2WMIA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 in complex with the a-trisaccharide blood group antigen.
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
582
structure length
572
Chain Sequence
b'VDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTENYWIWANDIENKAADYLKVSAKNGGYFIWAEQNNGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 221
structure length 572
sequence length 582
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmiA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmiA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmiA02
3PTQA 4PMNA 1AVAA 4ZXLA 2EO7A 3GXFA 4PMZA 1VFUA 4JCLA 3VDCA 3WD0A 3HMCA 3MO4A 4MB3A 3MUIA 1CXIA 4GPNA 2W4XA 1PIGA 4HZ6A 5DF0A 1Q6DA 1KQYA 2G3IA 1R85A 2AMGA 3LPOA 5A3HA 3LPGA 4HOZA 4DWSC 1WCGA 3B9DA 2ZX5A 4HMDA 4HP5A 1ODUA 1FHDA 4CN1A 2YLLA 2FDMA 3GNOA 4DWSD 1H1NA 4UFJA 5D8ZA 2E8ZA 3PZQA 4FLOA 2XHYA 5I24A 5EFFA 4QLLA 2VUYA 3EYPA 4JIEA 1GVYA 5A8PA 1WZLA 1PAMA 2WHKA 3U7BA 2MANA 1ZBWA 3UERA 4CU6A 1E40A 5LA2A 5ABGA 1BGGA 3QOMA 4KWUA 3GBDA 3MUAA 1ISVA 4MNKA 3WSUA 4TX8A 2VZOA 1CDGA 3PZGA 4CUCA 1MXGA 4U2YA 4OBRA 4D6JA 3SCWA 4C7FA 2D0FA 2YDRA 1WDSA 1UKPA 3WBEA 3MANA 2PI6A 4HMEA 3B9AA 5AY7A 1JNEA 3PTMA 2BY0A 4JFTA 3WH9A 1DEDA 1QW9A 2DSWA 3VIJA 2VURA 3SEPA 1UD8A 2J7BA 1RP8A 4AZ7A 2VQUA 5M17A 1PBGA 2DPEA 3W27A 2AOSA 2XVPA 1UKTA 2JALA 3IK2A 2XGIA 2WWDA 2B31A 1XCXA 3M7SA 5CSYA 1FFQA 1NP2A 1QI3A 1HM3A 3OGRA 2RGLA 3UCQA 2ZICA 4WKFA 1G5AA 4J3VA 3VNZA 3CTTA 2PWGA 1LL4A 1E6NA 1ZS2A 1UR1A 1I75A 1LXKA 3KL3A 1M01A 4J3WA 3L2LA 1VFMA 1H5VA 1UWQA 2CPUA 4WKHA 5JBEA 3AS0A 5LYRA 4AZCA 1PX3A 1E6XM 1N7RA 1NWUA 1PPIA 2VZUA 4PUDA 4V28A 4E8CA 5BXSA 4P7NA 5GNYA 5FOOA 4AWEA 4AY1A 1HJWA 3K4DA 5GNZA 4XX6A 1HF6A 4W88A 5HXMA 2D2OA 1BYBA 1R7OA 2WXDM 2J7FA 1CGVA 3VD9A 5GNXA 1PZ3A 1E43A 3ARYA 3UETA 4D6IA 3N15A 5A8NA 2WMIB 2PWDA 4AZIA 4FMVA 3MSGA 4D6GA 1J0JA 4MB5A 3QOKA 4NRSA 5ABFB 5I23A 1UWRA 3SCTA 1E4IA 3RM9A 1KQZA 7CGTA 1JL8A 2W5FA 3W29A 3WQWA 4ATWA 3AHVA 3RPMA 3PBGA 1UQZA 3A4XA 3QR3A 4JHZA 2G8ZA 4BQ5A 1NOWA 1J10A 2D24A 4UOJA 5I0DA 3AYSA 3W6LA 1PZ2A 4AZCB 4ATLA 1SFSA 4XUYA 1E71M 1KCKA 3PZMA 1VB9A 4JKKA 1CGYA 3VIKA 3BAYA 1WNOA 1JF6A 4AEFA 4UQ9A 5FKYA 3SCRA 3HN3A 1XH2A 3AIEA 1WZKA 4MB1A 1FP9A 2XFYA 1JYVA 1J0MA 4AIEA 1JYWA 1TR1A 3ARVA 4F9JA 1B0IA 2VOTA 1XD1A 3MMWA 5HPCA 4PEEA 1J0NA 1ZJAA 4AD1A 1KXVA 2OLHA 1DWHM 3RILA 1CENA 4MDPA 1J0HA 1JDAA 3CZLA 1C3FA 2J7HA 4J3SA 2VO5A 1QNQA 1W3LA 2JEQA 4PTMA 4GXPA 4HPGA 1DP0A 5JUVA 3PN8A 2ZXQA 1FH8A 2WBKA 4OOZA 2E4TA 4AEEA 1IT0A 5IFPA 4IPLA 1GOKA 4EK7A 1XHGA 2WC3A 3NCOA 3AS1A 3WD4A 4HPHA 2PBOA 1VEMA 4HA3A 2QPSA 3IJ9A 1DWAM 3QHOA 2NT0A 3RIKA 1F1SA 3ARUA 2VL4A 1UD2A 5A94A 3T2OA 4WF7A 3J7HA 1JZ6A 1TUXA 2BNJA 5DT7A 2A3EA 4W5UA 4PTVA 2ZX7A 2WCOA 3WQ8A 1QBBA 4DWSA 1LL6A 2JIWA 4U33A 3U5UA 4UQBA 2YL9A 1V02E 2EPKX 3AIWA 1X6LA 3WQ4A 5D4YA 4LYPA 1EOKA 2DQXA 1JNDA 3CZEA 3N11A 2E40A 4H8HA 3W38A 3T0DA 2J25A 1XYZA 3AQUA 4PMVA 5BXTA 1V3JA 3WF4A 5KZ6A 1UA7A 1CPUA 2J8GA 3VM5A 1UZ4A 1FHLA 3GDBA 1ISXA 3SUVA 1I8QA 1GJWA 1ESWA 3VDHA 2WW5A 1RH9A 5I2UA 2DH3A 2ZUVA 2D20A 4EKJA 1XYFA 3VTRA 2CITA 2QMJA 5EFDA 4E2OA 2XSAA 1A3HA 1J11A 3L4YA 2WMKA 1LWHA 1MW1A 2V5CA 1QNRA 4XB3A 2YOCA 3ZSTA 3CLWA 4XV0A 3AXHA 1LG2A 3N18A 4PN2A 1M03A 3W0KA 4W86A 4UQCA 1CTNA 4Q22A 4GO9A 1GOIA 3WDRA 2W91A 5A2AA 6CGTA 3WEZA 4GQQA 3ZR5A 5GPRA 5CXPA 1NWSA 3A4AA 3G6LA 3DYPA 1KGXA 2OWCA 1CXHA 1LQ0A 2D0GA 2BY3A 4GINA 1UWSA 3ARZA 1YHTA 1M7XA 3B8SA 3HU7A 3W26A 3EBVA 3WH7A 2ZWZA 1VIWA 4CVWA 4HA4A 4QAWA 1CGTA 3ZJ7A 1UR9A 2BRPA 3CHFA 1V3LA 3WNMA 5LA1A 2PWHA 2DSUA 3BAXA 3SCQA 3VGEA 2WKLA 3QGVA 3FNDA 2DSKA 4FF5A 3SIMA 1WDQA 5HDRA 1ITCA 1E0WA 5A6BD 3T0AA 2XG9A 1B3XA 1NH6A 2Q1FA 2VVNA 4JAWA 5D9NA 3VMPA 2CKSA 2ZXDA 2BXZA 4E4PA 4PBGA 1UHVA 2VMFA 3A6OA 5A2CA 3CHDA 1DHKA 3ZM8A 4AISA 1X1HA 1YQ2A 4TVDA 4B3LA 2F61A 4J27A 1UOKA 3IAQA 4B16A 3FN9A 4RE2A 4CD5A 1VRXA 2DSVA 1EO7A 2GDVA 4PMRA 3WQ6A 4OKDA 4W8BA 4PMDA 1UH2A 3AXIA 3AYRA 4KH2A 1G0CA 1N82A 4PCSA 3RM4A 3T0BA 4JHOA 4UQDA 4W5ZA 1GJUA 1VFOA 1JZ5A 1RPKA 2FHFA 4F79A 3CBWA 5HPOA 1OWQA 9CGTA 3WENA 1V6WA 4GI6A 1XCWA 1CXFA 5CPQA 3WD3A 2VX5A 1K9TA 2W61A 1XH0A 2YDQA 3DHPA 3CZJA 1UKQA 1TA3B 1VJZA 1KGWA 2V3EA 4CCEA 1GOOA 1W9VA 1RW9A 1UD6A 3WBAA 1W1YA 5CGMA 3BMVA 4JL2A 2V3DA 1JYNA 1FH7A 2XM2A 3BC9A 3WH5A 3WELA 1EHNA 1GQJA 3WN6A 5A6JA 1CEOA 2QV4A 2E9LA 5JIPA 4ZE5A 2NSXA 4PCTA 1HM2A 4WSJA 3ZJ6A 4AZBA 2J75A 2XVKA 5EMYA 4JL1A 1JGIA 1M53A 5CSUA 2XIBA 1JIBA 3VIOA 2RGMA 2DT3A 4NRRA 4OUEA 5BXRA 1OGBA 1SR0A 2W92A 1H4PA 2X09A 5ECUA 1BFNA 1F4HA 1HJVA 1LOHA 4QP0A 5A8OA 2CBUA 2Y5EA 3PHAA 4Z2GA 3BLKA 1CGWA 4H04A 1GPFA 1GCYA 3CGTA 3T09A 4TVUA 1HJSA 1JZ8A 4HZ8A 1CBGA 1UUQA 3GH4A 1EDGA 4KGLA 2PWEA 6TAAA 2CEQA 3EMQA 1E0VA 2NW0A 1CECA 1WPCA 3THDA 5D8WA 4GZEA 3CPUA 1N7PA 4J3XA 4Z2JA 3B9EA 4PTXA 1GUVA 3U5YA 5A6AA 4DM1A 4OZOA 5FL0A 3PZNA 2EBNA 3IANA 5I3DA 3A4WA 1D3CA 4AZGA 1ZBKA 4QLKA 1TMQA 4NI3A 1KXTA 1BF2A 4H41A 2Q8XA 4IISA 4GI9A 2O9RA 1NOUA 4URIA 2WHMA 3WDHA 4HTYA 4N42A 1VFFA 2BVTA 3UR7A 3FW6A 3NDZA 1CWYA 2YA2A 1E6ZA 4UTFA 1J01A 4LYQA 5C8BB 5DMYA 2E22A 4WKAA 2O9TA 1KCLA 3ZOAA 1XH1A 2A3BA 5HBFA 2FGLA 4UR9A 4ZENA 4BCEA 4HOWA 1VF8A 4E8DA 4A3YA 4DUWA 3MU7A 3NSXA 4GIAA 3SUSA 1E55A 1KB3A 3AHYA 4KMQA 3DYMA 1XSJA 1B3ZA 3W25A 2EPOA 3MMDA 3W28A 3NIYA 2E24A 3W37A 3MUY1 1NM9A 1E56A 2BY1A 1KWKA 1V0NA 3VNYA 4IPNB 5M3WA 4TTGA 3OBAA 3FXYA 3MV11 1VENA 2BHUA 2VR4A 2ZOXA 1HJQA 2J62A 3CUFA 1XC6A 4CKQA 1SYTA 1J0KA 1QNOA 2V5DA 1N7QA 3WF2A 3WDIA 2YLAA 3FHQA 3M07A 1OJMA 3KE0A 1D7FA 3VM7A 3VGGA 3VINA 4JZ5A 3KEHA 2WB5A 1MQPA 2ZX6A 3GXMA 8CGTA 4UFLA 3N12A 5D9OA 1E4LA 2J7CA 2DT0A 2C7FA 5A6BA 3AZTA 3L4XA 5A6MA 1W9UA 1H0IA 3APGA 3WDJA 2WMIA 1C8YA 2GJPA 3T2QA 1PEZA 4W85A 3MMUA 4AZ6A 2VX4A 2OSYA 1MW0A 2YA1A 1JG9A 3TTSA 4J28A 4UQEA 5EBAA 3IJ7A 2YL6A 1J0IA 3CMGA 5ABFA 1E4MM 5E6YA 1OBAA 1N7OA 2VRQA 1OM0A 1XSKA 1G94A 3RJXA 4D6HA 1KBBA 1HL8A 4AD2A 1L8NA 4D6CA 1OINA 1HKIA 1BAGA 2WBGA 3WNKA 1RD6A 2VJXA 1K9EA 4S3JA 3RJYA 1HL9A 5IDIA 5EB8A 4W7WA 1HVQA 3VX1A 2GUYA 1BG9A 5IFTA 1H3GA 2WDAA 4AYSA 3N1AA 2X0YA 1HKJA 1TZ7A 1C93A 4NF7A 3TONA 2EQDA 3O2LA 3SUUA 2XFFA 2XSBA 1HJXA 5E0CA 3VIMA 2VCBA 2TAAA 1UG6A 5CGTA 1J0YA 4PMUA 3OLDA 1HJUA 1WO2A 2J8FA 2GJXB 3EMCA 1GOQA 3ALGA 2PWFA 1VEPA 4WK9A 4YHGA 1B31A 1HP4A 4P7RA 4ZFMA 1UR4A 2WMGA 1HP5A 1C91A 1JXJA 3GM8A 1QOXA 2YL8A 1AMYA 1KXQA 4RE3A 1OT2A 5AC4A 4JKMA 1ZU8A 3WUFA 1US2A 5DEZA 4TX6A 4Z2IA 2EEXA 1KR1A 2VRJA 1V08A 1QPKA 4ZE4A 2WYSA 1UQYA 2PBGA 1UWTA 5CPTA 2VTFA 1RWCA 2YA0A 3WH6A 4ATDA 2CBVA 2PF0A 5CZKA 3L4ZA 1EA9C 4YPJA 4DUXA 1JDDA 1MVYA 4FLRA 4M8UA 2WCSA 3BCDA 1AQ0A 4AZHA 1RWHA 1WAWA 1RWAA 1GVIA 4H2CA 2X0HA 1JDCA 2EXOA 1ODZA 4HU0A 1E9LA 1UWUA 2VT0A 4B3KA 3POHA 1JZ3A 1HT6A 1H09A 4D1JA 1CGXA 1I1XA 2D23A 5HOSA 4UQAA 3F5JA 3EDJA 2CKRA 3BGAA 3GTNA 3RCNA 1LLOA 3ZT6A 3ZQ9A 2BFGA 4C7GA 6A3HA 3VPLA 1C8XA 3UEQA 1XSIA 1B3WA 1E15A 1NWTA 1LXMA 3EDFA 3KWXA 2CYGA 3OLGA 5AC5A 3EMZA 4M24A 4B9ZA 1BYDA 7TAAA 2ZE0A 4MNJA 4X9YA 1E1FA 4GQRA 3GNPA 3AMLA 2WLZA 3N13A 3N17A 4P7QA 4UFMA 1V6YA 5FCZA 1F9GA 1H41A 1QBAA 3L4VA 2IUZA 1MFUA 4CVUA 1WP6A 1UA3A 4BF7A 4CD6A 2J79A 2A3CA 4PUEA 2O92A 5A2BA 1IZKA 4PRWA 4TOQA 3WD1A 1CXEA 3WL1A 1H2JA 3WDPP 1MXDA 1J0ZA 2FH6A 4BQ3A 1J9YA 2J78A 1QI4A 1W3HA 3GH5A 2CERA 4QFUA 1DWIM 2ZX9A 1GOMA 5JBDA 3ARQA 3I3DA 2CESA 4CD4A 3WKZA 1W1VA 4PMOA 1Q4NX 2HISA 2WVVA 1JAKA 2QHAA 1WZAA 5CLWA 1E73M 3LMYA 3SUWA 1Q6CA 4S3KA 4LGXA 1GZJA 4TUFA 3ARWA 1HVXA 1EGZA 5BRQA 5BRPA 4OJYA 1BQCA 3AS3A 2CETA 1V0MA 1GONA 1HMWA 3WF0A 3SCNA 2CBIA 2OWXA 3AIVA 1JZ7A 1JZ4A 1V0LA 2VNCA 2YKKA 4FLSA 1LWJA 3MUZ1 2D22A 2WC7A 4MAZA 4MJ2A 4U5IA 2ZXAA 3VO0A 3M46A 1C90A 1CYGA 3WY1A 3WF1A 3KL5A 2WLYA 4GI8A 3WFLA 4MDOA 1UYQA 3TTYA 4AIUA 1HN1A 3AMGA 1H11A 1OJPA 4WSKA 3UG4A 4D1IA 1V0KA 2WVVB 1B30A 4EE9A 3BAIA 3OLIA 1OJNA 5CLTA 3BCFA 5A69A 1BVNP 1W1TA 3O6AA 2VZTA 4CD8A 1MW2A 1QI0A 1BPLB 2XGBA 4M29A 2Z1SA 1N7NA 1TA3A 1KBKA 4A4AA 2DIEA 4EANA 3BAKA 2ZUTA 3WIJA 1E5JA 1OCQA 2EPMX 3ZO9A 4PMXA 5HNNA 2WCGA 1GNXA 1VJSA 1PX4A 2DEPA 1PIFA 3AHXA 2NT1A 2WZEA 4Q7NA 3UG5A 1K9DA 1V6UA 2Y4SA 4W8AA 1WDRA 1TFVA 2G4FA 1W9BM 3GXIA 1IZJA 4OBSA 1ZBVA 3AZRA 2DIJA 2WZHA 3CUIA 2FHBA 2UY4A 2FHCA 1ISWA 3LPFA 2WANA 4GKLA 3ZT7A 4UOQA 3VX0A 2WCAA 3IJ8A 5E70A 4TVCA 2G3MA 1WZMA 1O7AA 1UD4A 3BH4A 1PJ9A 1EQPA 3SCSA 4D6DA 1BTCA 4AXNA 3CZGA 1OIMA 1XD0A 4X0NA 3W81A 5ABEA 3CZ8A 1E3ZA 4JFUA 2WVTA 4K68A 5DFAA 2WPGA 1CZ1A 1WE5A 4AD4A 2E9BA 3BAWA 4P8UA 2ZUUA 2VX7A 3VIHA 1FOBA 3ZMRA 1PX8A 2DT1A 3VD5A 4FK9A 4OIFA 1Q6GA 3A3HA 3T08A 4YN5A 5LA0A 4KGJA 3DYOA 1SMDA 2OYMA 4JFSA 1V02A 5A6SA 2Y24A 1BHGA 4LXFA 1VBRA 4MADA 4AD0A 2VCCA 3E1F1 5IXEA 3SURA 1KR0A 1KWGA 2PC8A 2YBTA 1GHSA 1X1JA 3K8MA 4BZYA 1Q6FA 3QHNA 4LPCA 4B15A 2WK2A 3S6TA 1V03A 1C7SA 1A47A 2C8NA 4BA0A 3M6DA 2W62A 2X1IA 1FH9A 2VRKA 1EDQA 1EH9A 4UCFA 1HKMA 1QHZA 3GH7A 2XFRA 3VIGA 1JAEA 2YDSA 5BWFA 2BV9A 3WUBA 3S2CA 2OYKA 1E70M 1QVBA 2E0PA 1UR0A 4L4OA 2WWCA 4UFIA 4MNLA 3VUPA 4W7VA 3OGSA 1WDPA 4P7OA 1QNSA 5M03A 2YBUA 4W7UA 1MYRA 3SCOA 5A6LA 4ACZB 1FP8A 3RO8A 2WAGA 1UKSA 5ABHA 4MPKA 2UY5A 1Y7VA 3NUKA 2ZX8A 3AIRA 5A8MA 3WUGA 1TG7A 2ZWYA 1W3KA 5A8QA 4W8LA 3TA9A 1OSEA 4QLJA 2JF6A 5JIWA 3VD4A 2GFTA 2XVGA 1JD7A 1LL7A 2F2HA 4B9YA 1HKKA 3CUJA 1JF5A 4PTWA 2J4GA 2WSKA 5BYWA 4M81A 1E3XA 1JYXA 1CLXA 2JE8A 3MV01 3GNRA 3ARSA 5DT5A 3AXXA 5IHSA 1KFWA 2CNCA 3L4UA 2A3HA 1JFXA 4EAMA 4D71A 2EPLX 2PB1A 2VQTA 3NSNA 1C92A 5A95A 4LQ1A 1QHOA 3AS2A 3CH9A 3SUTA 3SCUA 4C7DA 3ZSSA 4UNIA 1WB0A 4FLQA 4JKLA 4UFHA 1ZJBA 2X05A 1WKYA 1U30A 4NSBA 3AHZA 4W84A 1NARA 3W4RA 3PTKA 3PZUA 1TVNA 3VMOA 2X2YA 4Z2HA 3ECQA 3SCVA 1W2PA 3WMSA 4CU8A 3PZIA 4U3AA 5E0FA 1MWOA 2CBJA 4U31A 2C0HA 1OD0A 2IXUA 4H8VA 1OGGA 2FGZA 3AMCA 3N04A 1JZ2A 3TTQA 2YJQA 5I77A 1C82A 1CGUA 3W82A 4W89A 2BVDA 1V3KA 3II1A 5AYIA 1EDTA 2GJXA 1DWGM 1OT1A 1V3IA 5DO8A 1G01A 2OSXA 3AHTA 2DH2A 3HJEA 4F66A 3PZVA 4DUVA 3FAWA 4ZEPA 2XYLA 2J74A 4UZSA 1MFVA 1VBUA 1BGAA 3DECA 4M1RA 3VU2A 3OA5A 3UG3A 1J18A 2Y8VA 1V3MA 4PMYA 1B3VA 4F9DA 1EXPA 5CPSA 1UKOA 4JFVA 1W9DM 1JD9A 5I79A 3AOFA 3WQVA 4AZ5A 2W66A 1W91A 1BG4A 3WNPA 3CZKA 2GK1A 4Z2LA 2GSJA 3T2PA 1D2KA 2G41A 3AROA 1ZL1A 4JCMA 2YIHA 3ZJ8A 4QCEA 4P8XA 2E9MA 2BHYA 1ISZA 4WLCA 2XWEA 4M56A 1E5NA 4UOZA 7A3HA 2Y2WA 2YL5A 4D6EA 3VOCA 4N0RA 3F4VA 3OZOA 1LJYA 2JFEX 3UR8A 4RL3A 4UZUA 5CJ5A 2W67A 1BVZA 3W24A 1G9HA 3BSGA 4JFWA 4HMCA 3BSHA 2DSZA 1RWGA 1UZ1A 4PMQA 4P7LA 2QLYA 2WMJA 3ZJKA 2HVMA 3EDDA 1F4AA 4P8WA 2D3LA 2UY2A 3F5LA 2E3ZA 2ZXBA 2O9PA 2QMKA 2UWFA 2CIPA 5FIPA 1OGSA 4BS0A 1AQMA 1FFRA 1W9XA 5E9AA 5I78A 3FAXA 3WD2A 3AIBA 4BQ4A 3U57A 3VIFA 3CIVA 2DDXA 3PZOA 1HIZA 2BS9A 2GK1B 5FD0A 5JBFA 2GJRA 5A6KA 1GQLA 1X6NA 3L2MA 3WMCA 1RWFA 1Z32X 3ARXA 1TCMA 1LF1A 1U33A 1QHPA 2XPKA 2J7EA 2VX6A 1HX0A 3I3BA 3WL0A 2D3NA 3NJ3A 5C70A 4ML4A 3UESA 2XVNA 3WF3A 3RM8A 1E0XA 2O9OA 3PZTA 1DWJM 4V27A 4A3HA 3A47A 4GO8A 4BQ2A 1K6AA 2WKGA 2JEPA 1X1NA 3AMDA 3ZR6A 2WNWA 3G6MA 2WMHA 3L4TA 5BXPA 3IAPA 1GQKA 2FH8A 1E4NA 4J7RA 4Y7EA 3OGVA 4M82A 1HXJA 2WVSA 4TTUA 1BSIA 4U5KA 2WM0A 3NDYA 1HNYA 4PSRA 3AMKA 1R87A 3OG2A 1NOFA 4U2ZA 1E6QM 1UR8A 1JFHA 5FL1A 1FA2A 3VDBA 4AMCA 2EJ1A 1W2VA 3FY1A 1P6WA 3POCA 8A3HA 4CU7A 2BRWA 3CHCA 1ZB5A 2D1ZA 3GBEA 3K1DA 4AIOA 3RDKA 4MB4A 3ARTA 3RMEA 1ZBCA 4DM2A 1W3YA 4R27A 4TXEA 1C7TA 2IXVA 1OB0A 1ITXA 3KL0A 3D5HA 2BY2A 3LPPA 2VZVA 1IV8A 1LG1A 4KRTA 1E72M 1TE1A 4CN4A 3SCPA 1E6SM 2QPUA 4YHEA 2BVYA 1B90A 1E6RA 3CUHA 2VVSA 4PSPA 3I3EA 1W32A 1G1YA 4GZIA 1W9PA 3EDEA 1K9FA 1B2YA 2WZIA 1OIFA 3GZAA 1HMUA 3VKKA 2OWWA 2F8QA 1UR2A 1L0PA 2OYLA 4J3TA 3CUGA 1U2YA 2WHLA 2ZUNA 4MNMA 2GVYA 1JXKA 3VGHA 1QI2A 1OJOA 3K46A 4MJ4A 2JF7A 3D3AA 4HZ7A 5AYBA 5BCAA 1H0GA 4CN6A 3VMNA 1E6PA 5IHRA 1CLVA 3BAJA 3BMWA 2OSWA 2BRVX 1MQQA 3OLEA 4NZCA 2Y8KA 3WMBA 1NP0A 2VR5A 1UD5A 1GHRA 3O9NA 4LYRA 4M80A 1MQRA 3DHUA 2AAAA 1XGZA 2J7GA 4QCFA 2QF8A 1DWFM 2V3FA 2V38A 4DWSB 3CHEA 3WEOA 3TOPA 1KXHA 2WMFA 5D9MA 1TVPA 2ESCA 2JIEA 4WIWA 1XRVA 4KRUA 2GDUA 2UY3A 3AIUA 2BXYA 3NSMA 3VGBA 4R5EA 1B9ZA 1UH3A 4RE4A 4XZWA 1R86A 2DT2A 4GZJA 4AC1X 1I1WA 3VD3A 1E1EA 2XWDA 2X03A 2EPNA 3ALFA 1B1YA 1EHAA 3W53A 2G3NA 2CHOA 3WUEA 4D72A 3AZSA 3BXWA 2CHNA 4IUGA 5CG0A 1CXKA 5GQBA 3CO4A 4X0VA 1M04A 1ISYA 3AICA 1KGUA 3FHAA 3QHMA 3VILA 3OIHA 3OZPA 4ZXOA 4CCCA 1GOWA 4IM4A 5TD4A 2X8RA 4H8UA 2ZUSA 2Z1KA 4F8XA 1CNVA 3AJ7A 4W87A 3WNLA 5BROA 3AFBA 1EOMA 4ACYA 3WNNA 1SMAA 1OD8A 4P8VA 3WFZA 1UD3A 3MSDA 4WJXA 4UFKA 5CQ1A 3VGDA 3ZIZA 3WNOA 2ZUWA 4D6FA 3L4WA 3VVGA 2J7DA 2J47A 4V2XA 3VDAA 2V3GA 1DTUA 4J3UA 1V3HA 2G3JA 1GQIA 3U7VA 4HOXA 1V6VA 1V6XA 2CCRA 5A1AA 3MS8A 3TP4A 2XM1A 2J77A 2VI0A 3NYDA 4PYSA 3VGFA 3VD7A 2XUCA 1CXLA 1EIBA 1O6IA 2CXGA 2DGAA 1AQHA 5F7UA 4CD7A 5I5RA 1W1PA 2E8YA 3BLPX 3WH8A 1NQ6A 1BYCA 2ZUMA 4QDMA 3N9KA 1VAHA 1H49A 3OB8A 1X1IA 1EO5A 1NWRA 3DC0A 4U3CA 3ARRA 2D0HA 3MKKA 1B3YA 1R8LA 1S46A 2XVLA 3KZSA 1EGUA 1QNPA 3K8KA 1QW8A 1C8QA 4ACZA 5KEZA 2WSPA 3VIIA 4LX4A 4CGTA 1W3JA 3GYCA 1XV8A 3WEMA 5I6SA 3EDKA 2WC4A 4H7VA 4MTVA 2WHJA 3GXDA 1BLIA 1UH4A 2BHZA 5E6ZA 1RP9A 4CCDA 4MAVA 3WDQA 2VC9A 4HU8A 3AI0A 2VZSA 1US3A 1GW1A 3WQ5A 3CMJA 3AISA 3K4AA 4XZBA 3ZT5A 1CIUA 2WVUA 4W93A 4AD3A 3THCA 2XIIA 4OOUA 2XJ7A 1GORA 1CB8A 2A3AA 1QI5A 4AD5A 3K8LA 1EQCA 5D9PA 3PZ9A 1ECEA 2VCAA 3TTOA 3F5KA 1MW3A 1JI1A 3VIPA 1R7AA 5C71A 2ZIDA 3ARPA 5M5DA 3JUGA 1J12A 2W63A 1JI2A 1Q6EA 3AIQA 1UWIA 4HA1A 4Z2KA 4AW7A 1VEOA 2XTKA 4L4PA 3W6MA 1BYAA 5E09A 1HN0A
chains in the Genus database with same CATH superfamily
2BG5A 2EO7A 1JUEA 2RDTA 5M1TA 2Z7GA 3HMCA 1TJPA 5B7ZA 2NXGA 3GHTA 4OBTA 2PGWA 3ZWSA 2W4XA 2KX9A 2QAFA 2NSOA 4LH8A 2G3IA 1CT5A 2PGFA 4NJKA 1WXZA 5A3HA 1V51A 3LPGA 3W2NA 4FR6A 1WCGA 1XFCA 3UJ2A 1ODUA 2BLEA 3TU9A 1FHDA 1BSLA 1H1NA 1TTIA 4GBDA 1O0SA 2E8ZA 5I24A 3URQA 2VUYA 4JIEA 1GVYA 3F2CA 1WZLA 3U7BA 3EPMA 2MANA 1E40A 5D04C 4AWTA 4O12A 2V5LA 1L9WA 2OOGA 1FWAC 2ACUA 1CDGA 3LOTA 4CUCA 4OBRA 2WO5A 4MFDA 3SCWA 3RPDA 2YDRA 2OLSA 2XIQA 5HWNA 3FV9A 5F4SA 2PZ0A 2X2GA 2PI6A 4GIYA 1OCJA 4QQ3A 1XICA 1JNEA 5GJNA 2ODOA 3QZ6A 4ZTYA 2BP1A 3W01A 1QW9A 2DSWA 3SEPA 3CIWA 2G97A 2FMNA 2J7BA 3STEA 4ZCWA 4G7FA 1KFJA 4NZ1A 5M17A 3S4TA 4KBXA 2XVPA 2JALA 1P0BA 2PU1A 4ZODA 4CLMA 3PANA 2WWDA 1LZOA 3RRXA 2P8CA 1JRBA 1KRCC 3M7SA 4ZB5A 1K70A 5G4HC 2ZICA 2GGIA 4ASTA 1G5AA 4DJDC 2BMBA 1XLIA 3VUSA 1BVWA 3TQKA 3S5SA 1E6NA 2WSRA 3IRSA 1R30A 5EBUA 1I75A 4NG3A 4Z0JA 4J3WA 1LOSA 2CPUA 3UR2A 3LNPA 1VBJA 3LTSA 4F0KA 1Z8AA 1E6XM 1N7RA 1NWUA 2OOFA 4PUDA 3FKRA 4F3HA 1KBLA 5FOOA 4B92A 1XKYA 4EF8A 1R3SA 3W7LA 3G77A 4GD0A 1KRBC 1R7OA 5AVNA 4S3AA 1PZ3A 3UETA 4JQ2A 3N15A 1A5NC 3UGVA 5A8NA 5J5RA 4JTFA 2PWDA 4ENLA 2VGGA 3HM7A 1ZHAA 4V33A 3QOKA 4NRSA 4NXSA 5K7JA 2XGZA 5I23A 4HNOA 3SCTA 1E4IA 3U6WA 3FYPA 3NL3A 1XIFA 3C52A 4ATWA 3AHVA 1K3UA 3H21A 1UQZA 5L9FA 3A4XA 4JHZA 2AL1A 3W6LA 4CQ9A 5LGXA 1DJQA 4LC6A 5AN7A 3PZMA 4JKKA 1TCDA 4ADUA 3TYDA 1WNOA 1S2VA 5FF7A 1Q8JA 4AEFA 4X2RA 5KINA 3CQJA 3Q65A 1P1MA 4MB1A 2C1IA 2XFYA 1DYSA 4I8YA 1B0IA 2JGYA 3V3WA 5HPCA 2VELA 3WLJA 1ZJAA 2QULA 2A4AA 3MPGA 3RILA 3DKJA 4MDPA 1OC7A 5C6MA 3CAQA 4NKCA 2YCJA 3CZLA 1TWZA 4UTWC 3L2IA 4MZ1A 5CZJA 4WXYA 5BZAA 1LT7A 4M1BA 4PTMA 2EPHA 3HGOA 3SJ3A 1VP5A 5JUVA 2ZXQA 4ICNA 2O56A 2WC3A 2ACRA 3AS1A 3WD4A 4HA3A 1DWAM 4C6IA 2C19A 3O6YX 5HQMA 3RIKA 3ARUA 2A0NA 1RQHA 4HYWA 3OBEA 5D2YA 5A94A 3HQ1A 5DBTA 2Z7KA 2PDIA 3H54A 1QPRA 4UQBA 3L0NA 2NQJA 3XIMA 4LYPA 4ZR8A 3MY9A 2DQXA 4XISA 3N2OA 3N11A 3WLRA 3E0VA 1IWAA 3HO8A 3PAOA 4RXFA 2NUXA 2J25A 1V3JA 3WF4A 1PYFA 2ZE3A 5KZ6A 3UVIA 2J8GA 3IACA 4B90A 4O0ZA 5K2ZA 1ZJHA 1ESWA 5AHMA 3VDHA 2WW5A 1RH9A 1W37A 3M0VA 4JNZA 4NJHA 2CITA 3CPRA 1GYMA 2QMJA 4LVAA 1C9WA 1TWSA 2B7OA 4S2CA 4XAFA 5EFDA 3B8WA 3HV9A 5CPOA 3GC2A 3ITOA 1GVRA 3LCIA 3NQ7A 3MP3A 4BEUA 5FEXA 3CLWA 3KVKA 3L68A 4H2HA 3W0KA 1IEQA 1ITQA 3JR2A 2EKGA 4W86A 4GO9A 2PGEA 4R85A 4Q8UA 4DF1A 2WNZA 3V36A 4OUIA 5I03A 1XLJA 2PF8A 4FS9A 4D8OA 1W5QA 5F1VA 2BSLA 1KGXA 1CXHA 4N9CA 8TIMA 3N2MA 2QEZA 3NQDA 4IIEA 4JTHA 4GINA 1EJXC 4XKYA 2VXNA 1S2CA 4GIEA 1YHTA 3B8SA 3HU7A 3EBVA 3WH7A 1M3UA 4EXBA 5DLCA 1VIWA 3NL2A 1FY6A 1ENUA 4FNRA 1TTQA 2TODA 3LV5A 4HA4A 3IVSA 4QAWA 3CWHA 4A29A 2BRPA 3CHFA 1V3LA 4LAMA 3TOYA 2WQPA 3V0SA 1SZRA 3SCQA 2WKLA 1JQVA 3FNDA 4GX9A 3DBNA 2DSKA 4FF5A 4MOZA 5HDRA 1E0WA 3WBWA 1EJUC 2NWSA 2WJZA 3LCGA 2CKSA 2ZXDA 3MCNA 4S3DA 2BXZA 3R89A 2DZAA 4G6CA 4PBGA 4ZSTA 2VMFA 4RZ6A 3NQVA 3D0CA 3ZM8A 4KS0A 1YQ2A 4J27A 2VYOA 4B16A 1W31A 1VRXA 1F73A 1EO7A 4PMRA 2VWSA 4GNKB 3CUXA 4GY0A 4PMDA 3VOGA 1S5WA 1G0CA 1N82A 3RM4A 4AEOA 3S5OA 4S3CA 4S38A 4W5ZA 1VFOA 5J8LA 3CWOX 3IIOA 3WENA 2YW4A 1AZ2A 1K9TA 2W61A 3SQMA 1XH0A 2V5BA 3CZJA 1UKQA 2FZMA 1GOOA 1W9VA 4PFHA 4O0QA 1W1YA 4JL2A 2OG9A 3WQDA 2V3DA 1RXOB 4ZQOA 3EXRA 4F0SA 1JYNA 3WN6A 4DXVA 1XDMA 4GA8A 5KTLA 3FGCB 3NEVA 3TSDA 2CZDA 2GLKA 3AUOA 2E9LA 2OELA 2DP3A 1PE1A 4NZ3A 1Q6LA 3PBMA 3QV8A 4NZJA 4ZE5A 2NSXA 4WSJA 3UP8A 4NYUA 2FLIA 2Y0FA 1Z48A 2EF9A 1JGIA 4JL1A 1JIBA 2RGMA 4UWMA 3U9IA 1SR0A 1H4PA 2X09A 2NV1A 1F4HA 2GQ8A 3O06A 4L56A 2X30A 2CBUA 2GUUA 3PHAA 3TMLA 1XM3A 3W22A 4YMZA 4H04A 1GPFA 2QUVA 3CGTA 3T09A 2P3EA 3GDRA 2CZFA 3WQEA 3B06A 4KGLA 6TAAA 4C6KA 1EL3A 3CPUA 1OY0A 4H7CA 3MZNA 1RPXA 2A21A 2F84A 4Q32A 2BDQA 1RA5A 4O4VA 1MNZA 3PZNA 2EBNA 2VENA 3IANA 4HJWA 2OPJA 1QJWA 4KRZA 4PULA 4LT9A 3TWAA 2E5DA 2Z28A 1TMQA 1BF2A 4DY1A 3BG3A 2P50A 3W1UA 1NOUA 3WDHA 4HTYA 4N42A 2BVTA 3P5YA 3NDZA 2YA2A 3P8JA 3S9IA 2REQA 4PTDA 2O9TA 3ZOAA 1XH1A 1HGYA 5HBFA 2FGLA 4UR9A 3N9RA 4FSAA 3G1RA 3PM6A 3H23A 5CGQA 2FZDA 3MU7A 1A53A 3M5VA 4P2VA 1QPQA 1MEWA 4WJEA 2LLEA 3W25A 2EPOA 3V1HA 3CEUA 2G5WA 3W37A 4FR1A 1E56A 2BY1A 3AWNA 3R43A 1J5TA 1HTIA 2O7SA 1XRSA 1A5KC 1ZTVA 1XIBA 5DMNA 3WZ0E 3N34A 3R0UA 4FXJA 1VLWA 2DU2A 2HJPA 3MV11 1VENA 2ZOXA 3MSRA 3E38A 1J0KA 1QNOA 2V5DA 2YLAA 3FHQA 3FYOA 5EMJA 3ABXA 1LWIA 3CMFA 3KE0A 2QQ6A 3VINA 3KEHA 2WB5A 1X7FA 4EOUA 1OX6A 8CGTA 3TQ0A 4UFLA 3W88A 1YDOA 4AVNA 2IPGA 2DT0A 3AZTA 5I00A 3SQLA 1EGMA 3APGA 4BF9A 3TKFA 3KOZA 1REQB 1C8YA 1DKWA 2GJPA 2OSYA 2YA1A 3SSJA 5EBAA 1X8FA 3IJ7A 5LGZA 4GWEA 4REQB 2YL6A 2RH9A 1OBAA 1T99A 1N7OA 1OM0A 4QBXA 1VCFA 3NXFA 4KFPA 1HL8A 4HJFA 3L0GA 2GUBA 2E6FA 4AD2A 5I02A 2IQTA 2Y8UA 1GGOA 3TQPA 4JIRA 1HKIA 1S2WA 3VZXA 4X22A 4I8DA 3WNKA 1OG6A 2HXUA 3BW3A 4GRSA 2W0UA 4O14A 1HL9A 5IDIA 1F3XA 3KFTA 3T0TA 1HVQA 1JGMA 3V5OA 5IFTA 3IJ6A 2QPXA 1IGWA 3N1AA 4D2JA 3BK0A 4O13A 2DZXA 2H9AB 1HKJA 2VC5A 3BLLA 1TZ7A 3UZWA 3KLKA 2EQDA 3AJXA 4S2BA 3QV9A 2XFFA 5E0CA 4PUWA 3UA4A 3W1TA 1UG6A 4KCWA 3LZ3A 5CGTA 1J0YA 4PMUA 3C5QA 1TSIA 1WO2A 2I9UA 2PDQA 1GOQA 1XLFA 4IJRA 3USZA 2BODX 1SM9A 1B31A 3TYCA 4HSOA 4JDBA 1HL2A 2WMGA 4OTKA 3HPZA 1QOXA 4L5ZA 1A3XA 1AMYA 4RE3A 3TZNA 1OT2A 2PDBA 1OFPA 5AC4A 4JKMA 3C2OA 1CB7B 1OVDA 4Z2IA 3QVQA 4LV4A 5FSEC 4Q8OA 1W1B1 1UQYA 1A0CA 1UWTA 3DKLA 4RDZA 3KHDA 2YPIA 1NFBA 4GFIA 1WKDA 2CBVA 2PF0A 4XSLA 5CZKA 4YTTA 1KTNA 1EBHA 4YPJA 1JDDA 4FLRA 2WCSA 4L61A 3B4YA 1I45A 3M43A 3TYUA 3N6JA 1VD6A 2JK2A 3UW6A 1WUFA 2Q02A 2X0HA 4PR4A 2QCHA 4Y2WA 3T40A 5C2XA 3ITGA 1E9LA 1UWUA 4TIMA 2QDEA 3POHA 4HNTA 1JZ3A 1WBJA 1HT6A 4QEEA 4MLRA 1CGXA 5E9XA 4RDVA 4IMDA 1RAKA 3W2KA 3F5JA 1RK6A 3GTNA 2EGZA 3RCNA 3ZT6A 3PY2A 3B8DA 1VFSA 4LUTB 4C7GA 6A3HA 5D03A 5H91A 1VGAA 3P67A 1XSIA 1E15A 3UA3A 1NWTA 3GIYA 4XD6A 2PPGA 1P7TB 1I2PA 4XIMA 1UZDA 1IXPA 5HATA 3ZZ1A 1UMLA 4M24A 1BYDA 2ZE0A 4MNJA 3H7UA 4GXMA 3DC8A 1VH7A 4GQRA 3AMLA 2YFOA 3N17A 1X1OA 1V6YA 3UWZA 1YIXA 2FMOA 5FCZA 2CWNA 4QS5A 1R3WA 5EL1A 4TR9A 2A3CA 4KIEA 5A2BA 1VHCA 4JPGA 3EB4A 3WD1A 4E2BA 1Z6KA 3WL1A 1FWTA 1Q65A 3LMZA 3WDPP 1MXDA 1N7KA 3RRAA 2FH6A 3FEQA 4ZA0A 4IL0A 4X63A 4WY0A 2Y6ZA 3U2CA 1QI4A 1JCMP 1H7XA 1Q4WA 1W3HA 1N8FA 2CERA 2ZX9A 1A0EA 1B3OA 5F2LA 3WKZA 2J8TA 3EPNA 4EXAA 1Y5VA 3B4UA 5AC6A 3WBYA 2QHAA 1SFJA 3B0XA 2ABAA 2RDXA 4M0XA 3PJXA 3LMYA 3WQCA 1VFLA 2G4JA 3QMSA 3ABRA 3SUWA 1XYMA 3F03K 1PVNA 4S3KA 5LNSA 1HVXA 3N6QA 5BRQA 3F4CA 1DVJA 5BRPA 4LOCA 4AWUA 1V0MA 3FKKA 3URNA 1TUFA 3G24A 1VBGA 3W6YA 1MEHA 3A12A 2X41A 4CQAA 1V0LA 3UZZA 4AVFA 1K8ZA 1US0A 4IQEA 3Q4DA 2D22A 4PUKA 4NZ4A 3PULA 3VE9A 3VO0A 2GJNA 1UP0A 1CYGA 3WF1A 3KL5A 1QOPA 2FTYA 4MDOA 1WXJA 1CB2A 1XLLA 1GG1A 1TX0A 4FHAA 4US5A 1OJPA 4WOQA 4WSKA 4FB7A 1GTHA 3M0KA 3MKVA 1LQAA 1T96A 4NNCA 2Y5SA 5REQB 1RSCA 4QHRA 3GFXA 1YPXA 2VZTA 3K2GA 1QI0A 2HTMA 3PWGA 3EAUA 1TA3A 2X7VA 4A4AA 1YE6A 1VPQA 3WLLA 3GDMA 1FVPA 2ZUTA 4RNFA 2AAMA 3LLDA 2YXGA 3ZO9A 4PMXA 3RXZA 1XLAA 2WCGA 1EJ7L 4DBSA 2Y4SA 4AHQA 4W8AA 1PCKA 1TFVA 1WDRA 2V69A 5I3GA 4IJBA 4DJFC 1IZJA 1MDLA 3QMTA 2DIJA 3CUIA 1W56A 3KUMA 1VLIA 4A8NA 4LY8A 2VEMA 1NAL1 1AD4A 4GKLA 3JW7A 4L4MA 3GTHA 3TNOA 3IJ8A 3E6EA 3L9CA 3BH4A 1PJ9A 3M5XA 3SCSA 4D6DA 3KP1A 1XLEA 3W81A 1W1ZA 2DIKA 4JFUA 3GTXA 4DF2A 4K68A 2OKTA 3UR5A 4GG9A 2NWRA 2GSEA 1S5TA 1DJWA 5DCDA 4JX5A 1W8SA 4NYYA 2V0TA 1YYAA 3PNUA 1FWFC 1PWMA 3WQGA 3VCRA 1JCXA 2QJGA 5LA0A 1TQJA 4HCLA 4DLQA 3IIXA 5A6SA 4XIAA 4LXFA 3O07A 1RLDA 2XINA 1FCUA 3E1F1 5CZ0A 2OZTA 2RDWA 4XD3A 4H9TA 3ZWTA 2YCLB 4NAEA 3FK4A 2VZKB 2ALDA 4JICA 1SZEA 4LPCA 2FYMA 4B15A 4PH6A 3CH0A 3RYSA 3M0XA 5CSRA 2W62A 1FH9A 3OVPA 2VRKA 1EH9A 2EG8A 2WKJA 4MWAB 4YJ5A 4MZ8A 3MQTA 3VIGA 2BGNE 4JBRA 3WUBA 3S8HA 3NL6A 3VKCA 2WWCA 3KOYA 3OGSA 1QNSA 3AYTA 3DFOA 4W7UA 3UWWA 1KRAC 1W3TA 3BW4A 3S46A 3SDOA 4ACZB 3RO8A 4L1WA 2TSYA 1D8WA 3QV7A 3W02A 2UY5A 4DYEA 3LHWA 3LGGA 2HXTA 2QUMA 1AW2A 3SRKA 2FZ9A 5LIKX 2ZWYA 3QC0A 4W8LA 2MUCA 4QLJA 2ZBTA 4C1LA 3VD4A 4GI4A 2G95A 3KBMA 1PO9A 3SECA 5CC6A 4MUPA 3EB2A 1GVQA 3A4JA 4GK8A 4PTWA 2WSKA 3LM3A 1JYXA 1CLXA 3PPGA 2JE8A 3CM4A 3HFYA 5DT5A 4C5ZA 2OJPA 3DX5A 3RG6A 1E1CA 1PCWA 4C6MA 1JFXA 4NAFB 4D71A 2EPLX 4GVFA 2ZC1A 5A95A 1QHOA 4AX7A 3ICJA 2E77A 3GZ3A 1T0OA 1YBQB 3HV8A 4QXIA 2X05A 1WKYA 4TMBA 3AHZA 3NVTA 4W84A 3LX9A 3PTKA 3VMOA 1EJTC 1TRIA 2X2YA 3G1VA 3PZIA 3THAA 3EA3A 3SIZA 2C0HA 1OD0A 3QLDA 2VC6A 1BRLB 1JZ2A 1C82A 2P53A 5FF0A 3LV6A 2BVDA 3II1A 5AYIA 4R9OA 5IDZA 4HK7A 1V3IA 5CPMA 2OSXA 2DH2A 3GXNA 3UG8A 2IPWA 2PODA 5I09A 1BWVA 3KOXA 4DUVA 4H9VA 2WQDA 5FEWA 1MFVA 3EOLA 3OA5A 2Y8VA 3UZYA 1TJ1A 5CPSA 3KS6A 3SN1A 2W66A 8RUCA 4S3GA 3KRUA 4Z2LA 2R1MA 5K9XA 3T2PA 2A7RA 3L65A 5CJMA 3AROA 5H8MA 2YIHA 3USBA 3ZJ8A 4QCEA 3B8UA 4P8XA 3NZRA 3TDFA 4LJ3A 3SQSA 4UOZA 3DESA 5HA7A 1AW5A 2ZRWA 2CLKA 3DG3A 3U4FA 3OZOA 3VKBA 3H2AA 4KETA 3UJRA 2JFEX 1U5VA 4RL3A 3LHYA 4XSMA 4JQ1A 2PAJA 1G9HA 2YDAA 4O17A 4OV9A 4Q4RA 2OT1A 4P7LA 2HVMA 4V1YA 4JX4A 1XLGA 1P48A 1F4AA 4I5XA 2UY2A 4IJCA 2O9PA 1I2QA 4JIHA 4OV4A 2UWFA 5CBBA 1OGSA 3L67A 4BS0A 1YADA 3WD2A 3S6DA 4F2UA 2JBMA 3U57A 5XINA 2I1OA 3VIFA 1HIZA 2GJRA 4IFKA 1UIOA 1X6NA 3L2MA 1RWFA 2QZRA 1TCMA 3VC6A 3U3HA 1HX0A 3N73A 3K30A 3WL0A 4MWAC 2XVNA 5AC8A 2IS7A 2Y1HA 3O63A 3L5AA 3RU8X 3PZTA 1DWJM 4GO8A 3W1QA 4BQ2A 4K8GA 4IP5A 3RN6A 1X1NA 3AMDA 1J6PA 4QE4A 2O0TA 5BXPA 3QGKC 2QKFA 5CPLA 3TR9A 4QGCA 3O15A 3EZ4A 2HE5A 4F0MA 4O8AA 1S2TA 3NDYA 3B8TA 4BHYA 1R87A 2ZADA 4JS3A 3MO7A 5AYXA 1IYXA 3NZ1A 4QX4A 3A9IA 3W2JA 1FWDC 2DFAA 5F4WA 1XUZA 2YCEA 4AMCA 1Q85A 4I7UA 1P6WA 8A3HA 1NF0A 4IQJA 3VA8A 5DXYA 1H1ZA 4F0HA 2Y7FA 3RUBL 2BRWA 1ZB5A 3I4EA 3CTLA 1TELA 3CV7A 2PRLA 3REQA 3ARTA 2B81A 3A21A 3P2VA 3WLTA 4DM2A 9RUBA 1MXSA 4TXEA 4RNHA 3K4WA 1OB0A 2RUSA 3KL0A 1DE5A 3P93A 3W7IA 1NU5A 1E72M 3SCPA 1E6SM 3I7QA 4YHEA 3KZPA 2AQWA 3GUWA 4DXXA 1YTDA 3R1ZA 5BU9A 2VUNA 1HMUA 3VKKA 1H63A 1R6WA 2CFFA 4GFSA 2J13A 4EX4A 4J40A 2WHLA 1XL9A 2QCCA 2GVYA 4ZQRA 1JXKA 4KEMA 3FCPA 3VGHA 1YXCA 1OJOA 3K46A 6PTDA 4MJ4A 5AYBA 2VM8A 2JQXA 1X96A 1E6PA 2QUNA 4JTEA 3BMWA 1X8CA 1WXYA 2JKAA 3F59A 3P80A 5EYWA 4FAMA 3SRDA 2Y8KA 3UWQA 3WMBA 1K02A 3UXDA 1KM2A 4LYRA 1MQRA 2J7GA 1A5SA 2QF8A 3NYZA 3UYCA 1XBXA 1DWFM 3CHEA 1R3TA 4LUSB 1TKKA 3T07A 1ZALA 4KWVA 3P3BA 2R8WA 3CJPA 2PRMA 1F05A 1A4MA 1WX0A 2GDUA 3VGBA 3KLLA 1LTDA 2OGJA 1HFBA 1R86A 4GZJA 2SFPA 5CKSA 2YB1A 3VNIA 5A8GA 1KM5A 3G5EA 1B1YA 3BICA 1EHAA 2CHOA 3WUEA 3OBKA 4FZIA 1EEXA 3KM8A 3AZSA 5CG0A 3GKAA 4X0VA 1KBJA 3LBOA 2B7PA 1KGUA 4WSHA 1ME7A 3UPBA 3G0XA 1R3QA 4Q33A 5DANA 2X8RA 2Y70A 4IOTA 4H8UA 1AJ2A 2QAPA 2ZUSA 2V5JA 4XZIA 3WNLA 5BROA 3AFBA 1DXIA 5C9WA 1EOMA 3NQ2A 4ACYA 3WNNA 1OD8A 3WFZA 3LCXA 7REQA 1XIGA 3NM1A 5TQLA 2ZUWA 3L4WA 4C6EA 1TWIA 1QNVA 3MVIA 4PA8A 4YTRA 3JZUA 4MZYA 1RD5A 3ES7A 4W4QA 2XM1A 4PYSA 3CAKA 3VD7A 5F2MA 3P60A 3VZYA 3AYVA 2DGAA 4YVVA 3P62A 2NVAA 4ZO9A 2PDKA 2E8YA 3BLPX 1MRQA 3OVQA 5FF4A 3N4FA 1NQ6A 4A6GA 3VOIA 4DUOA 4QDMA 1VAHA 2NQZA 5K4ZA 3DC0A 4U3CA 2Z1BA 4MF4A 1XINA 2D0HA 2WNQA 1R8LA 3BE7A 4B2DA 5BOFA 3BW2A 2HBXA 1QW8A 4NJIA 1C8QA 4LX4A 5CAKA 3GYCA 4CNSA 3JZEA 4LF2A 1UP2A 3EWCA 4PZVA 3GLCA 3KCLA 1RY8A 4MAVA 4HU8A 3EX3A 2VZSA 4QRNA 2NLYA 3KBSA 5CAHA 3LSCA 3UF9A 1GW1A 3WQ5A 3AISA 3OYZA 1CIUA 3F4DA 2WVUA 3KW3A 3F4NA 5DMMA 4CNUA 4OOUA 5F1UA 1GORA 3R6IA 3HB9A 3JVAA 4CNPA 4GQGA 4PMJA 1C8VA 4IX0A 3D3FA 3C3NA 1ZGDA 4ZVJA 3PNZA 4ZO6A 1J12A 4H9YA 3EWBX 2QDGA 2VEGA 3NL5A 5EA9A 2HROA 2V67A 2H90A 4AW7A 1VEOA 2XTKA 3Q37A 2TYSA 4Q8TA 1HN0A 4LUYA 2J9ZA 2DV0A 3LDVA 1KKRA 2P3ZA 3BVJA 2VD8A 3WD0A 1A4LA 4JGDA 4MB3A 4AY7A 4R53A 1CXIA 1JJKA 3SY1A 1TE6A 1V8EA 1O60A 4PL1A 2AMGA 3PVFA 4HOZA 1LBLA 4RV8A 1DJYA 3NG3A 3UZ5A 2B7NA 4HP5A 2F2KA 3CV6A 2Z26A 2P10A 3GDKA 2YLLA 4CN1A 1GW9A 2ZC8A 2FDMA 4UMAA 2QVHA 2V82A 3GNOA 4C60A 4DWSD 4UFJA 6ALDA 5D8ZA 4FLOA 1VPXA 4AVOA 4F4RA 2HEJA 5A8PA 3UERA 4CU6A 5LA2A 2QR6A 4KWUA 3MUAA 1RCXB 1VS1A 3LU2A 1ISVA 3WSUA 4TX8A 2Z6IA 2VZOA 4XVDA 4U2YA 5AZ0A 4C7FA 2D0FA 2XN2A 3MANA 1BTMA 1EZ2A 3FA5A 3NFUA 3GC5A 4WOZA 1G4EA 3WH9A 1DEDA 3CYJA 2RFGA 2Z2AA 1FRBA 4XUGA 2VURA 4GYPA 1UD8A 4PB5A 3VOJA 4C6NA 4WCJA 1WBHA 3BZGA 1V7AA 1PBGA 1P43A 3IK2A 2XGIA 3O16A 5HMSA 1ONRA 4IG2A 3M6YA 3PB0A 1U5HA 4JTLA 2J27A 3NOEA 4LS0A 1NP2A 1HM3A 3EWWA 3OGRA 3UCQA 4B5TA 3LG3A 3QY6A 2NQ9A 2J9XA 1D3GA 5CZSA 1IHIA 3CNYA 1IR1A 1LXKA 3WQOA 1M01A 5D33A 3L2LA 1VFMA 1UWQA 4WKHA 5JBEA 3AS0A 4J2PA 2PP3A 1ICPA 2NQ5A 2CLOA 5AHNA 4AZCA 3ERPA 5LXEA 2VZUA 4E8CA 4BEQA 5GNYA 4AWEA 2PDMA 5C55A 1FHVA 2XH2A 1HJWA 2ZFAA 1HF6A 3PAJA 1OZMA 3C0SA 3KVJA 4BK9A 1TB3A 4H6QA 4TMCA 1FWWA 2WXDM 2O7QA 2XIOA 1V4YA 4ONVA 7ENLA 2WMIB 4AZIA 4O50A 3MSGA 3R25A 3HIJA 5ABFB 2IKJA 1UWRA 3RM9A 7CGTA 4R7OA 4UBPC 1OK6A 4OT7A 3QR3A 3C61A 1LUCA 3G2GA 2D24A 3AYSA 1PZ2A 3S2JA 4Z1DA 4ATLA 3UWVA 3UD6A 1KCKA 2A3LA 2I14A 1CGYA 1R38A 2V68A 3BAYA 3R0DA 4DBWA 4IF2A 3LA4A 4UQ9A 2YB4A 1XH2A 3AIEA 1FKWA 1FP9A 2F6UA 4P61A 1JYVA 1J0MA 1JYWA 3NQCA 1BQGA 3GU1A 3N6HA 2CW6A 1KXVA 2E5BA 1DWHM 1AK5A 1Q45A 4B2DD 3TJXA 4PB4A 1JDAA 1C3FA 4J3SA 2F6KA 2Q6ZA 1FWHC 4DHGA 3LSBA 2JEQA 3APYA 4HPGA 1P0KA 2FPVA 5AHIA 3PN8A 2WBKA 5IFPA 2R94A 3WJYA 1U5JA 4U10A 2GVJA 3H4GA 1VEMA 3SI9A 2QPSA 3QHOA 5LNVA 1F1SA 1B4EA 3UXAA 1OYCA 3PWAA 3ZLFA 4WF7A 3J7HA 3ITLA 2XFWA 4E8GA 3EWZA 2BXVA 2A3EA 3N29A 1GPWA 2WCOA 3WBXA 4ZOAA 4YYFA 4YVXA 1EWEA 4LNYA 2YCIX 1EOKA 4H83A 3CZEA 3STCA 2E40A 4GUGA 3PG9A 4M19A 3AQUA 4PMVA 4L7ZA 5BXTA 1UB3A 1UA7A 2NZLA 3VM5A 3EWUA 1KV8A 3DAQA 1TTPA 2FZBA 1I8QA 5DX7A 3GS6A 1I0BA 4LSBA 1OFQA 1Y0EA 3DUGA 4GBUA 5I2UA 2DH3A 1NFPA 2ZUVA 4FF7A 2BGSA 3CS2A 4EKJA 1GEHA 3RLUA 4HT3A 3B9OA 1KNWA 2XSAA 4O1FA 3LERA 1A3HA 1LWHA 2WMKA 1RCOB 2V5CA 3P61A 5LNUA 4L4LA 2YOCA 3ZSTA 4XV0A 1XS2A 4PUJA 5JMUA 1M03A 2OVLA 2VDHA 5CH9A 1DIKA 4FEZA 4IXXA 1UASA 3E5BA 4MM1A 3PBWA 1GOIA 1BWKA 1UZHA 3WLQA 2F38A 4O10A 3MI6A 2W91A 5A2AA 5FF2A 3ZR5A 3SADA 1R5YA 5GPRA 2QIIA 1TV2A 4Q8VA 3PS7A 5CXPA 1NWSA 1EFZA 5AECA 1RHCA 2C1HA 3DYPA 3EOUA 1PKYA 1F61A 2D0GA 2ZTKA 1FQ0A 1SZGA 1G4PA 1UWSA 1M7XA 2ZRXA 2ZWZA 4PCFA 2IKIA 3CEPA 4LUIA 3GU2A 1XDLA 1POJA 4CVWA 1EXBA 3NPUA 1Q7ZA 3MMTA 3SW6A 1D7KA 4KERA 2PWHA 4C6FA 3EKZA 3WQFA 3BAXA 3QGVA 4AFYA 3TXZA 1OCBA 5A6BD 1WDQA 1DE6A 1ITCA 3TW9A 2VVNA 3GVWA 5D9NA 3TTEA 3VMPA 4DO5A 4IICA 2ISDA 4DX3A 4A2SA 4PUUA 1H51A 1UHVA 3GK0A 5HWJA 3SO7A 4E6MA 5JXQA 1X1HA 3ABSA 3ONCA 2AKZA 3KWSA 1WKFA 2VFFA 3C8NA 3FN9A 1QW7A 4I5UA 3P5ZA 1OJXA 5EMKA 2GDVA 5DY3A 4W8BA 3R94A 5H8PA 3AXIA 4KH2A 2Y7GA 4PCSA 3IIPA 3T0BA 1IT8A 2C13A 1JZ5A 1RPKA 2NUWA 4F79A 1L6YA 3CBWA 1OWQA 3ZXWA 2V5KA 1V6WA 1CXFA 3WD3A 3A9BA 3ISIX 2BOGX 3TA6A 1VJZA 2AL2A 3LCHA 2V3EA 1MNSA 3BTNA 1I60A 1GWJA 1UD6A 2ZRZA 3WBAA 3MB9A 4J4KA 1J96A 8XIAA 3WELA 2ANUA 3C0LA 4LVDA 4H6KA 2H6RA 1CEOA 2QV4A 4DLMA 3DI0A 1PYMA 3OODA 3ZJ6A 3C2YA 2XVKA 2XIBA 1KFCA 3VIOA 4QJ5B 3ATZA 2R1NA 2W92A 5LNWA 3H53A 4FX8A 3W1RA 4A8IA 2GGJA 1HJVA 1LOHA 4QP0A 2V63A 2Y5EA 4MMWA 4B5NA 3UVAA 3MKCA 2DVXA 4TVUA 3U48A 1YXYA 4B5VA 4HZ8A 3R10A 4M5PA 1EDGA 1O5RA 2PWEA 1UOZA 2CEQA 3QF0A 1M65A 3T1GA 3EXSA 4YLWA 1CECA 3HGJA 4GZEA 3DGBA 2QF7A 4J3XA 4Z2JA 3P82A 4PTXA 1S5NA 3NEHA 3U5YA 1X97A 1IEWA 5A6AA 2E25A 5FL0A 3PBVA 5HMFA 2XN1A 1TO3A 4I90A 2WHMA 3F2DA 3M41A 2X1UA 3VC5A 1NY1A 1CWYA 4RKAA 3GIQA 2I7GA 3VNJA 4UTFA 1J01A 5C8BB 2AGKA 4WKAA 2PDNA 3B0PA 1KCLA 3EA1A 4ZENA 2CZVA 3TFXA 3UD2A 2FDSA 1I8JA 2AMXA 1VF8A 2JKEA 3VFCA 4A3YA 4E8DA 5FJRA 3PBUA 3CL7A 4GIAA 4UXDA 2FFCA 3WLMA 1E55A 1PIIA 1XSJA 3MMDA 4PGLA 4GIRA 3LM7A 2E24A 2POZA 3URBA 3R0KA 3MUY1 2PDYA 4F2BA 1G69A 3IJLA 1IIHA 1KWKA 3CAWA 5BOOA 1B9BA 3MCMA 4IPNB 1P6CA 3SFKA 2FJKA 4TTGA 4HNCA 4HU3A 7ODCA 2UV8G 2BHUA 2L5HA 2JKPA 1HJQA 2J62A 2D69A 3NTYA 1T6MA 3T78A 1M6JA 1GVOA 2BOEX 1SYTA 3UNTA 4MIMA 1W54A 2HVOA 3GVRA 3M07A 1H7WA 2Y62A 3FJ6A 3VGGA 1F2JA 1O95A 3EB3A 4GACA 5D9OA 1TV4A 4FP1A 2C7FA 3COTA 5A6MA 1JPHA 3WDJA 3PUEA 2CLPA 3R4IA 3T2QA 1MW0A 3TTSA 3DERA 4J28A 2O4MA 1FWGC 1J0IA 1LLQA 1E4MM 2OEMA 5ABTA 4HZMA 1XJBA 3W7JA 3RJXA 4ALDA 1BAGA 4L9ZA 4YS1A 1DQUA 2QJIA 3MHFA 9XIMA 1IWPA 5C0QA 4LNCA 4QNWA 1ECQA 4XAPA 5EB8A 4W7WA 3HOJA 4MKSA 3VX1A 1BG9A 4AHPA 4ZBCA 1AA1B 1C93A 3TONA 3O2LA 2CLLA 4YIWA 4RR4A 4DEFA 3O7UA 2XSBA 1GEQA 4QS6A 4Z1YA 4C6PA 3OLDA 1HJUA 3H7RA 2GJXB 3EMCA 4XBSA 2CHRA 3IK4A 2HS8A 1HP4A 2OTDA 4ZFMA 1HP5A 1JXJA 4E2DA 1G4SA 3SSZA 1IXNA 3TE9A 1JRCA 5T9CE 1UBSA 1US2A 2OKOA 5HQEA 3ABZA 4TX6A 2EEXA 2J6VA 1DL3A 2VC7A 4ZE4A 2WYSA 1Q8AA 5F2GA 2PBGA 3AXMA 2VTFA 5HNRA 2BVWA 3CQKA 1QK2A 1E9ZB 3NURA 4M8UA 2ACSA 4BI7A 1AQ0A 3PPHA 1UROA 3QH2A 3AUJA 5DN1A 1W0MA 1FWNA 2PDPA 3GVQA 1THFD 3SRHA 2PEVA 2EXOA 1ODZA 4HU0A 3VAVA 1KTCA 9XIAA 3QKZA 5K4XA 4Z1AA 3KDOA 4CNNA 4ZO7A 2XIMA 4JTUA 3MA8A 3EDJA 4UTIA 3I7SA 2EG6A 3V0UA 2BFGA 3IUDA 4MWAE 1C8XA 3FJNA 4NL1A 1B3WA 4H6RA 3HPAA 4W9TA 3GAKA 2A85A 1LXMA 3EDFA 3ZR4A 1U1JA 5G4WA 2DQWA 2CYGA 3OLGA 4B9ZA 3BLDA 3EOEA 2QS8A 5DCBA 3GTFA 4UFMA 3LD5A 1VC4A 1H41A 1QBAA 3L4VA 1MFUA 4PUNA 1WP6A 3O8AA 3QQ1A 1XISA 4TOQA 1CXEA 1NFGA 3THUA 3P6LA 1JVNA 1JPMA 2Z00A 2J78A 1L6GA 4M7SA 2P0OA 3G1DA 4JQAA 4XD5A 5G2WA 3TCEA 4S3EA 4PMOA 3PFMA 3E5PA 1LOQA 4YXGA 5LSMA 1EJVC 4ZQNA 2WVVA 1JAKA 2DUZA 1OFEA 4S1FA 3MT1A 2QUTA 3KRZA 5JVLA 4LGXA 4TUFA 1W5MA 1FWBC 2PS2A 3GKFA 4UR7A 1KBIA 4UR8A 1GONA 5HJYA 2CBIA 2OWXA 4Y90A 1IIGA 4YNGA 4NI8A 4O8RA 1JZ4A 5IRPA 2VNCA 2ZA2A 4FLSA 1LWJA 2WC7A 4MJ2A 1DBTA 2GGEA 4WY0B 2WLYA 3WFLA 1UYQA 4HHHA 3GW3A 4HHMA 4AIUA 4HHLA 1SO6A 4RJEA 3HFTA 4ZSUA 1B30A 4LAOA 3BCFA 1GKRA 3SBFA 4DN1A 1F7BA 1N7NA 1RJRA 1T40A 4C6JA 2C14A 3AAMA 4IMEA 4UCGA 1GZ1A 3UFYA 1R3YA 2EPMX 3NQMA 1PX4A 4HNVA 5C9UA 3BUVA 3QSRA 4TU1A 3VNLA 1W5PA 2P76A 2XSXA 2NT1A 1SFLA 4Q7NA 1TV3A 3FGCA 1IGSA 2PLKA 3DG7A 1FDZA 4OBSA 1ZBVA 2FPYA 3AZRA 2WZHA 4J1OA 3OHIA 1JCLA 3ITXA 1ISWA 5HUPA 4C6BA 4TVCA 2G3MA 5ENLA 3A13A 5EPDA 3KOFA 3NZQA 4N9EA 1UD4A 1RBLA 3C0JA 1EA0A 3ZFHA 4JTCA 1PKLA 2INZA 1PUDA 1WOAA 3CZGA 4X0NA 4Q4SA 5H2ZA 2WVTA 1J79A 4A8RA 1CZ1A 1HO4A 4O0KA 3EKLA 3RO6A 4AD4A 1MEIA 4P8UA 1Q6RA 2ONEA 1KM3A 1P0NA 3ZMRA 2OO6A 3OQ8A 4IH3A 1Q6GA 4O57A 3N2TA 1F6YA 1G7VA 3A3HA 3M0ZA 3T08A 3LNMA 2YXOA 4YN5A 6TIMA 1SMDA 2BOFX 3A22A 4HKPA 4V15A 4MPQA 3NO3A 2VCCA 1QR7A 1H62A 4IHCA 4O53A 4LYKA 2YBTA 2VKZG 1X1JA 3K8MA 1Q6FA 1LT8A 1EEPA 2WK2A 1V03A 2WNNA 3PUGA 4TV6A 4B5UA 2OFJA 4PB3A 4FIQA 2A6LA 4UCFA 5I3KA 4HD5A 3RX3A 3UCCA 3GXTA 3GH7A 4E0CA 2XFRA 4JQ3A 5BWFA 2BV9A 3H2OA 2E0PA 3E2RA 4UFIA 4QJ4B 1SR9A 4EXQA 4K1WA 3VUPA 3OZMA 5M03A 3HTWA 2YBUA 5HUOA 1TPDA 3SCOA 2FFIA 1GG0A 2PGRA 4QITA 2E6YA 3OTRA 1UKSA 4LTSA 4ZL1A 5ABHA 2X7WA 4I9JA 3I68A 1Y7VA 2ZX8A 2I57A 5A8MA 3WUGA 1SVDA 5HJXA 4K3ZA 1H60A 2DUAA 3TA9A 1OSEA 4L9YA 5JIWA 3OJGA 3KS5A 4PL2A 3GFYA 2GFTA 1JD7A 1LL7A 1N55A 1U1UA 3CUJA 3N4AA 1JF5A 2J4GA 1E3XA 3IPWA 4QE1A 3GNRA 3ARSA 4IXHA 4DI9A 4C90A 4UTTC 3L4UA 2HK1A 4REQA 2CLEA 1P1XA 3H55A 4ERIA 3LN3A 3PP7A 3UWUA 1C92A 3AS2A 3DFPA 8XIMA 3CH9A 5DMLA 3SUTA 2Y61A 2FB2A 4FLQA 4JKLA 3M9YA 3O1NA 3S5YA 3GR8A 1XGEA 2PE4A 4K8EA 3G1YA 5AKQA 1DIEA 3ECQA 3W1MA 3QPYA 3TFCA 2H9AA 4U3AA 3R8RA 1YE4A 2CBJA 4ORMA 4H8VA 1E9IA 3TROA 5I3IA 3F4WA 3N04A 1OFDA 4L6OA 4LRSA 3RHGA 1EIXA 3W1PA 3G8EA 3S1XA 5EGRA 1EDTA 1W3IA 5DO8A 1W5NA 2WJDA 4H8NA 3GNNA 5AHFA 4F66A 3PZVA 5U4NA 5CJNA 1YW1A 4FXSA 1VBUA 4EAYA 4M1RA 2GWGA 1SSDA 5EMUA 3UG3A 4F9DA 5JH2A 2OR2A 1M5WA 4AF0B 4QG6A 4GVGA 4JFVA 1UKOA 1JD9A 1W91A 3WNPA 4H1ZA 2GSJA 1D2KA 2G41A 3B0UX 2BHYA 4WLCA 4Y9MA 3W74A 3W2UA 1E5NA 1A5OC 1AL8A 1FDYA 2PDXA 2Y2WA 2YL5A 4YTQA 7A3HA 4D6EA 2W9MA 3O6CA 1RZMA 3NQEA 3G8RA 1Z69A 3L5MA 4LBUA 4QG9A 4PE8A 2EJAA 4G7EB 3UR8A 3WQPA 1DJNA 4XO7A 5CJ5A 3TLLA 2DSZA 2QLYA 4RPQA 3ZJKA 3F5LA 2QMKA 3TEVA 4L1XA 1AQMA 1FFRA 2NVCA 3FAXA 3L12A 3AIBA 4DBUA 1GVFA 3CIVA 4LUTA 2BS9A 3EEGA 3DIPA 5AB3A 5FI8A 3DFSA 3QEZA 2J24A 1M7JA 1YNPA 3ARXA 3ELFA 4FX6M 2DORA 4FX7A 1LF1A 2Q01A 2QGHA 2XPKA 2J7EA 3S9ZA 3NJ3A 4ML4A 3BURA 4A35A 3UESA 4ES4A 3M5YA 1KM1A 2O9OA 4MVAA 4V27A 2VEKA 1K6AA 3MJMA 2WKGA 4XD4A 3M7WA 3LUTA 3TQVA 1E4NA 4EF9A 2A79A 1SPQA 2FPTA 5E0KA 4C6LA 1HXJA 3P81A 2WVSA 1BSIA 1S3TC 4U5KA 3KTSA 2DJXA 3ONBA 3DFTA 3NVDA 4PSRA 3OG2A 4U2ZA 1ADOA 1UR8A 4IGMA 2KXSA 1KV5A 4X3ZA 1FA2A 1ME8A 3VDBA 3GNXA 3NM3A 3POCA 1S39A 4CU7A 1I2OA 1FX6A 4WUIA 2OZ3A 5ECVA 3K1DA 4MB4A 3RMEA 4R27A 3MJYA 1C7TA 3I6EA 3JS3A 1H7PA 1TMLA 3LPPA 2Y7DA 1IV8A 3TSBA 3IV8A 1KM6A 1XP3A 4CN4A 5U7SA 3S1WA 2QPUA 5HAOA 3CB8A 1B90A 1E6RA 3SGZA 4R3UA 3IUIA 3NOYA 1W9PA 4GZIA 3LTYA 3NA8A 4AC7C 2YEPF 4YL2A 2OYLA 2C71A 5H1WA 3IRDA 3CUGA 4GYKA 1U2YA 3WLIA 2ZUNA 3TC6A 2BWGA 4L9XA 1YMYA 2VEFA 2JF7A 2XZ9A 3D3AA 4HZ7A 3HA1A 1JPKA 3R79A 3BAJA 1ZJIA 3REQB 4A2RA 2OSWA 3EX2A 2DVUA 3QYQA 2PLCA 1LBFA 1XFBA 1K7XA 1NP0A 1UD5A 1RQEA 3QBUA 2BX7A 4M80A 3FOKA 5EMMA 3E2SA 4A3QA 2AAAA 3ABQA 4DWSB 2V3FA 3WEOA 1KXHA 3R13A 2C0AA 5D9MA 2O55A 5HJLA 1TVPA 3BCJA 3CO8A 3H2CA 1VQTA 3E96A 4HQVA 3FVMA 3BQ5A 2JIEA 3M0IA 4WIWA 1XRVA 2UBPC 3AIUA 1XIDA 3NSMA 4RE4A 1QU4A 4E38A 4ILSA 1LDCA 5A6TC 2G3NA 4I9AA 1M68A 3G1FA 3BXWA 2CHNA 4IUGA 1KKOA 2IKHA 4R34A 4PFMA 3CO4A 1M04A 4GISA 3SM0A 3FHAA 3VILA 3OIHA 1GOWA 2Q71A 4AYGA 3NQBA 2ZZ4A 2QJMA 4EWJA 2FZ8A 4ZQMA 3S1UA 1CLKA 2AQOA 3C2RA 2VEIA 2OEKA 1XIEA 4XQ6A 1JQXA 3AJ7A 3CUZA 3SB0A 1SMAA 3GD6A 4P8VA 1UD3A 3N14A 4UC5A 2C3ZA 3ZIZA 2XH4A 2V4IB 2J66A 1UW9A 2J47A 2YCLA 3GXPA 5KSWA 4ZZ9A 1F07A 1V3HA 2G3JA 1ZLPA 1V6VA 3NQ6A 3MS8A 3LLXA 2VI0A 3NYDA 3VGFA 3CQHA 1CXLA 3UZXA 1AQHA 1TMHA 4MWAA 2CXEA 3B8VA 5HWMA 4BF5A 4FOKA 1BYCA 1YDYA 1H5YA 3N9KA 1ONEA 1H49A 1X1IA 1PV8A 2PTXA 4US6A 1S46A 4H9ZA 2YZ5A 3K8KA 4NQ1A 4ACZA 5KEZA 3UJEA 3VIIA 1TZ9A 4CGTA 4WR3A 3DI1A 1GVEA 3EDKA 4HYVA 1BLIA 1P0DA 3LI0A 4WY0F 1Z41A 5E6ZA 3W7PA 4CCDA 1AH0A 2NXHA 3WDQA 3LY0A 3AI0A 1US3A 2RDUA 4K7YA 2DZUA 4N02A 1M41A 3EXTA 4XZBA 2V30A 4AD3A 1SFTA 3THCA 3NR0A 1LM1A 1CB8A 3HMJG 1QI5A 3IV3A 1ECEA 2HPIA 4NAFA 4NX5A 3H4XA 1JI1A 1R7AA 1C29A 1XBYA 6ENLA 5CC7A 5AVHA 2VOMA 3ARPA 1UP3A 3JUGA 1JI2A 5T26A 3C6CA 2NX1A 1RLCL 4HA1A 4Z2KA 3EWXA 3NZPA 1BYAA 3LRLA 4Q7IA 2ZRYA 4ZXLA 3C2FA 4PMZA 1VYSX 1V93A 1KM0A 3TMQA 1P6BA 1PIGA 4HZ6A 5DF0A 4QDWA 2H3DA 4GH1A 1KQYA 3LPOA 1FWCC 4DWSC 2F9RA 3T44A 3RX4A 1NDWA 1NTHA 3B9DA 1OEPA 2ZX5A 4GQ0A 3DN5A 3FSTA 4QM1A 2XZ7A 6XIMA 3BG9A 2XHYA 4A8LA 5EFFA 4JNMA 2ABBA 1EKOA 1PAMA 2WHKA 1ZBWA 3G1HA 5ABGA 4Q4PA 1BXBA 1ZP3A 1GYNA 4MNKA 2BB0A 3DDMA 1VCVA 2AKMA 3GDLA 3PZGA 1MXGA 4D6JA 3VOFA 1O5QA 4GJ1A 4ZGYA 4HMEA 1F6KA 3B9AA 1EYEA 3W7NA 4ERAA 3I4KA 2ZDRA 3VIJA 2DZSA 4AH7A 1RP8A 3NQAA 4AZ7A 3B0YA 2DPEA 2YCKX 3W27A 1RCQA 3I6TA 4EPEC 4I5RA 3FVDA 3DFHA 3WK1A 4R7WA 1X38A 5CEWA 4FXFA 1UC4A 1XCXA 4WDXA 4BI6A 3KBJA 3FFSA 3A23A 5D2TA 3VNZA 3CTTA 4GLEA 3W76A 2PWGA 2FVMA 1ZRQA 3SRFA 3FYYA 2C1GA 4L6DA 3T0CA 3KL3A 4QSHA 3DOPA 2PCQA 3GFZA 3E74A 1KFLA 4OWGA 4G9PA 1WUEA 5BXSA 6REQA 1N2VA 3O0KA 2R9RA 1OX4B 2VDIA 4AY1A 1XYLA 4XX6A 5GVJA 1QCWA 4EPKA 1G6CA 3OA3A 2QUUA 4W88A 2BZNA 1SJAA 3H2NA 4XO6A 1SW0A 4DLOA 2CC0A 4QQUA 2J7FA 3R7MA 4FPSA 1CGVA 4FA3A 4IG2B 3VD9A 3IT4B 5GNXA 1E43A 1QFEA 1SSGA 5FF3A 1YNQA 2QT3A 4FMVA 4D6GA 1F76A 4MB5A 3O05A 4YVPA 4AWSA 1KQZA 2PFHA 1JL8A 3W29A 3RPMA 4MLJA 2G8ZA 4BQ5A 1NOWA 4LAZA 4DZAA 2PDGA 4AZCB 4XUYA 1E71M 5IOBA 5FJUA 1RY0A 3EA2A 1JF6A 4MWAD 2PDWA 5FKYA 3SCRA 2VFDA 4GHRA 2Y85A 1DJHA 1TR1A 3ARVA 1IEXA 2VOTA 4IPJA 2P88A 1T41A 1J0NA 4AD1A 2EHHA 1XIHA 3NGJA 1Y5WA 4L6HA 5HNTA 2ZA3A 3PR2A 4MJZA 4UTKA 2J7HA 4DQWA 2VO5A 1QNQA 4LVGA 4Y8FA 4QAIA 2ISSA 4Q4OA 1DP0A 1A49A 5BMXA 2E4TA 3CK5A 3E9AA 4IPLA 5K9DA 4EK7A 1XHGA 1H7RA 4LCSA 4HPHA 2PBOA 3IJ9A 2OX4A 2PDHA 4IGHA 4IUOA 3BO9A 3I6RA 3PG8A 2QIWA 2CZ5A 1UD2A 4PCNA 1A80A 1JZ6A 1R2SA 3H22A 3DFYA 1UIPA 5DT7A 3GG8A 3M0HA 4PTVA 3N2CA 2ZX7A 4V1XA 1QBBA 4FALA 1LL6A 2JIWA 4U33A 1XBZA 1V02E 5EMLA 2B4GA 5D4YA 1FWRA 3VI2A 5D2WA 3UU0A 3V4BA 1JNDA 1AH4A 4ZQPA 3HBLA 2GYIA 5G4EA 3T0DA 1KFKA 1XYZA 4HN8A 1K8XA 3NPVA 3MW7A 1CPUA 3GDBA 1FHLA 2DW6A 1ISXA 3SUVA 2PDFA 1Y8BA 1DORA 1B5TA 1YEYA 1DXEA 1XYFA 3MCOA 1ZAHA 1AJ0A 1IWBA 2GSHA 3KVMA 3TIMA 4JTDA 4J9JA 2CLMA 1J11A 2Z29A 1DXFA 1WDWA 1QO5A 3AXHA 3N18A 3N19B 1AODA 4HPNA 1EF2A 1R47A 1KLYA 3YPIA 3CHVA 1EC7A 3UBPC 4UQCA 1CTNA 5IBXA 3WDRA 4K1GA 1A5BA 5JQ9A 3GIPA 3ANVA 1XQLA 3WEZA 4KFNA 2ISWA 2R14A 3FLUA 4CNTA 2OMAA 3GX9A 2OWCA 3B3DA 3Q94A 1LQ0A 4MHBA 3KX6A 4C1NA 4HSNA 3GYEA 3B97A 4QDPA 1W6TA 5C2GA 2OT0A 4DNHA 3W26A 2FKPA 2IMRA 1UPPA 3M0MA 1MI3A 4I6KA 1RA0A 3OZYA 1Q6QA 1K6WA 1RVKA 3V16A 3U4AA 3TVAA 3ZJ7A 1CGTA 3G3DA 1UR9A 3MDWA 4RDYA 3WNMA 4O1EA 3S2LA 3VGEA 2B7QA 1SO3A 4WX2A 1SUXA 3UWYA 3SIMA 3T0AA 2XG9A 4YWIA 2QDHA 2QW5A 4JAWA 3O3RA 4FI4A 3W7DA 3A6OA 3MHGA 1UR3M 5A2CA 1TRDA 3CHDA 4AISA 2V2HA 2EAWA 1XLCA 4TVDA 4B3LA 1UOKA 3IAQA 4BKNA 4RE2A 4CD5A 3MHUA 3R12A 3S0CA 4H6EA 4LEQA 3FA4A 3FDKA 1X1ZA 3AYRA 5LIXX 4JHOA 7PTDA 1RK5A 2DZWA 1GJUA 1XLHA 2NQHA 4PBFA 4LB3A 1WQ5A 5FJTA 5HPOA 3VYLA 9CGTA 4WDTA 3DENA 3KBNA 2VX5A 1TR9A 4XK2A 4XBJA 3VK5A 3DHPA 4JYEA 3GDTA 1KGWA 4JXCA 3RCYA 1CX9A 3QZAA 3BMVA 1S1PA 3LI1A 4KWSA 1V77A 1QPOA 2XM2A 3WH5A 1EHNA 1GQJA 3ZVIA 1K8CA 1TVLA 3NQGA 5C5YA 1G7UA 3RF9A 4HBKA 1CW2A 2PD9A 3KTCA 5JIPA 3W7OA 4UMCA 3C2VA 2HZGA 4ZFCA 4AZBA 2J75A 3DH7A 5EMYA 2E67A 3S1GA 5CSUA 4CQCA 4QISA 3TUUA 4GOAA 3SN4A 4NRRA 2DT3A 5BXRA 2GQ9A 1P5BA 3L23A 5ECUA 3QSTA 3H70A 3TCSA 2Y7EA 4XTIA 2OX1A 5A8OA 3CB3A 3BLKA 1CGWA 3W7CA 3UD1A 2ZYFA 1CBGA 1UUQA 3GH4A 2AL2B 4RZ4A 4R7JA 2CLIA 1Y65A 4JTIA 1E0VA 2YSWA 2NW0A 1H7NA 3GTIA 1DJXA 1WPCA 3SJNA 3THDA 2A7NA 5D8WA 1LLWA 2W27A 2FB3A 1ZCCA 3KBVA 5B7YA 4M6VA 2YBVA 5I3DA 5H8UA 2ZVRA 1VZWA 2D2HA 4AZGA 3P84A 1ZBKA 2OB3A 4NI3A 2Q8XA 4IISA 4P5UA 4GI9A 1OK4A 4QNEA 3UR7A 3FW6A 2PTYA 4H9XA 2YR1A 4BR1A 4LYQA 5DMYA 1K1DA 4NJJA 2A3BA 2X1TA 3CAVA 3VCNA 4HOWA 1XRFA 4N2YA 4DUWA 1X7IA 4Z17A 4Q6JA 3SUSA 1KB3A 3AHYA 3FDGA 3W23A 4MY1A 3PBYA 4LVBA 1B3ZA 3NPWA 3EWYA 3AALA 3NIYA 4KWWA 1UCWA 5A5WA 4A3UA 4CEXC 1FWJC 4IIHA 1V0NA 4NIRA 1N8WA 2VFIA 3MTWA 4RPPA 2E28A 4B3ZA 3UY7A 1QT1A 5M3WA 4FOJA 2Z2UA 1PTAA 3VNKA 1DIDA 4YTSA 1RJPA 3LGDA 3CUFA 3WYZA 4Q8PA 4CKQA 1HUVA 1N7QA 3WF2A 3HPSA 3LLFA 3RX2A 1OJMA 3TC7A 1KCZA 1M7OA 4LBSA 3VM7A 1H50A 4H00A 4I3GA 1GTEA 4WDUA 3D46A 1AJZA 1NDYA 1MQPA 3IUHA 4K39A 4HU4A 1TPVA 4R33A 3BZJA 1ZUAX 2J7CA 4Z08A 3VKJA 4HTBA 1XYCA 3IGXA 1EC8A 4ZMGA 2WMIA 2C6QA 4JTGA 1PEZA 3MMUA 4AZ6A 4DO6A 4GY1A 4UQEA 1G4TA 1XF0A 4FNUA 2ISFA 3CMGA 3QM3A 4K7VA 4YWSA 3QY8A 3VABA 5ABFA 3QJAA 2WV8A 2VRQA 2WZMA 4G5DA 1NEYA 2QJNA 4D6HA 1KBBA 1RALA 1XX1A 1W1IE 4DNMA 4Y9NA 3D47A 5XIMA 1L8NA 4D6CA 1OINA 1ZFJA 2WBGA 3TR2A 4S3JA 4US5D 2PC4A 3RJYA 3UYIA 4OHQA 1DQWA 3CU2A 3E0LA 4C6CA 1H3GA 3IWPA 4AYSA 4GUIA 4NF7A 2GOKA 4UTJA 3MUXA 1Y5XA 1HJXA 4Q4QA 3VIMA 1K7FA 2VCBA 2TAAA 4K36A 1O5KA 3KCOA 2J8FA 3ALGA 2PWFA 4OQVA 4WK9A 1RBAA 4E4FA 2X16A 3H12A 4P7RA 1UR4A 2PDUA 3W72A 5CBJA 4Y8EA 1C91A 3GM8A 4JYDA 3PPCA 4HPJA 2ZZ6A 2PUZA 4KWOA 3PJTA 3T05A 3H4WA 3V5CA 3WUFA 5CPNA 1XUUA 1KR1A 2VRJA 4CQ8A 4JYFA 1RWCA 3WH6A 4ATDA 2G96A 3L4ZA 2Z25A 4PEKA 1MVYA 3W7GA 4YCOA 4AZHA 1RWHA 1WAWA 1RWAA 2WOQA 4H2CA 5CCZA 2HNHA 4Z0SA 1JDCA 4R88A 5HQLA 2VT0A 4B3KA 3S3GA 3M1ZA 1LP6A 1OYAA 1H09A 4D1JA 1NELA 2GL5A 4NP7A 3UZJA 2D23A 4UQAA 3GW0A 1PWLA 2CKRA 3ABOA 3LEPA 3TYBA 2ATSA 3ZQ9A 4PTNA 3M16A 1PZ1A 1NVMA 3UEQA 1Q3NA 3R5EA 4C5YA 4JN6A 3M0JA 3B03A 5AC5A 3SR7A 1XCFA 2UZ9A 3EMZA 3QTGA 2WM1A 3ZVHB 4RE0A 1IXQA 3GNPA 2PP0A 3N2XA 3N13A 2VGFA 5C54A 4Y9AA 5G1YA 2IQ0A 1F9GA 3KRBA 3UQNA 3VDGA 3W87A 2J79A 4GZ7A 4PUEA 1DPMA 1IZKA 4J3ZA 3RAOA