8YA 3IVUA 3N4FA 3B0YA 1UH3A 2YDQA 1I2OA 2REQB 2QCDB 3RK8A 1IT0A 2PF0A 4QRNA 4GCAA 4D1JA 3AAMA 2BB0A 5KTLA 4LRSA 4UMCA 4UFLA 4GZEA 3S5ZA 3ZVHB 3AMCA 2UY2A 1X97A 1MRQA 2J9ZA 3QZEA 3GXIA 1FWBC 4ZA0A 4S3JA 5E5CA 3URBA 2ZICA 3AI0A 3TW7A 4QX4A 4QE1A 1DPMA 3IGXA 3ARSA 1GEHA 3CUXA 1X98A 2ZOXA 2DH3A 1A3XA 3VX1A 1J0ZA 1SW0A 4JX6A 2GSJA 4H00A 1IEIA 1E9LA 1P5BA 1AA1B 2ZKMX 1EDTA 5CBBA 1IXOA 4MJZA 4W8BA 1PBGA 1FCQA 4AIEA 3QSTA 3AC0A 5H8UA 3EA1A 1MDRA 4P7RA 1LYXA 3RXZA 3BE7A 4AH7A 3KZPA 4HK7A 3IVTA 3E5PA 2WZTA 3F03K 4B3LA 1JZ2A 3TC6A 1H51A 4WQ6A 4C7GA 4DBEA 1E5JA 2WCGA 3P62A 1GG1A 2FGBA 1OJPA 1GVRA 2FGLA 3KE0A 1Z7AA 1EO7A 5K9CA 1C91A 1VENA 3BDKA 2ZC1A 4L1XA 4W7UA 3WQVA 3VOGA 3MUY1 4PTMA 2TYSA 3WQGA 4JDBA 1OCJA 2GWNA 2CLKA 4GO8A 4NAEA 4O1CA 3M1ZA 2J78A 3AIQA 3PR2A 2QCNA 3QHOA 1US2A 4UQAA 2PBGA 3GZAA 3TP4A 2GQAA 2FHCA 1KQZA 5A2CA 2VFIA 5REQA 3MY9A 1U22A 3EB3A 3AJXA 1XCXA 4MWAC 3W3OA 5CZSA 2ZWYA 2ZUSA 5HWNA 2QCGA 4PSPA 1JI1A 4Y9MA 4O52A 1XBXA 4OUEA 4NL1A 2BX7A 3W2JA 2WMIB 1EIXA 2PCQA 3O6DA 4YS1A 1VC4A 2UBPC 5CPQA 4ZODA 1ONEA 3GNXA 1Q66A 3OZOA 4H8VA 1JCJA 3SSJA 3WF3A 2PUZA 4D8ZA 1A80A 4LT9A 3OHIA 4A6GA 3MP5A 3ZT6A 4O0KA 2X2YA 4LBUA 1PXGA 4GVIA 1SFTA 4DJFC 4JCMA 1LLQA 4L61A 1XIJA 4UFHA 1D3GA 3WDQA 3UCCA 3WQ8A 2VEKA 3CASA 1C90A 1RJRA 4HYWA 3HBLA 3NEHA 1KBJA 2CYGA 2YFOA 2PCEA 2VX4A 1XRFA 2C6QA 5KEZA 2YZ5A 1BG4A 3B06A 3VGDA 4KETA 1VLIA 4LEFA 1H7OA 1XDLA 3CZGA 3R0DA 3NG3A 1JI2A 4J40A 2FDSA 1KV5A 1GTEA 2CETA 3UPMA 4GQRA 3WSUA 1KO0A 4C6CA 1ELSA 5U4NA 4H3DA 1XICA 2PLCA 3SCWA 2POZA 5EFDA 2XWDA 1VPYA 4H04A 1IXQA 4GJIA 1JZ5A 2VUYA 3R94A 4AD3A 2A3CA 3RPMA 2YL8A 4GRSA 2BOEX 4DJDA 2CW6A 3VOHA 2JKEA 4OZOA 3LGDA 1OX4B 3U8GA 4F2TA 3TKFA 2J74A 1DJZA 5AHLA 3E02A 2WVVA 1MQRA 2YYTA 5AKQA 4Q32A 1JCYA 1QAPA 4C90A 3A4WA 3FN9A 3KLKA 4Y90A 3JS3A 1FP8A 1QXLA 2Y4SA 3HGRA 1G4SA 2Z7KA 1JPKA 4L4LA 4A2SA 4ZL1A 3BC9A 1VFLA 3QOKA 4LVBA 4KWUA 3PZVA 2A3EA 4JQ1A 4BFAA 1UOKA 4YTQA 1XW8A 1TRIA 6TIMA 1J9YA 4HMDA 5E6YA 4OV4A 5A8QA 3O9NA 1YADA 1IZCA 2OEJA 3BJSA 2CESA 4CD4A 5U7SA 3N34A 1U1HA 4C1NB 5JMUA 1TWZA 3KOYA 2EPHA 1S2TA 4ECLA 4AD2A 1GZ1A 3VIHA 3ONCA 3B9DA 5IBXC 4HOZA 2DQWA 4HA3A 1XFCA 1E3XA 1JDEA 2OSYA 4RZ6A 3FY1A 3M47A 1GEQA 3WJXA 3S83A 1NY1A 3LLFA 1Q2RA 4CNTA 3SM0A 1QHZA 3HTWA 4Z1DA 3OBKA 1OZQA 3GG7A 1B5TA 3EOEA 3MV11 4LC6A 5CPLA 4MZ8A 3GVWA 3TZNA 2YZRA 1AK5A 1ZL1A 3STEA 2VJXA 4JHOA 3TJIA 3BLPX 4J4KA 1ZGDA 3W6MA 5JBFA 2ZA1A 1Q8AA 2BY1A 5DCBA 2QGYA 4J1OA 1CIUA 3QLLA 3TROA 2QDDA 3K8KA 5KETA 1CLVA 3STPA 2G5WA 4GG9A 4ZOBA 4HSHA 5CKSA 5ABGA 1LT7A 2D24A 2V6AA 4REQA 3DIPA 1QVBA 2ESCA 3KDNA 2XVGA 1MW0A 1YEYA 3AXMA 4M8UA 2Y7DA 5DO8A 4GIAA 2INEA 3SCUA 1EP3A 4IFKA 4BF9A 1PSCA 3DC0A 5I3HA 2J7GA 5C8BB 3UGVA 1TSIA 5K4ZA 4H4IA 3VNKA 4LAZA 4X2RA 4O0QA 5A3HA 4JTSA 3NQFA 3LNMA 7CGTA 2DT1A 2OGJA 3CPRA 4ZQPA 4UR7A 4ZO9A 3VDBA 5G1YA 5JQ9A 1FFRA 2Y62A 3RAOA 4DYKA 3NQVA 3R4IA 5HOSA 4MFDA 3WQ6A 3ANVA 3LYEA 4XBJA 4EANA 2DSZA 3GHRA 5LIKX 3U6WA 4HGXA 1BAGA 3WQPA 2QUTA 4EPDC 4H9XA 3W37A 4YWIA 2VZTA 5AYIA 3DH7A 4FMVA 4HMNA 3TAKA 3UBPC 4HOXA 1VPXA 4JR5A 1PVNA 2HVOA 2XZ9A 4XZIA 4AVNA 1S2VA 5LIXX 1D3CA 1W8SA 5I6SA 1M65A 5FF0A 4AD1A 1RPXA 2E1WA 2FB2A 1BG9A 1VRDA 5AZ0A 2I56A 4CN1A 2XSXA 1TR1A 1R3TA 3AQUA 5FSEC 4QDWA 5BOEA 3CH0A 2QMKA 5CBJA 2OZ3A 2V0TA 4NKCA 3ITVA 1VS1A 3V5OA 1DQXA 4OT7A 3PBUA 2R24A 2FZBA 2DUAA 3B0UX 1NM9A 4QEEA 4RK8A 3QMTA 3N14A 3P2VA 5HWJA 3W70A 1BVNP 2WMFA 3VO0A 4JY8A 4JFTA 1XF0A 4NHVA 3FEQA 4Q6XA 3IJ6A 4FP1A 2GJRA 4F9JA 3WK0A 4ICNA 4P7NA 2RUSA 4OBTA 4ZCWA 1QPNA 1C8YA 3BJTA 4MPQA 3EMCA 1ECEA 2Q71A 2BBFA 1XYBA 3NYZA 1EOMA 2QJJA 4QIUA 4AF0B 3LSBA 3AMKA 1NIUA 1R3VA 2C14A 3QVQA 1GOWA 1WXZA 5F1VA 4JIRA 5T8GA 4DELA 4CD5A 5GNYA 2E09A 3BLKA 3CB8A 1RPKA 5CPOA 4PEEA 3G22A 2X1TA 1VFTA 2OLAA 4HU0A 3CXOA 4I90A 3ZR6A 1GQKA 4WSKA 6REQA 4UQ9A 2DW7A 2NXHA 1MXDA 4RV8A 3Q45A 2E24A 5MKGA 2PDIA 4WDWA 3WQEA 3STCA 4IFRA 1MRAA 1YPIA 2RHGA 1PX4A 1F9CA 3N2MA 1XWYA 4WJXA 4B5SA 4GPNA 4H83A 2Y7EA 1E6NA 3DHDA 5EMJA 1JEZA 1IZKA 4DZHA 3B4YA 1WOBA 3KXQA 4PBEA 3WEZA 3VOJA 3MYPA 3RR4A 1LRNA 4DZIA 4JTFA 2ZQ0A 4YXGA 1LORA 3M0KA 1LOSA 1UBPC 4CLMA 3LV5A 1CXFA 4OV9A 4B5UA 4H6KA 3NOYA 3TK7A 3BAXA 5LNRA 1E55A 2DZBA 1YNPA 4ORMA 5I79A 1RJQA 1Q6EA 2PWVA 1AH4A 2QJHA 2IXUA 2PDFA 3QFWA 1CXLA 2X0HA 4C6FA 3P80A 1GVEA 1W17A 3TJLA 2OX1A 3EWUA 1T41A 4YTUA 6TAAA 4DWSA 1MZHA 4FNTA 3WK3A 5C9UA 1QMLA 2C3ZA 1YE6A 3BSGA 1J2BA 1SFLA 3O16A 2GVLA 4MTVA 4WKHA 5CSSA 3QMSA 2V3GA 2ZDRA 1K02A 1TREA 4R85A 1BGAA 2G4JA 2PE4A 2ZC8A 3KX6A 3L2IA 4NP7A 3EWCA 3ITTA 3GDBA 5IOBA 3UG4A 3VU2A 1KFWA 4Z0JA 3CNYA 1JYNA 4KEZA 5CC5A 4R7OA 1J93A 5A8OA 3SN1A 2QCHA 3CPGA 4PC8A 3RLUA 2QPSA 3XIMA 1KNWA 1K9EA 1P6CA 1WP6A 3WUEA 1WZKA 3N3TA 1RV8A 4YYFA 1RK5A 4MJ4A 5J8LA 3ABXA 1KKRA 3S0CA 4B2DA 1O12A 1N7KA 4TX6A 5CSYA 2ZYFA 1OFDA 3VOCA 2HZGA 4XAYA 4URIA 4DWDA 4DYJA 2P8BA 1UP3A 1PS9A 1LZOA 5GQBA 1W1A1 3EWYA 3LEPA 4OE7A 3LLDA 4Z08A 4MNLA 2V2DA 3NZ1A 1HO1A 3GQYA 1HXJA 3RF9A 2CHRA 4RE3A 3WLKX 3EMZA 4PSRA 5HBFA 5DRCA 1OJOA 1NF7A 4XD4A 1XGEA 5LIWX 5FF3A 4ZTXA 5FIPA 2EJAA 3GYEA 5C7VA 4IH3A 3L68A 4RR4A 5E93A 2J47A 4LUIA 3UD6A 4A8NA 1KM0A 4W86A 1S38A 1NOFA 2R1MA 3L4WA 4GUFA 2GDUA 4LW7A 3VIOA 4AEOA 3QR0A 2O4QA 2DJLA 3PSVA 3M44A 3H2NA 1AZ2A 4ES4A 2WZIA 1WAUA 4UTUA 3M0XA 3U2ZA 2OFJA 2C79A 2WJZA 4JFVA 1EZWA 1O4UA 4TV5A 3NSNA 1XSJA 2PD9A 5TNVA 5FF4A 5EKYA 1XLKA 3AWNA 3N3MA 4A3HA 2FZDA 1G9HA 2EG7A 3VNIA 2WXDM 3VA8A 3HG4A 1GOIA 3DHPA 2I57A 3MJYA 4O4WA 1U1UA 5HR6A 2FTYA 1B9BA 1UASA 6XIMA 1UA7A 4L1WA 3GG8A 1QTWA 1HL2A 1DL3A 1W9DM 1ZB5A 4JTTA 3SGUA 1TQXA 3BGJA 2AQOA 2W92A 4U4MA 2DZXA 1B31A 3VC5A 1XIFA 3NL3A 2VCAA 2VEGA 3EXTA 4RDWA 2H9AB 1UUQA 3WYZA 3DUGA 2VVNA 3CLMA 4BK9A 1GYLA 3KAOA 1VR6A 3BLOA 4IX2A 3LBCA 1E0XA 1J0IA 1BYCA 1PCKA 4JYFA 1Q5MA 3MVIA 1M5WA 3L0NA 3ZVIA 2HISA 3WLPA 4IF2A 4E8GA 1LOQA 1BGGA 4E2OA 3ITOA 1SJCA 1X38A 3U7BA 1EJTC 2VWSA 5FAGA 3PBGA 3GS6A 4XZ9A 1QI0A 1EX1A 4W5ZA 4ASTA 2X30A 3BQ6A 2X0SA 1XDMA 3VZYA 3BLIA 2E6AA 1DWHM 1SO3A 2DSKA 3HOJA 2W61A 5FEZA 1LOLA 1W1TA 5GJMA 1TV3A 5BYWA 2P5NA 1W9VA 1WUEA 1S46A 3R7MA 1R86A 1YBQA 2VD8A 3AMDA 4W8LA 2WWCA 2WCSA 1DYSA 1KLYA 3R13A 3F4NA 3W27A 3UWWA 1ESWA 1FX6A 3TZFA 1XL9A 1R3WA 2D1ZA 3IRSA 1EGMA 1AJ2A 5JBDA 4NT0A 3POHA 3LXCA 4ZR8A 3C2VA 3BLLA 1W91A 4Q8QA 3WFAA 3C3NA 4QLJA 3O07A 1W1YA 3HPAA 3RX4A 3A12A 4S3AA 5C70A 1HX0A 4ZO7A 3OLGA 2Q6ZA 3A3HA 4Q8UA 1XM3A 2WDAA 2PDHA 2FDMA 3AO0A 4QAIA 4LBRA 2QIIA 3SIZA 1QNPA 5BNKA 3VVGA 2PLJA 2V82A 4GI6A 3AXKA 1LOHA 3L65A 4M7SA 1PL9A 4IMGA 1KM6A 2VCBA 2J6VA 1J12A 3QC3A 2E68A 1RQBA 3U57A 1UKQA 1I2NA 4O19A 3LM3A 1THFD 3W38A 4JBRA 4Z0SA 2J79A 4ENLA 1W3JA 4EPEC 4Q4OA 5HJXA 3GVGA 3DC8A 3FDGA 1I0DA 1V02A 2Y7FA 2XWEA 3WDIA 1NJJA 4DNMA 2OSXA 1SW3A 2VRKA 1DTUA 3WQWA 4D6HA 1JVNA 1E0VA 1QUMA 2Z1VA 3REQB 4IG2B 4XZBA 1VEOA 1ZY9A 3P0WA 2DP3A 2YCEA 2NW0A 4UR8A 3IUDA 1QNSA 3NPWA 2CBIA 1N8FA 2DY3A 4I9AA 3W2NA 2B7QA 1XKJA 2BXVA 4S39A 5H2ZA 1T7LA 3WMSA 4G56A 1U5JA 3K5XA 3AFBA 3UXAA 2QJIA 3V5FA 1L6SA 4JCLA 4ZB5A 1E1EA 3KFTA 4LPCA 4UOQA 3DGRA 3V1HA 2DIEA 3QGVA 2YXXA 4WDTA 3LQGA 8TIMA 5IDZA 1AQHA 2BLEA 5A8NA 2H3BA 2XH4A 1YQ2A 1O5XA 1BKSA 3IANA 3N13A 3L0GA 2YCLB 4ML9A 1ZZMA 5CCZA 2OT0A 3U3HA 4A8RA 3W1NA 1P1MA 1F2JA 2ZZ2A 3BV4A 4MB3A 1G7UA 1OF8A 3MWCA 1VJSA 1RWFA 3QTGA 1VQTA 4IMDA 3CQHA 4CEXC 1R7AA 2E9BA 5HDRA 4OJYA 1HTIA 3CB3A 2OZTA 1E9ZB 2PTWA 3N25A 1QW9A 3S1VA 2A3AA 3WD4A 2CHNA 1S5TA 3FXYA 3EKLA 4IOTA 5E9AA 4QLKA 1E56A 1KRCC 4H1ZA 3FA3A 3WLMA 4E2VA 1MXGA 4EPKA 2V63A 2P76A 2D22A 4BQ5A 1AH3A 2A7RA 3W6YA 1NDWA 4GYPC 1UKTA 2F2KA 4DZAA 1J5TA 4LU0A 2REQA 2QCDA 4MAZA 3WNNA 3GE7A 1AQFA 2YR1A 1PB0A 4JFUA 2OYKA 3FFSA 3P0XA 1FFQA 2EBNA 3QC0A 1XIGA 1RQHA 4PUKA 4C5ZA 4FF7A 3ZVHA 4UTWA 3O8AA 3WO8A 3B97A 1UR1A 1I75A 2PU1A 4S3EA 1UD8A 3CV6A 1N7QA 1UJPA 1W3TA 2V4IB 4I9JA 3KL0A 3GBDA 4A3QA 4HP5A 4E8CA 3W2KA 1GQNA 4PUDA 1JCMP 1I1XA 2NWRA 1VJZA 4CVUA 4XD5A 3TXVA 3NQAA 1I60A 1H0IA 1BLIA 1HMWA 1E71M 4Y6GA 3JVAA 3UY8A 4GGHA 2VC5A 5EB8A 4ZE5A 2DZVA 3G5EA 3PANA 3MC5A 4FXJA 5DRIA 3MT1A 3IT6B 3N11A 2DPEA 1XJBA 3PNZA 1G94A 4GI9A 1LTDA 1NH6A 1EF3A 1O68A 1Q6FA 2XJ7A 3FW6A 3LQLA 4GYJA 1KR1A 5D2XA 1W5PA 3FYOA 3I3EA 3R89A 4PMYA 5FEWA 3LHWA 2NVDA 2Z28A 3FYYA 4PCFA 3T6CA 5D33A 2ZX6A 4GNVA 3BCJA 3S8HA 2CCRA 3I3BA 1E4IA 5H91A 4TXEA 5LNVA 2RDXA 5A8GA 1K8CA 3VIMA 3AS1A 1FA2A 4AY1A 3H2OA 1QOXA 5CSRA 3VILA 5BXTA 3HZ3A 3DESA 3N18A 1B3WA 3TWAA 4AHOA 1OY0A 1E6RA 4C6JA 2YL5A 1RLDA 1W1ZA 1X6NA 4ZQNA 4GX9A 5A94A 2X16A 3KRZA 3TSDA 3GDRA 2GJPA 3DFNA 2IPWA 4AYSA 7ENLA 3TJXA 3SBFA 1EF2A 4CNNA 3PUDA 1E6ZA 4H6QA 5B7ZA 2ACQA 2VOMA 4M3PA 3H2EA 1VB9A 4Y9OA 5AYZA 2HBXA 4J2PA 3UZ5A 1EQPA 3HQPA 4DLQA 4I7UA 2AMGA 3T07A 2BTMA 2HNHA 4MWAD 2WMIA 4F48A 2ZTJA 3PBVA 1RH9A 1UHVA 3BZJA 4HTBA 1R3YA 1RWHA 5I00A 3L4XA 4X2PA 3VD5A 4FAMA 3MHGA 3TONA 1G6CA 2RAGA 3H55A 1CDGA 1NP2A 2PPGA 3GFZA 3T40A 4EXAA 3GW0A 3RX2A 3B8SA 4KFNA 2C1IA 3C61A 5KZMA 3BAIA 1TMLA 1A3WA 3CUFA 2J66A 1V0NA 4C91A 1ODZA 1W3IA 1R87A 3R8RA 1K9FA 2A3HA 3W6LA 3AZTA 2V5BA 4DJFD 4JYDA 4QSHA 5AHIA 1A3HA 1V03A 4JEJA 4ERGA 7TIMA 2Z7GA 2X8RA 4HPGA 4WKFA 3KUMA 1QNOA 3IWPA 4DO7A 1LM1A 4JTHA 3PQIA 3L4VA 4MWAB 2G96A 3KRUA 4MPKA 3MO7A 3WDRA 3OVPA 3T2OA 3RMJA 3JW7A 1ZS2A 3NUKA 1XG4A 3K30A 2CLHA 2R82A 1V02E 2OZ8A 4HHHA 3TH6A 4MVAA 1V0LA 4KRTA 1HN0A 4D71A 3E49A 4M19A 3B8VA 3C8NA 1TUFA 5I24A 3L7RA 3LD5A 1OHLA 3GHUA 3QQWA 3VUSA 1GGOA 4O57A 1IHIA 3EWXA 2BHZA 4YHEA 2GQ8A 2WNWA 2NLIA 4ML4A 2QZRA 3MMDA 1KXQA 3FXGA 3NQMA 3XISA 2WPBA 1EHAA 1VRXA 3LRMA 4JIEA 2J7FA 4QQ3A 2HVNA 1OX4A 3RFAA 1M7PA 4UQBA 3NJ3A 5ENLA 1V6YA 2QF8A 2WNNA 2OSWA 4DI9A 1UR0A 2WLZA 4TV6A 4GINA 1H60A 1CGYA 1GONA 2OYLA 3NDZA 1GW1A 4HCDA 1WDPA 4MF4A 3W4RA 3VPLA 4LEQA 3W2LA 2ZRWA 4CCCA 2HPMA 1IWPA 3KBUC 1MW1A 5G4WA 2I1OA 4LANA 3DHUA 1OADA 4TTUA 4E5TA 4IX0A 3W07A 1KWGA 4KFOA 4LCRA 4X60A 4C1NA 3D5HA 1QI5A 3FHAA 3SRFA 1LUCB 1OG6A 3SCTA 2V5LA 1E72M 3R11A 1WPCA 2XYLA 4P8VA 3SB0A 4HU8A 4HMEA 2A2IA 3V35A 1EA9C 1A5AA 1DXIA 4FXRA 3NO1A 3A23A 3B9OA 1KFKA 1TX0A 4UBPC 3U2CA 2CPUA 3HF3A 3S9IA 5A6SA 4NJIA 4CNPA 1S5WA 3LX9A 4HOWA 5ABHA 3MQTA 1X1OA 1Z89A 4FNUA 2PDWA 4HZ7A 3UWVA 1B90A 1R9YA 2GUBA 3VMNA 3CV1A 5PTDA 3IT4B 3W7IA 1FOBA 1EFZA 4AISA 3OTRA 4B5XA 5FJOA 4HT3A 3KRBA 4AMAA 2DW6A 4FOKA 2Z2UA 4DBSA 3M5ZA 1UQYA 2PAJA 2Y6ZA 4NQ1A 5AHEA 2EJ1A 1HUVA 1QT1A 1C7TA 3ARTA 1DWAM 4RNHA 1ONXA 2ICSA 8CGTA 4AZCB 1E6SM 1B3OA 4Y96A 1UB3A 4PMZA 1XCFA 1VYSX 3JZUA 4AYGA 5BXPA 1B54A 1O7AA 3C0JA 5A1AA 3TU9A 3AS0A 4YVVA 1WYIA 4GNKB 1QJWA 3CYJA 4MIMA 1VD6A 1VEMA 2B81A 4PCTA 4J35A 1F3XA 4DO4A 4OQVA 3D3FA 4FX8A 2NX9A 1N7NA 3E0WA 1W1B1 3W7MA 1I6NA 3THDA 2QULA 4LSBA 3NFUA 2JK2A 2WLYA 1UWRA 4HNOA 1G67A 3T42A 1FDJA 3UJEA 1UWAA 4XBSA 1KGUA 4ATWA 1PZ0A 3TDFA 1QWKA 2FLIA 1C7SA 2JALA 2I16A 1I8QA 1Z32X 1SMAA 3PWIA 5E9XA 3N4AA 4L5ZA 1VBGA 1RR2A 1Q13A 1WKYA 4U2YA 3WH7A 3HB9A 3TYEA 5K9XA 2Y88A 5L9FA 2WC4A 3ZJ8A 2QV5A 3PN8A 1VBUA 4S23A 2QUNA 1FTXA 3TVAA 1J0HA 1XYLA 1NDZA 5G4EA 4AHPA 2DT2A 1C9WA 1R6WA 3LCGA 4ZENA 2DGAA 3MUXA 2PGWA 5AYBA 1G4PA 4US6A 5DMYA 2HDJA 4V27A 3EPMA 5HPOA 4FXFA 2D2HA 3BOXA 1F05A 2OB3A 5I5RA 1NDVA 5C54A 3L2LA 3B0VC 4GWEA 2FQIA 4RDYA 1KFJA 4Q8VA 4JIIX 1OYCA 1XLAA 4O15A 1NELA 1O5QA 2W9MA 3UQNA 1BXCA 1XRTA 2ATMA 2ZRZA 3VXGA 1TJ1A 1XYZA 2VDGA 4UTTC 1CLKA 3DGBA 3PVFA 4WRHA 4Q4QA 3JU2A 1FXQA 1P7TA 2CLIA 1JF5A 3M6YA 4XB3A 3P82A 3OW1A 3GTIA 1OBAA 3SEPA 3TLLA 3TMQA 1BVZA 1SSGA 8XIMA 5BRBA 2G3MA 1UW9A 4IPNB 1UZ1A 1T8QA 4AF0A 3KCJA 3UR8A 3A21A 3UWUA 1ITCA 4JKKA 4ZMGA 1MNZA 2XVPA 3PBWA 3CMJA 4HD5A 2C1GA 3H7UA 5A95A 4ZB0A 1L2UA 4WUIA 1X1HA 2G3JA 3VDCA 5K2ZA 3I6TA 1HIZA 3EXRA 1E0TA 1KBLA 1S2CA 4JXCA 3WLOA 2CU0A 3CHFA 1EZ2A 1OYBA 1XX1A 3EKZA 3GC5A 4O4VA 3PZTA 3WF0A 1EJ7L 3A4JA 3K4DA 3KVLA 5I3DA 3GTNA 4OECA 3NSMA 5FL1A 3SGGA 2ZVIA 3CT2A 4UMAA 3PY2A 4ZOAA 1J4EA 5C7HA 4O1BA 2XSBA 2GVEA 9CGTA 5CEWA 3TE9A 1EBHA 4NSBA 2NSXA 1A5OC 2BG5A 4WVXA 1RY8A 4EX4A 3NQGA 3LBMA 3MUAA 3OIXA 4AWUA 2P8CA 5J5DA 2OX4A 4XG1A 3F59A 3VMOA 3W73A 4XIMA 1KXVA 1VIWA 1MDLA 4ZO6A 3U2OA 2YEPF 4HQVA 4B91A 3CS2A 3MI2A 3S3GA 2GSEA 4HJWA 5DBTA 3MKKA 5T9CE 3HQ1A 4KCWA 2E4TA 4DY1A 3I7RA 2QDEA 3QKZA 1L6FA 3BG5A 5C9ZA 1DJNA 3TNBA 4W9TA 1RZMA 4EVZA 4PZVA 2ALRA 3LHUA 2AKMA 1QNVA 4QE5A 4D6FA 2WKLA 3UU0A 3TW6A 3UXKA 2J27A 4PGLA 1WZMA 2H90A 4JZ5A 2XIIA 1QWGA 2PWUA 1EB3A 3QY6A 5CG0A 2Z4GA 3W1MA 3LPFA 4IQEA 3WZ0E 1RA5A 1EDGA 3LMZA 3RHGA 3WH5A 1NOWA 2Z1WA 2ASHA 3VNLA 4Q8NA 4GABA 3TQKA 4IGHA 3TSBA 4GBDA 4AMCA 1R9ZA 3VIKA 1KTCA 3N2XA 5I3FA 4NZJA 3WMLA 2VMFA 3OVRA 1OF6A 1XFBA 3W22A 2V9DA 3FEMA 4QTGA 1JGMA 1T40A 2DZTA 3VK5A 1J6PA 2Y70A 3VKCA 4Y9AA 2EF9A 1SU5A 4IP4A 3QZAA 5AVNA 4I9TA 2CBUA 2J7CA 3L4YA 3LB0A 3W02A 4V1XA 4H7VA 7A3HA 1J18A 5ABFB 4GQBA 4AQLA 3URAA 1J5SA 2WWDA 4H8NA 2E6FA 4LUSB 4XIAA 1QHOA 1F07A 1W32A 4AZIA 3SJ3A 2FTWA 1LBMA 4ZEPA 1HQTA 4I5XA 1ZAHA 1FDYA 3BZGA 3U4AA 3NVDA 2BGSA 3EX3A 5DELA 4DUVA 4ACYA 2BGQA 3MW7A 1JCXA 3PZNA 1AL7A 1L0PA 4XZNX 1B4KA 3TOPA 4HN8A 3NZQA 4NXSA 1XR2A 5HQEA 3JRKA 2VI0A 5EFFA 3L0KA 2E67A 3WQOA 1L6GA 1N2VA 7ODCA 3H2MA 2Z1KA 3EZ4A 3A6OA 1HJXA 5ABTA 3HGSA 2ZZ3A 5HPCA 3MV01 3TYZA 4H8UA 4FEZA 2ZTKA 4IWWA 2WVUA 3MCOA 4UCFA 2V69A 3MCNA 3H4WA 4FX6M 3GNDA 4OHQA 2E40A 4AHQA 4G9PA 1OFQA 1WE5A 1R38A 2EPMX 1M1BA 1CYGA 1XINA 1AODA 2UY4A 3NL2A 4XVEA 1ZBKA 3V16A 2R91A 3UXDA 2A85A 1FKWA 3H26A 3NGJA 3EEZA 2YCKX 4HHMA 3MO4A 4W89A 4W7VA 2H9AA 1FWRA 1GVQA 2VURA 2EPKX 1XISA 3BAWA 2BODX 4DM2A 4M1RA 1DBTA 3NWRA 4I8DA 1SJDA 2YCJA 4GI8A 5CZJA 3ZJKA 4LVAA 5CC6A 4KCTA 4N9EA 1Y5WA 4AEFA 4OBRA 3PJWA 2X7WA 3APTA 3VZXA 3W9ZA 4JFWA 1EC7A 3GKAA 4MLRA 2PLKA 2INFA 3HN3A 1X8CA 3TYAA 1VBRA 3LXBA 4HSOA 2GVGA 3E5BA 4LS1A 3T08A 3ARPA 4P8XA 4IXHA 2UWFA 3C2FA 3ZFHA 2X2GA 1OJMA 4Q8WA 3KLLA 4A05A 3NYDA 2YW3A 1ZCOA 1FWJC 3ZYZA 3GH5A 2QNEA 2EO7A 4YTSA 1RK6A 3GIQA 4DUXA 4Q33A 4KEUA 2HK1A 3ZT5A 2QCCA 5LXXA 2PTYA 2E28A 2GSHA 3I68A 1OT1A 4JNZA 3CAKA 1SO4A 1UH4A 1K6AA 4R88A 5T26A 3N12A 1T5AA 4PB5A 1KLZA 3BTNA 3K8LA 1E1CB 3OYXA 3CHEA 2Z2BA 4MGGA 2ZXDA 3BQ5A 3ZWSA 1FWGC 5C55A 3MI6A 1WOAA 5CC3A 1MEIA 4JTAA 1RY0A 3W7QA 2YDAA 3LI1A 3L23A 2QUUA 5D8ZA 1H4PA 3ANYA 1PYMA 2Y8UA 3M0JA 2VQUA 4UTFA 4TMBA 4H6EA 1HKJA 4Y9PA 1V4YA 2PMQA 1F4AA 1B3YA 3QY7A 3VKBA 1Q6DA 4HNUA 2PA6A 1Q65A 1ICQA 1AD1A 1PTDA 4MOZA 3OZYA 4LY4A 3EWDA 5DMNA 3CQIA 5FEXA 1F7BA 3EDEA 3N9RA 1KRAC 5AECA 1CT5A 4H9YA 3SUUA 4EP8C 3QPEA 4F40A 2OOFA 3RRAA 4AVOA 2Y8KA 4A3YA 4ZOCA 2HPIA 2Y89A 3GDMA 3NGFA 5EPDA 4PL1A 4D6DA 3KL5A 2JF7A 4A35A 3CUHA 4ILSA 3CQKA 4LYRA 4B5TA 2ACRA 1PZ2A 3REQA 1ZAJA 4IG2A 2VHLA 5CZ0A 3AALA 1V3JA 2JGYA 4WOQA 4B9ZA 3SN0A 3CK5A 4N4PA 4WY0B 5C6MA 1Z42A 1AW2A 1HMUA 1KBKA 1WQ5A 1C82A 3QEZA 4AIUA 4ONVA 3RUBL 1WX0A 3AROA 1FWHC 2QT3A 3L2MA 4J3XA 3QHNA 4YTTA 5KZEA 2YBTA 2W0UA 3UJRA 4H7CA 2NWSA 4UZUA 1CGXA 1EL3A 4TMCA 5A69A 4WZHA 4FO4A 3ZOAA 1HL8A 3OOQA 1BYAA 4YJ5A 3M4HA 3NPUA 2YCLA 1B3ZA 3UVAA 4BI6A 4Q4KA 4GNJA 3F5JA 3HGJA 4U28A 3WF4A 1NSJA 3QYSA 3DKJA 2V8ZA 3WN6A 3Q2DA 4PB3A 4UUIA 2CNCA 2VDHA 4J5NA 4B4HA 3DYPA 3CT7A 5JIPA 1W1VA 2YKKA 3GTXA 1XS2A 4IIEA 4HPNA 5F2GA 1E15A 3W1UA 4K38A 1WA3A 3AOFA 3W25A 1S39A 4AD0A 2HROA 2Q8XA 3RX3A 3VIGA 1P6BA 1E43A 2WKGA 4KKXA 4P8WA 4XQ6A 4PODA 3D3AA 2FKPA 3A4XA 4G8TA 4TU1A 3W01A 1PE1A 2VTFA 4K1WA 4K8EA 4E8DA 3V36A 1JQVA 2XH0A 5HMEA 1RA0A 3W88A 4PTNA 4DF1A 3A9IA 2PDJA 2NQJA 5AC4A 3GUWA 1YNYA 1QHPA 3IIPA 1J0NA 2TPSA 1GKQA 1W9XA 2DDXA 4K6AA 4FB7A 4NYUA 4MMWA 3AYSA 3VGGA 1X6UA 1GT8A 1L8NA 3W29A 1EOKA 3LPGA 3QQ0A 4RNFA 4QITA 9RUBA 4QP0A 1JPHA 3ES8A 1BHGA 1PIIA 2VP8A 2ONEA 3TX9A 4KWWA 5J5RA 1TYGA 3ZXWA 4FNSA 3GU9A 5BROA 2MUCA 4IT1A 1H49A 2XIMA 5AB3A 2B7PA 3B8WA 4KEMA 2W66A 5FI8A 5M2FX 4HZ8A 3ECQA 1GVYA 4UMBA 3SFKA 4W87A 4TX8A 2QHAA 1W5QA 3KCOA 1QRQA 4GFSA 2XINA 5FEPA 1QOPA 2Z27A 2WZEA 4EXBA 5I3JA 1AL8A 3ARRA 1I9CB 3T1GA 1IXNA 1E9IA 4L4PA 5GNZA 2EPOA 2ACUA 3OPSA 4CD6A 3U7VA 2XFRA 1KM5A 3ID7A 3VCNA 5XINA 3IAQA 3I4KA 1R5YA 3BOFA 2C19A 8XIAA 4MKVA 4AU0A 1PTAA 2NVAA 3HG2A 3V0UA 1M9HA 4H9UA 4DJEA 1V3LA 3UWZA 2BWGA 3BLDA 6ENLA 1VFSA 1XYCA 3IV8A 3H7RA 1KXTA 2EKCA 3R0KA 3DX5A 3EOUA 3H2FA 3PUGA 1KR0A 3K8MA 2ZDSA 2Y2WA 5DMMA 3PK7A 4RZBA 1PAMA 3CYVA 1M7JA 1XH0A 4XAPA 2R1LA 1BXNA 1CWYA 3QBUA 2VZOA 3GNOA 5C9WA 4E3VA 2PI6A 3QF0A 2YCIX 1EP1A 1A5MC 4CD8A 4A8LA 4FHAA 4A3RA 3SUSA 3E2VA 3MI3A 1RVKA 3WKZA 3IGSA 3O0KA 4CN4A 5CZKA 3BGAA 2CERA 1EYWA 5M5DA 2WKJA 3V75A 1W2VA 3N4EA 4JTUA 4IUOA 1SR0A 4LUJA 3F5KA 1FHDA 3AIWA 1EJXC 1EA0A 5EMKA 1MUCA 2GOUA 2QCMA 1FP9A 4ZE4A 3KCLA 1H11A 2WHKA 1GTHA 4QG9A 3H2AA 2ZZ7A 1Y7VA 3ZSSA 3WLLA 4G6CA 3I10A 3WBXA 3S6DA 3B9AA 1V6VA 1RBAA 1FCBA 1US3A 3WH8A 4PN2A 4YPJA 1HT6A 2X42A 4QR6A 4DBWA 4L56A 1EGUA 1JRCA 1V0MA 2VM8A 3GB6A 4PBGA 3RO6A 3G8EA 2F6KA 2SFPA 3FV9A 4AB4A 1F3EA 5D05A 4LF1A 3B8IA 1D3HA 5FJPA 3M5VA 5MHBA 1MQPA 1EJVC 1SPQA 4CQCA 1TPFA 1OGGA 5DY3A 3WLJA 3CIVA 3G1RA 3MJMA 4MWAA 4M24A 1RBLA 4O13A 1LL4A 1S5VA 5I3GA 4PULA 4GH1A 5C2XA 1VFHA 1XLCA 4NVTA 4EXQA 2Z6JA 3ONBA 1OX6A 4HZ6A 2B31A 2HE8A 4PMVA 2J7HA 1CX9A 1LCOA 3M5XA 4V2XA 3CMGA 3ARZA 2NV9A 3G0SA 1DIOA 2OELA 2PF8A 1BFNA 4TVUA 2OODA 1JJKA 4AC1X 3DYMA 2AMXA 3CC1A 4DJFA 3WJZA 4JTQA 3AIEA 4C6KA 2PDGA 2BDQA 3E0VA 5AC6A 4JKLA 2QUMA 1YXCA 2Y1HA 2FH8A 1LQ2A 4LVGA 4ERAA 2PRHA 4IIFA 5D37A 1JIBA 3WUFA 4G7EB 1A0DA 5BRQA 3THCA 1QPRA 1I0BA 3CL8A 2VOTA 1LL6A 4J3TA 3W81A 1NFPA 3PJXA 4Q6JA 3ABSA 1ISYA 1RHCA 1WDQA 3W74A 4S3FA 4V33A 3G77A 1TZ9A 1UWSA 1OCNA 4YCOA 1TUXA 2NSOA 2ZRUA 3M0YA 1LLOA 4KESA 3W72A 4GXPA 1POJA 2WSKA 3NDYA 2POTA 5D9NA 4Y8EA 1LUCA 5LHFA 5HAOA 3OBAA 1O94A 3GSMA 3HPXA 3VAVA 4AXNA 1FKXA 1AZ1A 1S5NA 4FZIA 1NTHA 1HZYA 2LLEA 1OC6A 2AAMA 4OFCA 3G1VA 1KTBA 4GXMA 2WCAA 3ABOA 2WNQA 4JTIA 1OIMA 1X6LA 5FJIA 3A9BA 2XIOA 2GGHA 3TW9A 1JFHA 5AFDA 1DJWA 3M07A 3FLUA 2DEPA 1JZ8A 1D8WA 1D7FA 2OTDA 4NU7A 2XPKA 3SCRA 2IQ0A 4AWEA 1KCKA 3LCFA 5I07A 3EDFA 4LWWA 2V30A 3WCZA 5CPNA 1TB3A 4S38A 5G5IA 3IJQA 3QM3A 2CC0A 3D0CA 3CLWA 5A6BD 1VYRA 1AVAA 4MSSA 2A79A 3TN6A 3TA6A 5AZ1A 4K8HA 3AXXA 1ZUAX 5IBXA 3W24A 4AZCA 1HFBA 1XIIA 2FJUB 1EPVA 1FCUA 2J8FA 4DJEC 4NAEB 3G6MA 4QCFA 2VYOA 1UKOA 1QOQA 4UTKA 4FLRA 4U5IA 2FPYA 5F2LA 2WJDA 4L9ZA 3ITGA 1W3KA 1IT7A 2C13A 3PB2A 3WD0A 3L12A 3N2BA 3ARVA 3VNJA 2FZ9A 2WZMA 1ZRQA 2NXIA 4BHYA 1ODUA 4QISA 3EEGA 1B30A 1TV5A 4DO5A 3I6EA 4NNBA 1O5RA 1J2WA 3WENA 1VGAA 3GTFA 3IPWA 4AY7A 9XIMA 4JIPA 1C8VA 2DIJA 3A4AA 3PAJA 1GQIA 2G4FA 4HNVA 4GJJA 3L5MA 4JS3A 3OO2A 4GHRA 4K39A 4LUTB 4LYPA 3V0SA 1HNYA 3NR0A 4DHGA 4DNHA 4LC8A 3PM6A 5D8WA 3NZGA 4UQEA 1TWIA 2Z25A 3B0PA 2PGEA 2CBVA 3GVRA 2VFEA 1JCNA 3QTPA 1SJBA 2VL4A 3IVSA 4BI5A 1KCXA 1TO3A 4OBSA 4GISA 1RXOB 1UWQA 1I2RA 4CEUC 3KTSA 3H6OA 4IJBA 1V6TA 2E9MA 4JQ3A 3V5CA 1PPIA 3O0FA 1TIMA 3UR5A 2AGTA 4JTCA 4L6OA 1TPDA 2E25A 1A5SA 2HWGA 5EMLA 4DN1A 1XIDA 2C91A 3PJTA 1IGWA 5DY2A 2ZUMA 2VRQA 1ZLPA 3IGUA 1XIBA 2VQTA 1EQCA 4FNRA 1CCWB 4ZSTA 4GIEA 2F84A 1ZBVA 1YIXA 2A3LA 3HPFA 1PX3A 3T7VA 4A4AA 1VCFA 3THAA 1MSSA 3UERA 4K8GA 4AW7A 3LU2A 4FS9A 3P7YA 2AAAA 1HJQA 3QPYA 2OEMA 3GO2A 4WX2A 3PPHA 4XZMX 4KCUA 1GKRA 1A4MA 3SDOA 1FWDC 4WXZA 4DB7A 2W4XA 5HJLA 3VFCA 5BMXA 3XINA 3S6TA 1OVDA 3EYPA 3WQFA 1OZMA 1YMYA 4ALDA 3GK0A 2VEIA 4NZ5A 3VM7A 3CWOX 2QJMA 5EA9A 1UC5A 3EWWA 4CN6A 1V3HA 1ZQ5A 1ZBWA 2Y5EA 4DBUA 1R7OA 2CLOA 2Z24A 3DHFA 2FFIA 4RNJA 2A3BA 1R8LA 4YVXA 2Q8ZA 1QNQA 2XN0A 2J13A 4UFMA 1KXHA 2Y7GA 3VKJA 5I09A 2ZX7A 4QFUA 3GUGA 4HCLA 1Y0EA 1U83A 1J0KA 1QI4A 1ZALA 3N9KA 4RDVA 3ITLA 4MB4A 1V0KA 4JOMA 4DVOA 1RLCL 3RRXA 3FIGA 4XKYB 1TMQA 3KS6A 5C5YA 7REQB 4JY9A 4F0MA 4PTVA 3G1SA 3HJZA 5HR7A 3H21A 2W5FA 3ITYA 4NJKA 1WO2A 2QYGA 2OQYA 4F0KA 4P61A 3SY8A 4QDMA 4GGBA 3CHVA 1DWGM 3OQ8A 1XIMA 3M0ZA 3PPCA 3MHFA 4IJRA 1VH7A 4QS5A 4XAGA 3K1GA 1TV2A 3L9CA 2YDSA 1I2PA 1Q4WA 4HIBA 3OP2A 3MPGA 1XLFA 3KBNA 2WMHA 5FOOA 3B0XA 3A5VA 3MMUA 5LKYA 5CJ5A 4H9ZA 2Y5JA 4UOJA 4NZ1A 4L6DA 3SR7A 3R6IA 4DUWA 2F2HA 1OK6A 3R0UA 2F8QA 3VD4A 1OEPA 1DIDA 3F7JA 2O55A 4NX0A 4NYYA 1CI1A 1HKIA 2C7FA 4MNJA 1XRSA 1SJAA 4Y2WA 4JN6A 4F4RA 1JPIA 2DZPA 4RNIA 3BURA 3GC2A 3ME3A 4J28A 4HA4A 3W85A 2ON3A 1H2JA 1UPPA 4RE2A 5A6JA 1LWJA 4JL1A 4IP5A 4FIQA 2GOKA 3SGZA 2TMDA 1PHWA 4NAFB 1UZ4A 3W1RA 4Z2IA 3MTWA 1V79A 1H62A 3L4TA 1Q6LA 1TMHA 3GM8A 1REQB 3BO9A 4JX5A 1ONRA 2E8ZA 3WQ5A 2ZRVA 1TFVA 5CXPA 4HA1A 1J0MA 3GNNA 1CGWA 4CNSA 3GG1A 5ABFA 2GLKA 3PSWA 3VNZA 1S3TC 4LUSA 4Q7NA 1ADOA 3DERA 3LCLA 5DN1A 4LAKA 3WK1A 1XGZA 3W7GA 1SGJA 3VKAA 1TVPA 4NI8A 1PWMA 5DLCA 4LV9A 3S46A 4TX9A 1QO5A 1JR1A 3P60A 2DZWA 4E38A 3HG5A 1K9DA 4XO6A 1OM0A 4IPPA 4U31A 4MYXA 5DQPA 4GYKA 3GVVA 3KBWA 2OG9A 3UD2A 4JX4A 5DF0A 5G4HC 1UR9A 2OLSA 1JYWA 5BWAA 4MUZA 1A53A 4YMZA 1UD6A 2C0AA 4O28A 2XIBA 4QM1A 4QJ3B 3ATYA 1T0OA 3IK2A 2FZNA 5FKYA 1Q7ZA 4QLLA 1KRMA 5BXSA 4JKMA 1JDDA 4IJCA 4M56A 1FVPA 2O56A 4H2HA 1C29A 1RAKA 5F7UA 2A6NA 4C7FA 1R2RA 4RE0A 3MP3A 2A7NA 2DV0A 1OGSA 4UR9A 3AXIA 2NVCA 3RJYA 3GXNA 3THQA 3F4VA 2X1IA 5LXEA 1RWAA 1ZENA 2O7SA 3T09A 4AX6A 2DQXA 1T8XA 2DSUA 2ZUTA 4KBXA 2VENA 2OJPA 4RV3A 2YYUA 3KOWA 3GYCA 1AQ0A 3TCSA 4FPSA 2YFNA 3HQOA 2V5DA 3TIMA 3PFRA 3USBA 1TJPA 3OG3A 2OQHA 2HS8A 1AD4A 1C93A 1ZTVA 3PB0A 3VKDA 3S1UA 2GJLA 3LI0A 3MDWA 4N9CA 3ICJA 3I7QA 1TA3B 3H54A 2J24A 3TYCA 5H1WA 4Q8PA 2VX6A 2Q02A 2NUXA 3L5AA 3LMYA 3DI0A 1UPMB 3W7HA 2FHBA 1RVGA 1GVOA 1C8QA 2GVYA 3LCWA 2EAWA 1QASA 1ZHAA 1OT2A 4E4FA 5C71A 4WY0F 3LUTA 4Z2GA 2IW0A 4NZCA 2QF7A 4ZO8A 3S2CA 3IEBA 3GDLA 1OABA 3IIXA 4LAOA 3HFYA 3LCIA 4QEHA 1AMYA 3LTPA 3CWHA 1PJ9A 1XBVA 3ELFA 3BW3A 3FX4A 4B3KA 1POKA 2QPUA 2IKHA 2HCVA