4D6GA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the blood group a-trisaccharide (l19 mutant)
Total Genus 224
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
224
sequence length
587
structure length
587
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYHTSAHWLSTSWIDKMYQKYPNLHGIFSTESYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords GLYCOSIDE HYDROLASE
total genus 224
structure length 587
sequence length 587
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6gA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6gA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6gA02
1XD1A 3NSMA 3CMJA 3VGHA 3BSGA 4ZE4A 5IHSA 4D1IA 1HMWA 3CBWA 5ABEA 2QHAA 3HU7A 4HTYA 4AW7A 3GM8A 4OZOA 1H49A 1SR0A 2CBUA 4HU8A 5EFFA 2QPUA 4PSRA 1DHKA 3I3EA 1H1NA 4MJ2A 4GQQA 2WBKA 1LOHA 3AMCA 1CTNA 4C7DA 2CYGA 2V3EA 3WDHA 2YKKA 4JFUA 1UD8A 1J12A 3THCA 2XGIA 4XZBA 1VFFA 4MADA 4H8HA 3VPLA 1C82A 4W7WA 5FD0A 2O9OA 4QAWA 2XM1A 1E70M 4XV0A 3N15A 1ZB5A 3RJXA 1RWFA 1E6XM 1WDSA 3ALFA 4UQDA 3K8KA 1P6WA 1W1YA 2E9LA 5JBDA 4ML4A 3SUUA 4N0RA 3ZR5A 4CN4A 1NP2A 2WMIB 2VI0A 1V0MA 4E8DA 5M5DA 1UKQA 2J7BA 4W8LA 3CO4A 2AOSA 4BS0A 4HOWA 4UFMA 3GNPA 2V3DA 2WW5A 1XC6A 2D2OA 4W87A 4RL3A 4ATDA 3WQ5A 1EGUA 1CGVA 1BYDA 4S3KA 5HPCA 2BHUA 1EHNA 1GJUA 3AI0A 1KBKA 1D3CA 3WUEA 1N82A 1ZL1A 3AZSA 1B3VA 5KEZA 3CTTA 3CZGA 3WDJA 1NOWA 2ZUSA 3SCQA 2A3AA 3AHXA 2VQUA 1E4LA 4UFJA 1ZJAA 1ITXA 1WDQA 2J74A 3VIMA 1EO7A 2PWEA 1QI4A 4W84A 2ZUNA 4LGXA 3OBAA 4Q22A 1V0LA 5BXRA 1E43A 3T2PA 1Z32X 2VZSA 4NF7A 3B8SA 1FH8A 1UH3A 3ARUA 3WELA 4DUVA 1OINA 4XX6A 2BFGA 4W89A 1TR1A 3VD7A 1HX0A 5E6YA 1LWJA 1NQ6A 1K9DA 1M53A 1TE1A 2W91A 1A47A 1LXMA 1UWTA 4GINA 3O9NA 1Q6DA 1TVPA 3SCPA 2CXGA 3ARTA 2BRPA 4AY1A 2BXZA 1C3FA 2OLHA 4W5UA 2VZTA 3ZSSA 4ATLA 1JF5A 5A3HA 5CXPA 2VR4A 3CZJA 2WLYA 3ARWA 1J0YA 2OYKA 2VUYA 1H0IA 1LQ0A 1HIZA 1VFOA 1F9GA 3AS1A 3GTNA 1VENA 1G0CA 1CXHA 1UR9A 2J77A 1E4MM 2VX5A 5LYRA 3W6MA 1I8QA 1BGAA 1E0XA 3HMCA 5BXPA 1WZAA 4AZ6A 3PZ9A 1HKMA 3WH8A 2WM0A 4FLRA 3W0KA 2WCOA 5F7UA 4XZWA 2GK1B 1W3LA 1WZLA 5BWFA 1JAEA 3CHEA 4EANA 4BQ3A 1GPFA 2WPGA 3CMGA 1OJOA 2VX6A 4WLCA 3WNNA 4UQ9A 1E6SM 5DEZA 5JIPA 4EKJA 5IDIA 4E2OA 3K8LA 1UR8A 1J0MA 3WF2A 4CVWA 2W67A 3VD3A 1HVXA 1HJQA 1KQZA 1KGXA 2GJXB 1RH9A 2E9BA 2WXDM 2FGZA 1RWHA 1BYAA 4QLKA 1B3XA 1M01A 3QOMA 1J0JA 1E73M 4MAVA 2X09A 3A47A 4HZ7A 2WMIA 1OT1A 1W3KA 1HP4A 1ECEA 4DWSA 2WC3A 2WVVA 1HJWA 4PYSA 1GQIA 1IZJA 3ZJ8A 4M56A 4TX6A 5A6BD 4UOJA 4PMRA 3IANA 3PZVA 4CD7A 3VIJA 3UCQA 2W5FA 4ACZB 1WB0A 4RE3A 1BFNA 3ARRA 3W25A 1OWQA 4QP0A 3NDYA 3VVGA 2UY2A 3PZIA 5DT7A 4TVUA 1QPKA 4JKKA 1UZ1A 4J27A 1MW0A 1X6LA 3AFBA 4JCMA 1N7NA 2W61A 3FAXA 1DWFM 3FHQA 4UFIA 3NSXA 3GXIA 5EB8A 2AMGA 4AZCB 2CESA 1O6IA 2VNCA 1E1EA 1W3JA 2V5DA 2FH8A 1DTUA 2OSYA 2Y24A 5BXTA 4AD4A 4LXFA 2VR5A 5CLWA 4PRWA 5A2AA 3VU2A 3AS2A 4HMDA 1CYGA 1GOKA 4NZCA 1GHSA 3OA5A 1RP9A 2BNJA 3VGBA 5A8MA 1W2PA 3WEMA 1JZ4A 4Z2HA 1MFUA 5AC5A 1E6QM 1FOBA 8A3HA 1XSJA 2W66A 1WKYA 2VMFA 1UWUA 2JF6A 4P7QA 1E56A 1KWKA 1WPCA 3T08A 2EBNA 3AXXA 3TONA 3FN9A 1Q6GA 1EHAA 1UUQA 4S3JA 2V38A 4F66A 4D6JA 3RJYA 3QHNA 1XSKA 2JIEA 4PUEA 2WLZA 2CITA 1LJYA 1MW1A 2D0GA 4OOZA 1JDAA 4GI8A 3FHAA 4CCEA 5A6KA 2D0FA 3W6LA 3TTQA 2WWCA 5D8ZA 2CHOA 2VZVA 1PJ9A 3D5HA 3L4XA 2PI6A 4PMVA 3TTSA 4Z2JA 1HKJA 4Y7EA 1MYRA 1HKIA 3EMCA 1ZJBA 1JYNA 1DWHM 4PMYA 2JF7A 2ZICA 1U30A 1QNRA 3A6OA 4LX4A 4MNJA 2J4GA 5BYWA 3I3BA 3VNYA 1LL7A 3KE0A 4E8CA 3DECA 4J3VA 1JGIA 3PZTA 1OIFA 3VDHA 3WKZA 1HT6A 3SCVA 1UOKA 4BQ5A 4P8XA 1GUVA 1NWTA 3HN3A 1QNOA 2XPKA 1V3IA 3U5UA 1RP8A 1KB3A 3SCOA 1HKKA 4W7VA 2YL5A 4KRTA 2OWXA 2EPLX 3QOKA 4A4AA 1BPLB 1EDGA 1DWGM 3APGA 5CSYA 2WSPA 1DWAM 1PPIA 4IUGA 3BLPX 3N9KA 4FLOA 3ZO9A 3ARSA 1AVAA 2DT0A 3K8MA 4D6IA 1PX3A 1ISYA 3W82A 1UQYA 4FK9A 1WE5A 2BY0A 4YN5A 1UR2A 5JUVA 3OIHA 4GZIA 3AMGA 5I79A 3SUTA 1OM0A 3O2LA 2XFYA 3CHCA 1C8QA 2J25A 3AROA 1BTCA 4WF7A 3GBEA 3UERA 1IZKA 4PSPA 3WBEA 2F61A 4JFSA 4D1JA 2JE8A 6CGTA 3WH5A 4C7GA 2OWCA 1OJMA 4B15A 3BMVA 4P7NA 2QPSA 3MANA 4AIUA 3M07A 1HJVA 3MU7A 1PZ2A 1QI2A 4R5EA 3BGAA 4AZIA 3NCOA 2BY3A 2BVTA 2IXVA 2VRJA 3EMQA 3K4AA 3MUAA 1C7TA 1MVYA 3K46A 4D6FA 1W3YA 4CKQA 4HOZA 3WD3A 3OG2A 5CQ1A 1JYWA 4OJYA 5GNZA 1OIMA 1F4AA 3WQVA 1C8XA 3GZAA 4Z2KA 4TTUA 4AZHA 5HDRA 4KH2A 4DUWA 1F1SA 4P8WA 4MPKA 4H41A 1HF6A 1EQPA 3ARPA 3WMSA 4AZCA 2E22A 3VD4A 3CHDA 2QLYA 2QF8A 3BSHA 1M03A 5A6SA 5CZKA 2BS9A 1SMDA 3N18A 3UG3A 3U7VA 3B9AA 2J7CA 3OLGA 2CEQA 1XYFA 1E71M 2PWGA 2WZIA 4JFTA 2OYLA 2GVYA 1E4IA 4JKLA 2BRWA 3RM9A 2A3CA 3NYDA 1N7PA 4JKMA 3W38A 4PTMA 1OD8A 5E9AA 3MMUA 4XUYA 1OGBA 3PTKA 3AJ7A 5E09A 3S6TA 3WNLA 3GXFA 2D3LA 2G4FA 3SCWA 1W9BM 2YDSA 3CH9A 3RDKA 2WCSA 5GQBA 3QR3A 3VDBA 2YL8A 4J7RA 5C71A 1BF2A 1GORA 3BMWA 1PX8A 2WHKA 1H09A 5ABFB 1E5NA 2W4XA 1E1FA 2UY5A 2OYMA 2PWDA 3VIPA 4PMXA 4XB3A 4W5ZA 5AC4A 2ZUVA 1JI2A 2WMGA 1J9YA 4W93A 1UR4A 4M80A 1UWIA 5DF0A 3AS3A 3IAQA 5AYBA 3WEZA 4X9YA 3AMDA 1ESWA 4NSBA 3WFLA 1UR0A 4RE4A 1SFSA 4MB3A 4PCTA 3DHUA 3PBGA 1NWUA 1FFRA 3MV11 3WF0A 2NT0A 4MTVA 1N7QA 2TAAA 1AQMA 3WEOA 5D9OA 4JZ5A 4U5KA 2E9MA 3CZKA 1KQYA 3WD2A 1QHZA 3KWXA 5EFDA 4CD6A 2WVTA 2D1ZA 2JFEX 1W9VA 1XCXA 3RILA 1TA3B 2D20A 2GJRA 3LPOA 1JXJA 1VBRA 3WUFA 1EDQA 4RE2A 1OGSA 3WSUA 4P7RA 4V27A 1JZ2A 3WDPP 4AMCA 3POCA 1E6RA 2E0PA 3FXYA 3IAPA 1HL8A 4TVDA 2WANA 5I2UA 1EGZA 4UQCA 3PZUA 3ARQA 2GDUA 2ZUWA 2PC8A 3ARXA 5A1AA 1F4HA 1CEOA 2ZX5A 1Q6FA 2YLAA 1GOIA 1U33A 1WAWA 3ZT6A 2O9RA 3WL1A 5CJ5A 2J7HA 1UKOA 4WSJA 7TAAA 3PZGA 5A69A 3LPFA 4WKHA 1SMAA 2XVPA 3WH9A 1MXDA 2GK1A 2XSBA 3J7HA 2XVLA 2ZWZA 1L8NA 4MB4A 2WAGA 1E6PA 6A3HA 5A6JA 4U2ZA 3K4DA 5ABGA 1XD0A 2A3EA 4J3WA 1WO2A 4X0VA 2Z1KA 4TXEA 3CZ8A 4UFLA 1NP0A 2E40A 1FFQA 3GXMA 1KXHA 3T0AA 3AHTA 1B3WA 4PTWA 2WK2A 8CGTA 1TVNA 4OBSA 5A6BA 1QBBA 1K6AA 3FY1A 4GO8A 5M03A 1MXGA 1UD6A 2E8ZA 4U3CA 3W81A 4TX8A 4BA0A 1XH2A 2YA0A 1JDCA 4QLJA 1J0HA 2EPMX 4DWSB 4PMDA 2WKLA 3L2LA 1VFMA 3AXHA 5DT5A 5I3DA 4J3TA 1K9EA 1Y7VA 3AMKA 3NDZA 1QBAA 2DPEA 1V3KA 3WD1A 2YBTA 3N12A 3ZT7A 4DM2A 3UETA 3ZR6A 1FP8A 1ZU8A 2JALA 1E15A 3MMWA 2A3HA 1CXEA 4PBGA 1Q6EA 1MWOA 4NRSA 4D71A 2XHYA 5A94A 1HN1A 2V3FA 4TTGA 2NT1A 1Q6CA 5TD4A 3OLDA 4ACZA 4UTFA 1V3JA 4PMOA 1LL4A 4TOQA 2HISA 5D8WA 4ZXLA 1CIUA 3B9EA 3BC9A 3W28A 4HP5A 5JBEA 2C8NA 4FF5A 5CGTA 5FL1A 1J18A 2JEPA 2HVMA 4MB5A 1VJSA 1OCQA 1WP6A 2YOCA 3CLWA 4M24A 3BAJA 1JD9A 2WHLA 2Y8VA 5HPOA 4EAMA 3CUHA 3ZOAA 5CG0A 4L4OA 2YBUA 2WCGA 1KR1A 1B90A 5E0CA 1QI5A 1ITCA 4AYSA 2Y5EA 3SUVA 3NUKA 4HU0A 3NIYA 4B3LA 5I24A 1CENA 1JG9A 2DSUA 2DSZA 1UR1A 3ZT5A 1BSIA 1BVNP 1VEPA 2EEXA 3CUFA 3OZOA 4QCFA 1QHOA 3VD9A 2IXUA 2Q1FA 4HMCA 1JFXA 3VDAA 2YJQA 2C0HA 1L0PA 4M8UA 1V3LA 2WMFA 2DSVA 4Z2GA 2CBJA 4QDMA 4OBRA 4CN1A 5CPQA 4HPHA 4B9ZA 5LA0A 1HN0A 4AXNA 4Z2LA 3VGDA 1HXJA 3WNPA 1W32A 1XSIA 3ARYA 2VOTA 2MANA 3GXDA 2PB1A 3A3HA 3WL0A 1XH0A 3WNMA 1DEDA 1LLOA 1GOOA 1QNPA 1UWQA 2QMKA 4W85A 5JIWA 2WC4A 1K9FA 1D2KA 3IK2A 2VQTA 1BG9A 2G8ZA 2J7EA 4A3HA 1VJZA 2NW0A 5GNYA 3IJ9A 1KGUA 3VILA 3AXIA 1CBGA 2VTFA 1HNYA 1B9ZA 2XTKA 1TZ7A 3AQUA 1XCWA 1TMQA 1SYTA 3EYPA 1OSEA 2XYLA 2WBGA 3TTOA 5LA1A 4MDOA 2XWDA 1TG7A 1VIWA 3VIOA 4D6DA 1US3A 4KGLA 1J0IA 2WKGA 2J7DA 4ZEPA 4AD5A 2GFTA 5FOOA 2NSXA 5A6MA 4ZENA 1I1WA 2O92A 4LYPA 1B31A 2UY4A 3WQ8A 2CCRA 3ZIZA 2GUYA 1OBAA 5A2CA 1TCMA 5ABFA 2VZOA 2VURA 1CXFA 1W1VA 4UQEA 4TVCA 1MW3A 3AYRA 2XSAA 3RPMA 4AEFA 2XIIA 2ZX8A 2GSJA 3OGSA 4F79A 1ZBCA 1HM3A 1H3GA 3AMLA 2J7FA 1W1TA 2J75A 3QHOA 4AIOA 5C8BB 3ZQ9A 1CB8A 1JI1A 2D0HA 3T2QA 2WCAA 2WMJA 2A3BA 3VIGA 1D7FA 4GIAA 3AZTA 1QNQA 3WN6A 4CD8A 5HBFA 2Q8XA 2X8RA 3POHA 2RGMA 3AIEA 3VDCA 3GH5A 4BF7A 1VFUA 1KCLA 1EO5A 3ZJKA 5D4YA 1DP0A 1B1YA 1B0IA 3BCDA 1CPUA 4FMVA 3IJ7A 3RMEA 3M46A 1WCGA 4H04A 2JIWA 3MSGA 5GPRA 4M82A 1W3HA 4MAZA 2Y4SA 1MQPA 4UOQA 5IHRA 2CKRA 1C91A 2B31A 2DIJA 2ZX6A 4YHEA 1JAKA 1RW9A 3L4ZA 3QGVA 2EXOA 9CGTA 1XV8A 1PBGA 3BLKA 1UKSA 2RGLA 4L4PA 2WMKA 4MNLA 2FHCA 5AY7A 4UCFA 5A2BA 2ZX9A 4CD4A 3OZPA 5FIPA 1GZJA 4WKFA 3SUSA 3OGVA 1LG2A 2XM2A 2DH2A 3WFZA 4U2YA 1E9LA 5A8PA 1NWSA 2ZXDA 5ECUA 1WDRA 1VEOA 3AHVA 3EDDA 3QHMA 3G6LA 4J3SA 4Q7NA 4ZFMA 3ZMRA 3TA9A 3MKKA 5HOSA 2WVVB 1CXKA 2DT1A 3AZRA 4CGTA 5M3WA 1UYQA 4AD1A 2XGBA 5LA2A 5A8OA 1XGZA 4J3XA 3UG5A 3BAXA 1E6NA 1CZ1A 3VIIA 1IV8A 1AQ0A 4W7UA 3VIHA 4HA4A 2F8QA 5FKYA 2E24A 3LPPA 1I75A 4KRUA 3L2MA 5EMYA 4NI3A 3RO8A 2WZHA 3ECQA 3FNDA 4DUXA 1HJXA 1E5JA 1CXIA 1JF6A 3KEHA 4AISA 4HMEA 4GO9A 4U3AA 2XVKA 5CPTA 3M6DA 3WQ6A 1OGGA 4TUFA 4AD0A 1UA3A 3II1A 3VGEA 1UH2A 3OLEA 1FP9A 3OLIA 3CUIA 1GVIA 3L4TA 3UG4A 2E3ZA 1OJNA 4BQ2A 2YLLA 3UESA 1J11A 1UKPA 1AMYA 1FH9A 4JL2A 5BCAA 1UH4A 3T0BA 3VIFA 1NOFA 4HPGA 4CU8A 4AD3A 3DYMA 4EK7A 1JZ8A 4ATWA 4HA1A 3G6MA 2PBGA 3VMPA 1FH7A 2W62A 4F9DA 4F8XA 3MV01 3WBAA 2J62A 2FGLA 2CERA 2G3NA 1GNXA 2FHBA 1UKTA 4KMQA 4QFUA 3AIBA 4ZXOA 2G3JA 4JL1A 3ZSTA 4M29A 1GONA 1R87A 3VM5A 3WD0A 3CZLA 3N1AA 4JHOA 1ODUA 3LMYA 2PWFA 1KBBA 3N13A 4JFWA 4ZE5A 1BLIA 1H4PA 3MUZ1 1R8LA 3A4XA 4U5IA 4CN6A 3ZJ7A 1C7SA 2DSWA 5E6ZA 1NWRA 5DMYA 4AZGA 2IUZA 2EPKX 1HMUA 3MMDA 1V6WA 3SCNA 4P7OA 1GVYA 5A8QA 1J0ZA 5CGMA 2Z1SA 3WDIA 3MSDA 4NRRA 2E8YA 3W24A 1PIFA 5I5RA 1GQJA 3F4VA 3ARVA 3MUY1 1X1IA 2G3IA 1PAMA 2PWHA 3ZM8A 4AC1X 4MNKA 1J0NA 1EXPA 1N7RA 1W9XA 3AHYA 1EDTA 5IFTA 5A8NA 3BXWA 1TUXA 5M17A 1JXKA 1CGYA 5EBAA 1V08A 4UFKA 1JD7A 1RD6A 5KZ6A 1U2YA 1CDGA 1I1XA 2CBVA 1H5VA 1QOXA 4FLSA 4QLLA 2DSKA 2ZXQA 1EOMA 2CIPA 2ZOXA 4AZ7A 1HJUA 3KZSA 3WENA 1NOUA 2ZUTA 1GOWA 3N17A 2YA1A 4JIEA 1V03A 1IT0A 1XRVA 2VCAA 1OD0A 4PMUA 2WNWA 2CKSA 1CLVA 4J3UA 1V02A 3LPGA 5A6AA 1V3MA 5CLTA 3DHPA 2DT2A 2F2HA 4KGJA 1E0VA 3JUGA 4UZUA 1QW9A 2YL9A 1W9PA 1VAHA 4WK9A 2DH3A 2YDRA 3GH4A 5BRQA 5I0DA 3AHZA 2BV9A 1C8YA 4YHGA 4H2CA 1OJPA 4UR9A 2EO7A 3F5KA 3WF4A 2J78A 3WF1A 4LPCA 1TA3A 2XVNA 1BVZA 1UG6A 1OT2A 4P8UA 4HOXA 3WIJA 4PN2A 3SCUA 1JDDA 2VRKA 2PBOA 3PZMA 1JYVA 1H41A 1R86A 3WQ4A 3ARZA 2VVNA 5IXEA 3RM4A 1CLXA 2YIHA 2WZEA 2D3NA 1UWSA 5D9MA 4QCEA 2XIBA 5HXMA 3AIVA 1J01A 4AD2A 2J47A 1ISXA 4BZYA 1HVQA 2DT3A 3KL0A 4MB1A 1WDPA 6TAAA 1KWGA 1XHGA 2CHNA 2EQDA 2ZIDA 1US2A 1GQKA 3WDRA 2G41A 3GDBA 1MQRA 3L4YA 1VRXA 1H0GA 3W53A 2XUCA 4AEEA 1KR0A 1V0KA 2YA2A 3WMCA 1FA2A 1LF1A 1DWIM 1G01A 3F5LA 1LG1A 3L4UA 2WHMA 1CXLA 3GBDA 5E0FA 1HM2A 4JAWA 3GH7A 1XH1A 4UQAA 1B3ZA 2CETA 4PEEA 4D6GA 2DQXA 1R7OA 1MQQA 3CIVA 1UHVA 1E6ZA 1R85A 1QVBA 2QMJA 3W4RA 4OIFA 4UOZA 2J8GA 5ABHA 7CGTA 2OSXA 4BCEA 3N11A 1M04A 2XFFA 5C70A 1QHPA 4H7VA 4AIEA 4GI9A 4U33A 3PTMA 3AIRA 1JL8A 1LL6A 1KGWA 1HP5A 4MJ4A 4OOUA 1E4NA 1CGWA 3DYOA 4GQRA 4IPLA 4OUEA 2CBIA 2XG9A 1X6NA 1XYZA 5CPSA 4DM1A 1VF8A 3AIWA 1QNSA 1WZKA 3K1DA 2X0HA 3VKKA 1S46A 3BCFA 3WH7A 2DEPA 4OKDA 4CU7A 2WVUA 3NSNA 1JNEA 4W8BA 3VO0A 4CVUA 1ISVA 4IPNB 4PTXA 2BY1A 2WHJA 2X0YA 3ALGA 3CZEA 3GYCA 3KL3A 2XWEA 2X1IA 3EBVA 3VUPA 4P7LA 3L4WA 2VX7A 4AZ5A 4M81A 5I77A 3CHFA 3WD4A 2VT0A 4PCSA 4IM4A 1X1JA 4EE9A 2Y8KA 1V6XA 2YDQA 1V3HA 4MDPA 4W8AA 2CNCA 4U31A 1V0NA 1N7OA 2OSWA 3VOCA 1E72M 5IFPA 1B30A 3BAIA 2CPUA 1CGTA 2WSKA 2WVSA 1H2JA 1K9TA 3MS8A 3M7SA 4K68A 1JZ3A 3VGFA 1EA9C 3AS0A 3SCTA 5CSUA 2UWFA 5I6SA 1V02E 3WDQA 5I78A 4LYQA 1HL9A 2EPNA 2EJ1A 4PMZA 2O9PA 4D6EA 4MNMA 2ESCA 2VCCA 2DGAA 3TTYA 2WYSA 4H8UA 2XVGA 4UFHA 1LWHA 1KFWA 1HJSA 2D22A 5JBFA 3EDFA 3PZNA 3UEQA 3W26A 4WJXA 3CPUA 3FAWA 3BAWA 3EDKA 1M7XA 2V3GA 2ZUUA 2GDVA 1V6YA 2BHZA 1V6VA 3KL5A 3I3DA 2W63A 1V6UA 1A3HA 4A3YA 5BXSA 2J8FA 3A4AA 4JHZA 3SCRA 3CUJA 3BH4A 3VGGA 2BY2A 2DDXA 1J0KA 1PZ3A 4WIWA 1CNVA 2G3MA 3RCNA 2ZWYA 4W86A 1MFVA 2DIEA 2XFRA 2PF0A 3VMNA 1UD2A 4JFVA 3VX1A 1MW2A 1LXKA 3OGRA 4GZJA 1BYCA 1ZBVA 1B2YA 3VX0A 4B16A 4B3KA 2O9TA 1JZ6A 2VJXA 1PX4A 2V5CA 4CU6A 2J7GA 3HJEA 2W92A 1JYXA 3VNZA 3W27A 3AIUA 4BQ4A 4F9JA 3WY1A 5HNNA 1G5AA 2GJPA 1WZMA 4DWSC 4J28A 4KWUA 4GKLA 3PN8A 3BAKA 4HZ8A 3PZQA 1RPKA 1FHLA 4Z2IA 3WNKA 3SUWA 1KXTA 3A4WA 4X0NA 1RWCA 1W9UA 3WQWA 1UD4A 2FHFA 4PTVA 1RWGA 5A95A 3NJ3A 1E0WA 5FL0A 1E3ZA 1J10A 4AZBA 4V2XA 4HZ6A 2D24A 4UQBA 1G94A 1GOQA 3MUIA 1X1HA 5E70A 2Y2WA 2JEQA 3T0DA 2ZUMA 2X2YA 1GQLA 1ISWA 5D9PA 2BVDA 3EDEA 3PHAA 1AQHA 2WB5A 3RM8A 1DWJM 1CGUA 1NARA 3AIQA 2XJ7A 3F5JA 4GPNA 2X05A 1YHTA 3DYPA 4CCCA 3THDA 2VO5A 1KCKA 1JZ5A 2EPOA 1C93A 3TOPA 5BRPA 4GI6A 4D6HA 3S2CA 3SEPA 3SURA 2VCBA 3W29A 2BRVX 2WMHA 1VB9A 1EQCA 4DWSD 1UD3A 4IISA 4ACYA 1O7AA 1UQZA 4YPJA 1NH6A 1X1NA 2WC7A 3ZJ6A 1Q4NX 1TFVA 2VX4A 1GHRA 7A3HA 4E4PA 1W91A 1GCYA 3D3AA 1G1YA 3AISA 4C7FA 2BXYA 4P8VA 3WF3A 1BG4A 5D9NA 1JNDA 1QW8A 3WUGA 5DFAA 2BVYA 4D6CA 2BHYA 2VRQA 4AWEA 3UR7A 4CUCA 2D23A 1EH9A 3L4VA 5DO8A 1JZ7A 3SIMA 2ZX7A 2E4TA 4LYRA 3UR8A 4LQ1A 1BQCA 4URIA 5AYIA 3BAYA 4WKAA 3GNRA 3EMZA 1BGGA 1VBUA 3OB8A 4CD5A 1ZBWA 1WNOA 1BHGA 4N42A 3N04A 1EIBA 3AICA 3RIKA 3VMOA 1W9DM 2YL6A 1R7AA 4M1RA 3WNOA 3U57A 5A6LA 1E3XA 3U7BA 1E40A 3VD5A 3IJ8A 3VTRA 2VL4A 3CUGA 2WWDA 4CCDA 3AOFA 1KXQA 3VIKA 1BAGA 1RWAA 1C92A 1UWRA 1CGXA 2AAAA 2FH6A 4W88A 1B3YA 2VVSA 5I23A 2VZUA 1W2VA 1PIGA 4UNIA 1GOMA 2OWWA 4D72A 4B9YA 1ZBKA 1C90A 4HA3A 2X03A 4PUDA 1W1PA 1H11A 3VINA 3AYSA 4FLQA 1CWYA 4GXPA 3TP4A 4R27A 1KXVA 1ODZA 2C7FA 5BROA 3VM7A 3T2OA 4UZSA 2QV4A 4PMQA 4H8VA 4JCLA 1E55A 4WSKA 2ZXBA 1GW1A 4PMNA 1UZ4A 3WMBA 1BYBA 3B9DA 3WUBA 2J79A 1ZS2A 2UY3A 3CGTA 3PTQA 3EDJA 1G9HA 5GNXA 2VC9A 3GNOA 1JFHA 3W37A 1EOKA 2GJXA 1CECA 2ZXAA 1VEMA 4GZEA 1GJWA 3SCSA 1OB0A 3E1F1 3O6AA 3U5YA 5FCZA 3DC0A 1YQ2A 3WH6A 1JIBA 2WDAA 3T09A 1QI0A 2FDMA 1PEZA 1UA7A 3PZOA 1FHDA 1ISZA 1NM9A 2ZE0A 4V28A 3MO4A 3FW6A 1QI3A 1UD5A
chains in the Genus database with same CATH superfamily
1PTGA 4PL2A 5IHSA 1EZ2A 1LDCA 3D3FA 1KM0A 4AW7A 3GM8A 5FJUA 4Y9AA 2CBUA 1GEHA 4ASTA 4TV5A 3UJFA 4GQQA 3LHTA 1CTNA 3VDGA 2R91A 2V3EA 1E1CA 1G67A 1F76A 1N7KA 2XZ7A 1UD8A 3THCA 1Z9AA 3P2VA 1R9YA 4E0CA 4AVOA 4IGSA 5FD0A 2O9OA 2GPTA 4XV0A 1FXQA 3N15A 2VP8A 4DI9A 1XDLA 1RWFA 4UTHA 4J40A 4NG3A 3M5ZA 1DPMA 3PPHA 3CU2A 4CN4A 3HJZA 2VI0A 1V0MA 5M5DA 1F6KA 3G1RA 3VCNA 3GAYA 3GNPA 2DW7A 1XC6A 4RL3A 3UF9A 5G4HC 4MJZA 2Y5SA 1GJUA 3AI0A 2PDMA 2YEPB 3BO9A 2CZDA 3WUEA 3CM4A 4R33A 3BJSA 5KEZA 2X7WA 3KBMA 1YNPA 2Q8ZA 4F0SA 3WDJA 1NOWA 1XLJA 2A3AA 3AHXA 2E68A 4HMNA 1ITXA 4KWVA 3AYVA 3W86A 2QULA 4QS5A 2ZUNA 4QE1A 3SGGA 1TQJA 1JUBA 3MMTA 1F8IA 1VCVA 3JZUA 3K2GA 1TMLA 1Z32X 5AHEA 3W85A 4FAMA 3B8SA 1ONRA 4K38A 1UH3A 1FDZA 3ARUA 4DUVA 3JU2A 1VPYA 3VD7A 1LWJA 1NQ6A 1K9DA 1A47A 3T7VA 3FA4A 2J27A 1Q8JA 3SCPA 4AY1A 3VKAA 3BANA 2C15A 4QE4A 1IGSA 2H6RA 1C3FA 3P62A 2QJGA 4W5UA 5A3HA 4GJJA 1J0YA 3BZJA 4DF1A 4KESA 2E1DA 3PAOA 3G0UA 3MSYA 2C0AA 3P84A 4AEOA 1E4MM 5SWUA 4HK7A 3PFRA 2VFDA 5LYRA 1EF3A 1I8QA 2GVLA 3G8EA 4ZB5A 1WZAA 1VFTA 4RPPA 4ZQRA 3MUCA 4C91A 1XJBA 4FNQA 1YYAA 3W0KA 5AC7A 5F7UA 1SO3A 2FB3A 3TYEA 3CHEA 1S5VA 4EANA 1FWCC 3TYBA 3S3GA 4AWTA 2WJFA 4WLCA 1B9BA 4UQ9A 1BWVA 3S5YA 4EKJA 3M5VA 1AD4A 2OLSA 1UR8A 3WF2A 3NWRA 3VD3A 3T4WA 1KQZA 2GJXB 3QYSA 5CBIA 1RH9A 3V3WA 1XWYA 3USBA 4QLKA 3W83A 3DHDA 3RCMA 4HZ7A 1N8FA 4E2DA 1IZCA 4IIFA 1EEXA 1FCBA 2IQDA 1OC6A 3O16A 4RX0A 4YYCA 3H23A 2C79A 3PZVA 1JPHA 1XIGA 4Q4OA 3L21A 3VIJA 3LHWA 5AZ0A 4XBSA 4B4FA 2QCCA 1KTCA 1Q2SA 2EJAA 3MQTA 4LS2A 2E6DA 4S2BA 2V5BA 4UTWC 1ZAHA 1RBAA 2B81A 5HK4A 2PDLA 3FAXA 3A4JA 5U7SA 5E5CA 1DWFM 1B4KA 3FHQA 4NAEB 3NSXA 2OGJA 4NZ1A 4G56A 2CESA 1O6IA 2VNCA 4WRHA 3C0QA 2Y24A 1FCUA 2QJJA 4WDTA 5A2AA 4HTBA 2I5GA 4HMDA 4NZCA 5CPLA 1GHSA 3VNDA 4NVTA 2OQHA 1SFLA 2NUYA 1DJNA 3WEMA 1XUUA 1MFUA 4WJEA 5AC5A 4ONVA 1E6QM 5DMNA 3NQEA 1XSJA 2BOEX 5HANA 2W66A 2NQJA 2QJMA 2VHLA 3HFTA 2VMFA 1EFZA 2BGSA 1FHUA 1KWKA 4OVXA 1W0MA 3TONA 3ATYA 2HJPA 1F74A 3L7RA 3NR0A 4C1NA 1UUQA 4PUMA 2V38A 2VENA 1VP5A 2WLZA 2Z00A 3QFWA 2CITA 2VC5A 2YFOA 1JUEA 1JDAA 4GI8A 3FHAA 1R6WA 4H6QA 1IXNA 2D0FA 3WLLA 3W6LA 1GG1A 3CEUA 2CHOA 3D5HA 4PMVA 4Q8MA 3L4XA 2PI6A 1QRQA 4GQBA 2ZZ6A 4AY7A 1W31A 5LIYX 1DWHM 4NKCA 4PZVA 2JF7A 2AL2A 5FF3A 3A6OA 8XIAA 1UJQA 4LX4A 4PBEA 1F2JA 2INEA 3UWVA 3VNYA 2BDQA 4E8CA 3DECA 4J3VA 1JGIA 3RK8A 1OIFA 3KM8A 3U4FA 2X1SA 1UOKA 4BQ5A 1NFPA 2V9DA 1JQXA 3HN3A 5EMUA 3I6EA 4IHCA 3U5UA 3RLUA 5LGXA 4DXVA 1RP8A 3HBLA 3NZPA 4W7VA 2OWXA 4KFPA 3GVRA 4KFOA 1IQ8A 4A4AA 4RV8A 1VZWA 4K37A 1XR2A 3U2ZA 1PPIA 4IUGA 4FLOA 1AVAA 2QW5A 3HG2A 3GB6A 1PX3A 1ISYA 1TV3A 3W7PA 2MNRA 1FWSA 1XQKA 1UQYA 1WE5A 1UR2A 4IJRA 4GZIA 1OFDA 1GYNA 3AMGA 3CWHA 1A4MA 2PURA 1A4LA 1XBYA 3O2LA 4QEHA 3CHCA 4LFYA 3PANA 5AVHA 2KXSA 5REQB 3SQLA 1IZKA 1BRLB 1LLWA 2F61A 4D1JA 1OJXA 2JE8A 3WH5A 1ZRQA 1OJMA 1W3NA 3BMVA 4DJFA 4PUKA 2CU0A 4P7NA 1MI3A 3LA4A 3ZLGA 2FMNA 3F1QA 5LNWA 2FVMA 4AY8A 4K7VA 1TB3A 2IQ0A 1DYSA 2BVTA 5KZDA 2B0MA 5D32A 3EMQA 3FA3A 4Y96A 1BKSA 5XIMA 2PWVA 1W3YA 4HOZA 1OCJA 1JYWA 4OJYA 4JN7A 1F4AA 3WQVA 1ITUA 4A21A 3QYQA 4WY0B 3G3DA 2OEKA 4DUWA 1F1SA 4P8WA 4UIOA 1SZFA 3TQVA 2DU2A 4FXFA 2DZUA 3ARPA 4HHMA 3WMSA 4IQJA 2E22A 3VD4A 1CCWB 3C2FA 2E5DA 1YNQA 2Z24A 2QF8A 1SO6A 1ZTVA 4HKPA 2BS9A 4QIUA 1SW7A 1KM5A 2PMQA 4JTKA 2CEQA 2PWGA 2WZIA 2A1YA 4JFTA 1EJ7L 1GJPA 4LRTA 3RM9A 4NAFB 4IQLA 3W38A 1TWZA 4PMJA 4AVNA 1ENUA 1FWIC 3H7UA 1OD8A 3L12A 2DJXA 4L80A 3L9CA 1YIXA 5F2GA 5E09A 3S8HA 1PTDA 3ZS4A 4DI8A 1UOZA 2RH9A 2D3LA 4EWND 3S2NA 3DG7A 1W9BM 2YDSA 3BW2A 3QR3A 5M1TA 1XP3A 1BF2A 1V5XA 4L9YA 1GORA 3BMWA 5ABFB 1OX6A 1JDEA 3VIPA 4JTJA 3T42A 2QDDA 2C18A 3KX6A 3A13A 5FJTA 2WOQA 4FA3A 4GFIA 3CAVA 2PRMA 3W1QA 5I7GA 3IAQA 1K03A 4S23A 4GBDA 4AG0A 4X9YA 4F48A 3F2DA 4R53A 1VRDA 4NIRA 4RE4A 1YEYA 3DHUA 3PBGA 2E28A 3WLSA 5HMDA 4ENLA 4WSHA 1RAKA 3TN4A 2NT0A 4LEQA 4WR3A 1EL3A 4UTTC 1SR9A 4MTVA 2NLIA 4FX6M 4JZ5A 1MO0A 3VUSA 4U5KA 3EXRA 2RAGA 5AHLA 2E9MA 3KBVA 1LROA 4CD6A 2WVTA 2D1ZA 3MHUA 2JFEX 3FXGA 1M7OA 2GZXA 2GJRA 4JQ3A 1ALDA 1ZENA 3UXAA 1NDWA 3EKLA 1XF0A 1OGSA 3KLKA 4HZMA 1JZ2A 4AMCA 3NYZA 2QUUA 4CCZA 3IAPA 3WX7A 4TVDA 4DY1A 4V1XA 2XIMA 3FCPA 3W7MA 4US6A 2ZUWA 2Z1VA 4RDWA 2Q09A 5HNTA 1UKOA 4WSJA 3PZGA 3I6TA 4LS0A 3EX4A 3DG3A 2XVPA 1FWWA 1MXDA 3G3MA 1OFAA 1V4YA 2XSBA 2XVLA 1L8NA 1OY0A 4MB4A 3MWAA 3WLTA 5ABGA 5BWAA 4J3WA 2VELA 3IRDA 4QBXA 1DXFA 3AALA 4DJDD 1FFQA 3USZA 2WK2A 4C90A 8CGTA 1BEUA 1T99A 1K6AA 2OFJA 5M03A 1MXGA 2ABAA 1UD6A 1DIKA 3CYVA 4TX8A 1XH2A 3P74A 4S3GA 1KFLA 3QC3A 3S5SA 4DWSB 4C6PA 3NPVA 1IEVA 3AXHA 1K9EA 4JDYA 1M1BA 1QBAA 3LN3A 1W1A1 4OBTA 2ISVA 4NASA 3N2BA 3TN5A 3UETA 1ZU8A 1HKVA 4PBGA 2QGHA 1MUWA 5A94A 1P43A 3UZZA 4LANA 5HWMA 3LENA 4JQAA 1Q6CA 5TD4A 2QJHA 3OLDA 3VNJA 4UTFA 1V3JA 4PMOA 2PDUA 1KM2A 1LL4A 3EWDA 3P82A 4NY2A 5J5RA 3I68A 3W28A 4HP5A 1J18A 3V0TA 4ALDA 2BG5A 1NU5A 1OCQA 3A9BA 2YOCA 3S9ZA 5G4EA 1K70A 3S46A 2NXGA 3T78A 2X40A 4EAMA 3DZ1A 3ZOAA 2XN1A 3NQVA 3OBEA 4LOCA 3A21A 1B90A 5TBOA 5E0CA 1ITCA 2YXOA 1OX4B 2Z27A 3NIYA 4XKYB 2DSUA 3S9IA 4G8TA 3GFYA 1UR1A 1BSIA 1BVNP 3RHGA 5AN7A 1QHOA 4HNVA 4YL2A 4RNHA 3PBVA 4PCNA 4FNTA 3KBSA 2YJQA 2IS7A 2L5HA 1I0DA 2QXWA 3WLHA 1FWDC 5CPNA 1O5XA 2RHGA 3LI1A 3KP0A 1UC4A 4CN1A 4B9ZA 1H5YA 1YDOA 2E67A 4Z2LA 3VGDA 4TV6A 5C54A 3PBYA 4ZBCA 1XSIA 3BCJA 2VOTA 2MANA 3GXDA 2PB1A 4HCDA 3WL0A 1QNPA 4ERIA 3N2XA 3P81A 3SM0A 4MUZA 2R1KA 1K9FA 3UPMA 3B04A 2G8ZA 1BWKA 4JIQA 4O0QA 4UMAA 3BTNA 2GLKA 1M5WA 5GNYA 1GG0A 3LM3A 2A7NA 3QVQA 1TPDA 3AXIA 1CBGA 4ZQNA 4WXZA 1HNYA 2PCQA 3AQUA 5DXYA 1R3VA 1TMQA 1I2PA 1SYTA 1XLDA 3EYPA 3QY8A 4MWAB 5LA1A 3N2CA 3TN6A 2HE8A 5F4XA 1TG7A 1H1ZA 3S1UA 3VIOA 2ZC8A 5HWJA 4MIMA 1XLGA 4DO7A 1KV8A 3E49A 1J0IA 3LG3A 1SQ7A 3B0VC 1R3WA 1T0OA 2NSXA 3TZFA 3NO5A 4ZENA 3GDTA 2O92A 4LYPA 4ZFCA 3LXAA 3QZ6A 1AH3A 1UBPC 2UY4A 4XD3A 2CCRA 2P0OA 3ZIZA 1TCMA 5FEPA 2QUMA 3MI2A 4DBWA 5GVJA 5DQPA 2DORA 1TRIA 4IP5A 4UQEA 1MW3A 3DBPA 4S3FA 1TWIA 2G4JA 4CLMA 1UMLA 5MHBA 2F6XA 2J7FA 1W1TA 3QHOA 4AIOA 2J24A 4WZHA 4Z17A 1D7FA 4N6FA 2PDPA 1N2VA 3ITXA 1DL3A 4L6DA 1GWJA 1HG3A 2QCFA 4P2VA 4BF7A 1B54A 3IUDA 4XZMX 1XS2A 3SFKA 1Q85A 4Z0SA 5BOOA 2V5KA 5D4YA 5G5IA 3BCDA 3IJ7A 2OOGA 4LUIA 5KITA 4WQ6A 4UOQA 2Y4SA 5GJNA 5D09A 2I16A 1RQHA 5IHRA 1Q65A 2PS2A 1JAKA 2AKMA 4O12A 3L4ZA 1XV8A 3FEQA 3VK5A 1UKSA 5AY7A 4Y8FA 1GZJA 5KZMA 1Q6OA 1FHVA 4PE8A 2QEZA 2Z26A 1QO2A 3D47A 4GD0A 4OU1A 2XM2A 3L5MA 4LUTB 3N4AA 2J9ZA 4U2YA 1E9LA 4Z1DA 5F2LA 3W70A 1VEOA 3G6LA 4J3SA 5A8GA 4MZ1A 3ZMRA 5G1YA 4CGTA 5M3WA 4DRSA 1DE6A 5LA2A 4J2PA 4K7YA 3ZYZA 3LUTA 3UG5A 1QK2A 1REQA 3TZNA 1IV8A 4W7UA 2AGTA 3VIHA 3TWBA 4JY8A 5C2CA 1SM9A 4IUOA 1I75A 1HO1A 3L2MA 3IIXA 4K8GA 4NI3A 2I1OA 3RO8A 3O06A 3ECQA 3FNDA 3OZMA 4E3VA 2E5BA 3QTGA 1CXIA 3KEHA 4GO9A 4U3AA 2DUAA 1FDJA 2PGRA 2O0TA 4TUFA 2G3FA 4GNKB 3CUIA 2PZNA 1GVIA 2NX3A 3QZAA 4GY1A 3UXKA 4A35A 2PGEA 1J11A 1UKPA 1AMYA 4JL2A 2OO0A 3GVWA 4CU8A 4Y9MA 3DFHA 4ATWA 2PBGA 1RCQA 1KBJA 5CPMA 1P1XA 4F9DA 4F8XA 1F73A 1SFJA 5C6MA 2QJIA 3KCJA 3WBAA 4QTGA 1VPQA 3T6CA 3SQSA 2FGLA 2G3NA 5G1TA 2G3JA 3KBNA 4JL1A 4ORMA 3W1XA 2WJDA 1GONA 1R87A 4ROPA 2V67A 4A8NA 1X8FA 3WD0A 4OFCA 4JEQA 4LAOA 1ODUA 4LU0A 3N13A 3ZWSA 3TROA 1BLIA 4HPNA 1H4PA 1R8LA 1XKYA 4CN6A 3QQ0A 1O60A 1JUKA 5A8QA 4HCLA 1LM1A 3WDIA 3PSWA 3SDOA 1YTEA 3B0YA 3GXTA 1WKFA 2Y7EA 3EX1A 1VBJA 3MUY1 5EGRA 3UZXA 1R3QA 4AC1X 2NQLA 4L64A 3KTCA 1N7RA 3CV7A 2CLIA 3AHYA 4O8AA 1YPFA 3P8IA 3LSCA 4TO8A 3M64A 1DKWA 2OVLA 3PB0A 5KZ6A 1U2YA 1VS1A 3GC5A 1VFLA 2DZAA 1XKJA 3RN6A 2ZXQA 4FB7A 4K8EA 4DZIA 3BVJA 1NOUA 1GOWA 1QPNA 2YA1A 3N17A 4GE8A 3TW9A 1KFEA 2XN0A 1IGWA 2E1WA 3LXBA 3NQBA 1XG3A 3GC4A 2HV5A 2H8ZA 1V02A 3LPGA 3LSBA 1V3MA 1BTMA 3TXVA 5C2GA 2BGQA 3JUGA 4H8NA 1OABA 1VAHA 4WK9A 1EJTC 1KFCA 1XLAA 4B91A 2YDRA 5I0DA 4LCQA 4IXHA 1IEXA 2I7GA 2A7RA 4YHGA 3ZWTA 2IKJA 2HNHA 4E4FA 2XVNA 5T26A 1UG6A 3G1XA 3DHFA 3VNLA 2GQ9A 1OT2A 4P8UA 5KZEA 2DZBA 4JD4A 1ZJHA 3KBUC 2VRKA 1ZUAX 3IGXA 1JYVA 4H7ZA 1P0KA 3RG6A 4F0KA 3RM4A 2OZ0A 2R14A 3H55A 3QLLA 4IX0A 2WZEA 3W22A 3GTIA 2PA6A 3LXCA 2CLMA 2P5NA 4DX3A 1HW6A 1UWSA 3BW3A 3MP5A 4QCEA 5D9MA 2XIBA 4AD2A 1J01A 2Q71A 4BZYA 1HVQA 2VC7A 2D69A 3NO1A 3SSJA 4ILSA 2GVEA 1YE4A 3N2TA 4JOMA 3LNMA 5G2HA 3TC3A 1EC8A 2XUCA 1C9WA 2YA2A 3U48A 1LF1A 1TTPA 2CLPA 3NPUA 2CLEA 4GI4A 3HV8A 1P0EA 4FXSA 2OODA 2WHMA 1HM2A 3GH7A 3SZ8A 5K9CA 3W00A 2AAMA 1TE6A 3W1AA 4ZSTA 1G7UA 4KF1A 2V8ZA 1E6ZA 1R85A 3DC8A 2QMJA 4UOZA 3GG7A 2J8GA 5ABHA 7CGTA 4LTSA 4BCEA 4ZB0A 1G7VA 4JNZA 2ZYFA 2VKZG 4U33A 3DESA 1U83A 4AC7C 4N4QA 3VZZA 4US5A 3KRUA 1KKOA 2XG9A 3AIWA 1WZKA 1OC5A 3PY2A 3T40A 4QQ3A 1TCDA 3QPZA 3CWOX 3B05A 3TVAA 4CU7A 1Q63A 4CVUA 3ANVA 3WQEA 1ISVA 3KHDA 1DJYA 2VD8A 2A4AA 3ALGA 4JDBA 3GYCA 4QSHA 5HJLA 3LZ5A 3E0IA 3L4WA 2VX7A 1OG6A 4AZ5A 3CC1A 3EPOA 5I77A 2VT0A 4PCSA 4O1FA 1T7LA 2Y8KA 4Z42C 1YNYA 2OSWA 1Q5MA 2VEMA 4XSLA 4NAFA 3NURA 3MCMA 2GUBA 1K9TA 3W2UA 1UPPA 3M7SA 3VGFA 5CSUA 1W5MA 3UCCA 1V02E 4O28A 4QX4A 2O9PA 4D6EA 3R8GA 2WYSA 4F2UA 4HT3A 2YZ5A 2D22A 4E38A 3UEQA 5G2WA 2I17A 4WJXA 2ZA1A 4M6VA 2QDHA 2ACSA 3BAWA 3O15A 1M7XA 3E74A 4QXIA 3BE7A 3I65A 3FYYA 1V6VA 4KRZA 4ORIA 4IJCA 3KL5A 3I3DA 4H01A 1A3HA 5D05A 4A3YA 4JHZA 2OX1A 3BH4A 3VGGA 4ZB2A 1J0KA 1PZ3A 4RDYA 2R1MA 3OHIA 3RCNA 4FXRA 5CBBA 1RLCL 3S6OA 1YBQA 4W86A 3GY1A 2RDWA 1MW2A 5L9FA 1LXKA 4GZJA 3S1VA 4B3KA 3MBDA 1AW2A 1TIMA 4XIAA 4R88A 5DN1A 1PX4A 4LAKA 4LJ3A 3DGBA 1FWGC 2W92A 2V0TA 5DX7A 3EOLA 1Q7ZA 5HNNA 4KWUA 3BAKA 1IXOA 3BOFA 4LVGA 1WAUA 1V7YA 4XWUA 1FBAA 2J13A 4WHBA 1RPKA 3LD5A 3WNKA 1QFEA 5BMWA 2RJHA 3P0WA 4NAEA 3VOJA 4X0NA 4IGMA 4GUHA 4MOZA 4PTVA 2FB2A 4RW3A 1MNSA 3RR1A 3OP2A 2V5LA 3BOLA 4EXQA 1G94A 1F5ZA 3OVRA 1IXPA 3IUHA 2Y2WA 4N02A 4I8YA 1ISWA 1GQLA 4QG6A 3P5YA 2PDKA 1TUFA 2WB5A 3KCLA 1WDDA 3N2OA 4DO6A 4C65A 1R3SA 3W72A 4JR5A 2AGKA 3THDA 1XDJA 2VO5A 1SZGA 2GGEA 4NZJA 1DJXA 3LHUA 5I3IA 5BRPA 7REQA 1WUFA 4G1KA 1LUCA 3W29A 2WMHA 3GXNA 3PJWA 4ZCWA 1ICPA 3C5QA 1VB9A 1EQCA 1UD3A 4IISA 4QGCA 1XIFA 4X22A 4JTQA 2VX4A 5LNVA 1GHRA 7A3HA 1ZSXA 4GUIA 3ME3A 1J6OA 4C7FA 5D9NA 1JNDA 1LZOA 4MFDA 2CWNA 5DFAA 4O13A 3APYA 2BHYA 1XPGA 3UR7A 3MHFA 4TQTA 3G1DA 4WY0A 2EGZA 1W5PA 4LC6A 1DXEA 1OFQA 3FYPA 2ZZ7A 3NL2A 2OT1A 1XQLA 4GVGA 3O6CA 3SO7A 3HM7A 3UR8A 1EEPA 4LQ1A 4URIA 1WV2A 3AC0A 4DWDA 1EIBA 3GQYA 5FJJA 1FWAC 2HVNA 1TELA 3WBWA 1E3XA 4Q7BA 3DENA 4XAPA 5F4SA 3V0UA 2NV9A 2JQXA 1I9CB 1ADSA 3RMJA 3UYIA 2V2DA 3A3WA 3CQ0A 1GEQA 3VIKA 1XYCA 3E5PA 1XC4A 1D9EA 4W88A 1BD0A 3BGJA 5I23A 3CK5A 5A6TC 1W2VA 3GUGA 4KCVA 1EJXC 2PLJA 1L6WA 4REQB 5FJRA 3AWOA 4JTLA 1C90A 4HA3A 2X03A 4PUDA 2VGBA 1W1PA 2P1FA 3R43A 4KIRA 3VINA 3IACA 1KXVA 2C7FA 1GVOA 4UZSA 3UWYA 3DG6A 3OVGA 5BW6A 2H3DA 1XL9A 3CGTA 5E93A 3EDJA 3HB9A 1LORA 3GNOA 2TODA 5XINA 1ZFJA 5DMLA 1VEMA 3TDFA 3VCCA 1XGEA 1HO4A 3EZ4A 1PUDA 4UNKA 1OB0A 2HXTA 3DC0A 1NSJA 1QI0A 2FDMA 3QF0A 4EPDC 3WLQA 3S5OA 2W79A 3TMQA 5AHMA 5XIAA 2PP3A 3K13A 1UD5A 3CMJA 4GCAA 3ENLA 3AUJA 1HMWA 3CBWA 5HULA 1SVDA 3HU7A 3JRKA 1Q6LA 4OZOA 1H49A 4ZZ9A 5EFFA 3E2VA 2QPUA 2R94A 4E2VA 4MJ2A 1IWPA 1LOHA 2DUXA 3FJNA 2CYGA 3VE7A 2YKKA 4JFUA 4HPJA 3W01A 2BBFA 4XZBA 4H8HA 3IGHX 1TIWA 5I3FA 1C82A 4W7WA 3H2NA 3PJUA 4NHVA 3W1PA 3LY0A 2NQHA 1E6XM 2FDSA 3IVTA 4H9VA 3GU9A 4ML4A 3SUUA 4N0RA 2WMIB 2V2HA 1H1YA 2ZKMX 2J7BA 1DBTA 3CO4A 2AOSA 4HOWA 3GFZA 4UFMA 1TWWA 2WZTA 2PC4A 3WQ5A 1FWHC 1EGUA 1EJVC 2OR2A 5HPCA 3L66A 1EHNA 1KBKA 1D3CA 4GC3A 3BK0A 5ABTA 1PHWA 2DY3A 2ZUSA 3HPAA 3SCQA 4DLQA 3E5BA 2VQUA 3OQEA 2WJEA 3W7JA 1XIMA 1WDQA 1XI3A 4RV3A 4GYPC 1EO7A 2PWEA 7TIMA 5K2ZA 1QI4A 4W84A 4ZQCA 3OBAA 4Q22A 1V0LA 2Z1WA 3UJ2A 1EJWC 4NF7A 2HTMA 4AH7A 1OF8A 1G6CA 4GCXA 4FSAA 5LHFA 1M3UA 4W89A 1NF0A 4J9JA 5E6YA 1M53A 3B8VA 3H4WA 2Y8UA 1KCXA 2OGYA 3QSRA 1GOXA 4XKMA 1TVPA 4LF1A 4L65A 4XVDA 2CXGA 4HJFA 2BXZA 2OLHA 1OG0A 4PRRA 4S38A 1IEIA 1JF5A 4GUJA 5CXPA 3ARWA 3B0PA 2OYKA 2AQVA 1EBGA 1LQ0A 4FPSA 3O0FA 4XD6A 3MWCA 3MCOA 1F9GA 4H6RA 3AS1A 1VENA 1G0CA 3GX9A 1S1PA 3W6MA 2FZ9A 3BOXA 3EWUA 1BGAA 1E0XA 3HMCA 5BXPA 3FKRA 3UZ5A 2OCZA 1ZHAA 4FLRA 2BB0A 4AVFA 3MBFA 5BWFA 1G4EA 2QIWA 4BQ3A 4MF4A 3UP8A 4OTKA 2VX6A 3WNNA 2X16A 5JIPA 4HU3A 3MKVA 4CVWA 3KVKA 1OFEA 1V79A 3TQKA 4C6OA 3M1ZA 1DQWA 4JTCA 4CQ8A 2O4MA 4NJIA 2WZMA 1Q7MA 1DTNA 2WMIA 3NGJA 3F4CA 1OT1A 3MA8A 1OYBA 1AJZA 3RR4A 1KBLA 1DV7A 2WC3A 2WVVA 1OZQA 2BX7A 1BF6A 2ZE3A 1F7BA 4PYSA 1BQGA 1GQIA 1IZJA 4RZ6A 4A2SA 3ZJ8A 3CQJA 3K4WA 4UOJA 4PMRA 3IANA 5DXXA 3XIMA 4GY0A 1AUSL 3FK4A 3UR2A 5E0KA 4I5XA 2W5FA 4RE3A 3QJAA 1WKEA 2W6RA 5CZTA 3W25A 3DAQA 5GJMA 3VVGA 3QMRA 4CNTA 2UY2A 5DT7A 4TVUA 1UZ1A 4J27A 3R8HA 3W2JA 3EA3A 1XIEA 1IT7A 2O7QA 4TX9A 1TZZA 4UNLA 2GSEA 3GTHA 2AMGA 3REQA 1HL2A 1W3JA 1Y5XA 3NG3A 4RJEA 2IKHA 5BXTA 2Y7GA 3AS2A 7ODCA 3DKLA 3UJEA 4UTMA 1AL7A 3GU1A 3VGBA 2YCLA 4Z2HA 3AU6A 4ZODA 1FKXA 1MDLA 3FDGA 5K7JA 1PKLA 3CV6A 2Q3RA 1WKYA 4H9MA 1UWUA 4P7QA 2W3ZA 2Q01A 3FV9A 4K3ZA 2D2HA 5DCBA 3LLDA 1O5RA 4D6JA 2A85A 2PTZA 1ADDA 3UVAA 3VFCA 4DF2A 5AHNA 1RXOB 1LJYA 1MW1A 2D0GA 4GYPA 5LIUX 4CCEA 2IQTA 4GUGA 3WK0A 3TTQA 3GDKA 1PJ9A 2Q02A 3TTSA 1QUMA 1EUAA 3M0JA 4Z2JA 4Y7EA 4G7FA 1HKIA 3EMCA 1ZJBA 3WLKX 1P4CA 1KLZA 1R3YA 1QNRA 2GOUA 2ATSA 3PVFA 2HSAA 2NVDA 4AB4A 2J4GA 4KWWA 3KE0A 3PZTA 3WKZA 3BW4A 4Y9OA 1EX1A 4P8XA 1NWTA 2XPKA 4QISA 5C0QA 3GKAA 4CQCA 4FI4A 1I8JA 4GYKA 1DIOA 2OQLA 2VM8A 4GXMA 2YL5A 4LF2A 1BPLB 4ZVJA 3APGA 4IXXA 3BLPX 4LBRA 3LERA 3UWEA 4HA0A 3K8MA 4D6IA 2ZRXA 1LP6A 4ERAA 3ABXA 4AHPA 5ENLA 1ADOA 3TCEA 2KAUC 5I79A 1U1HA 3OZYA 1OM0A 1TV2A 2XFYA 3IV3A 1JCMP 1M6JA 3TR9A 4R7JA 2XISA 2J25A 5I07A 1BTCA 3GBEA 2V4IB 2GQ8A 4PSPA 3S9YA 1RBOB 3NQ8A 4M6UA 1O1HA 3CMFA 6CGTA 4C7GA 3KVLA 4NU7A 1QJWA 2OG9A 5H8MA 1XYBA 2PDQA 3WFAA 3WLRA 2HBVA 4BWLC 3M07A 3MT1A 1E9YB 3MU7A 3LCLA 5IRPA 1J96A 1H7XA 2WJZA 1S2VA 4AZIA 3NCOA 1SZEA 2IXVA 1TR9A 3K4AA 1I2NA 3LV6A 3QGKC 4CKQA 3ID7A 3H6OA 3OG2A 5CQ1A 3SQMA 1OIMA 1RZMA 2W27A 4Z2KA 3SFWA 5HDRA 4C6FA 2FTWA 2PEVA 3TAKA 3CB3A 3ZLFA 2GJLA 1UROA 4AZCA 2QLYA 3NQGA 1FVPA 1M03A 1VYSX 3R7MA 2FTPA 3ZVHA 3B9AA 3AWNA 1E71M 3E02A 2OYLA 3SSZA 2J9XA 3W23A 2BRWA 4YYFA 4YVVA 2A3CA 1C9DA 1TPUA 3MI6A 3W9ZA 3FVDA 1OK4A 3S47A 3UW6A 3VNMA 1OX4A 3S6TA 4LW7A 4IG2A 5C9RA 4J1OA 3R6IA 3WLPA 4LAZA 2PTWA 1XINA 2G4FA 3BLEA 3TC7A 3RDKA 3VDBA 1KKRA 1US0A 4J7RA 1TJPA 4DEFA 4HK6A 4S1FA 3DH7A 4DXXA 1E5NA 1E1FA 4Q7IA 5D02A 1VYPX 2OYMA 2B4GA 1J2WA 1KTNA 4W5ZA 3BJTA 1IR2A 1LRNA 3SR7A 2GSHA 3BICA 1FX6A 4MY8A 1UR4A 1UWIA 5DF0A 4G6CA 2CLKA 5AYBA 5K9DA 3R8RA 4JTIA 3GFXA 1SFSA 4DZAA 4PCTA 1UJPA 3VAVA 2MUCA 3MV11 1V93A 4Z1CA 4IIEA 2H8XA 5D9OA 2Z2AA 3CQIA 4O18A 3K30A 1UP3A 1SW3A 3KDOA 3N6QA 1PVNA 3CZKA 1W17A 3L68A 3CAKA 2QCEA 1AODA 2HPMA 3W02A 3N6JA 3CL6A 3UA3A 1XCXA 3RILA 1MRQA 3KOFA 5J8LA 3AJXA 4GVFA 4RE2A 2CZVA 3WSUA 4US5D 3WDPP 1VH7A 3FXYA 3TW7A 4EXBA 5FF7A 1EGZA 2PDJA 4UQCA 4J35A 3UD1A 3ARQA 3ARXA 4LUYA 3UD2A 4HN4A 1A80A 2ZX5A 1GOIA 2C71A 2D2JA 3C4UA 3S2JA 3WL1A 3ITOA 2J7HA 3P14A 1ECQA 5IM51 7TAAA 3OODA 4WKHA 3W73A 1XLIA 4C60A 3A22A 4S39A 4YWIA 4CEXC 2ZWZA 3RU6A 1OC7A 4D9PA 4EPEC 1E6PA 1DHPA 4XBJA 2XIJA 3K4DA 1UR3M 1WO2A 4X0VA 1Z7AA 1CW2A 1ME7A 4HNNA 5J04A 4B5TA 3TC6A 1NP0A 4H9TA 1KXHA 2QIIA 5E9XA 3HPXA 4I90A 4PTWA 1BXNA 1VGAA 4JTUA 1TVNA 4OBSA 3IT4B 5D37A 2NWRA 4BF5A 4U3CA 4BI6A 3DFNA 1KCZA 4QLJA 2PWUA 2IPWA 1J0HA 2EPMX 2REQA 3QMTA 2WKLA 5DT5A 3UR5A 4GGBA 5I3DA 4J3TA 3V7PA 3P93A 4LS1A 3NDZA 2DPEA 1OCNA 3P5ZA 4REQA 4M51A 4GKTA 3ZR6A 4YU1A 3BL3A 3FFSA 2JALA 4KEZA 2QAPA 3MMWA 3HPSA 4GJ1A 4YVXA 4EP8C 1MWOA 4YTSA 3TAOA 2NUXA 1RPXA 3S2LA 4EX4A 2EG7A 4DBUA 2RKXA 4F4RA 1J2BA 2J66A 3CJPA 1P0NA 2HISA 4TOQA 3V35A 5D8WA 3DU0A 4ZXLA 4XZNX 4GX8A 3EX6A 3TOYA 4XZLX 2DZVA 5CGTA 4A29A 2FIQA 2XSXA 4ZR8A 4Q8NA 3WLJA 2HVMA 4MB5A 1VJSA 2ZZ4A 1X38A 3CLWA 2Z2UA 4DJED 3LCHA 4M24A 3BAJA 3R0DA 1DIDA 4AX6A 2PZ0A 2PFHA 1U5VA 5HPOA 3AYTA 4ZO9A 2YBUA 3WJSA 2XIOA 2EG6A 3FGCA 3PUOA 2VC6A 3BV4A 3B03A 2DSZA 3U2OA 1VKFA 3PP7A 2P8CA 4QCFA 4EIVA 3VD9A 2IXUA 1JFXA 4F40A 1IIHA 1A0EA 2FLIA 5D2TA 4XZ9A 3UWWA 4RKAA 1YBQB 1L0PA 4LC8A 1A5NC 4M8UA 1V3LA 3FDKA 3PJXA 2DSVA 2PP1A 3G0XA 4OBRA 3MP4A 5LA0A 4L9XA 5IBXC 1HN0A 3C8FA 1HXJA 1KBIA 3WNPA 3WLOA 5EY5A 3EWBX 1GT8A 3W07A 1GYLA 2HXUA 3MSRA 5K4ZA 3T0TA 4FR1A 1DEDA 1LLOA 1X96A 2DFAA 3W7KA 4YCOA 2FZMA 2QCMA 5JIWA 4N4PA 1EP3A 4H1ZA 1T6MA 1D2KA 2ANUA 4XSMA 2VQTA 3OG3A 1BG9A 2J7EA 1GYMA 4QJ5B 1YW1A 1VJZA 1EJSC 4AMAA 2VTFA 4EF8A 5LKYA 3WQGA 1P0DA 4JTRA 2VUNA 1TZ7A 4YNGA 2Z6JA 3H12A 2V5JA 2XYLA 3TTOA 4IMGA 4MDOA 4Q32A 2ZDRA 1PXGA 3GG8A 4DF0A 4M0XA 1A5KC 3LBCA 3GO2A 1VIWA 4GIRA 3IRSA 4H2HA 3W84A 6PTDA 3TLQA 4R85A 3H4GA 3TFXA 1QTWA 2J7DA 1KRBC 4AD5A 5FOOA 3BQ6A 5A6MA 5I3JA 2BTMA 3MW7A 1Q66A 1B31A 3WK1A 4QHRA 4JQ1A 2AMXA 3BURA 3QV8A 1JGMA 4JTHA 2GUYA 5A2CA 5ABFA 4LAMA 2VURA 1B3OA 1TJ2A 4O4WA 4DZ5A 2XSAA 3RPMA 4AEFA 2ZX8A 4FZIA 4F79A 5F1VA 1ZBCA 2JBMA 5DANA 2J75A 1AL8A 3CAQA 1EGMA 1CB8A 3GAKA 2D0HA 1JCJA 3SGUA 5LXEA 1I45A 3AZTA 4IT1A 3T1GA 3KTXA 4I7WA 2FVKA 3WN6A 2RGMA 5CGQA 1XYAA 3VDCA 1MMFA 2R1PA 4QG8A 3R0KA 4KEMA 4G7EB 4IMCA 4FMVA 2Z4GA 3M46A 1KFJA 4UCGA 3HG3A 5HQMA 4M82A 3IK4A 5HMEA 1C91A 4IMEA 2DIJA 2GDQA 2EXOA 1B5TA 3C0JA 2RGLA 3UD6A 2ZX9A 5FIPA 4IICA 5KTLA 3SUSA 3DN5A 3OGVA 2ZXDA 1KTBA 3UJSA 3QHMA 3DI1A 4Q7NA 4ZFMA 4AHOA 3TA9A 1CXKA 3M0YA 3AZRA 3H2CA 3TXZA 1UYQA 4AD1A 4JYFA 1XX1A 5MKGB 5A8OA 4KKXA 4G1NA 1L6FA 1ZJIA 2E25A 1T41A 4J3XA 4LUTA 4IFOA 4C5YA 3D0CA 1A5OC 5FF0A 1CZ1A 1MZHA 4QG9A 3VIIA 1AQ0A 2YXXA 3TNOA 2A5HA 1XG4A 4LRSA 2VWTA 1ZLPA 3PQIA 4ECLA 3RRAA 2W0UA 4DUXA 1GPWA 1WUEA 4HMEA 3G1VA 4GJIA 1OGGA 4OWGA 4KQNA 4AIBA 3UXIA 4DLOA 4QR6A 4PBFA 1MRAA 4LCRA 3UG4A 3GVGA 2QGYA 1QDSA 3OIXA 3T0BA 3F4WA 3VIFA 1PTAA 4HPGA 3IJDA 4AD3A 2HK1A 3WK3A 4EK7A 5EA9A 4JEJA 4I7UA 3STFA 4HA1A 1AZ1A 4AYGA 3OYXA 5HUPA 3VXGA 1PWMA 4S3DA 3UT0A 1GNXA 4KMQA 3VKDA 3AIBA 2PDFA 1JPIA 4ZXOA 3ZSTA 2X30A 3VM5A 3CZLA 4JHOA 1H7NA 1MDRA 4JFWA 4ZE5A 1F8MA 2QS8A 3MUZ1 1ZZMA 2ABBA 1X1OA 4PULA 3R4IA 3ZJ7A 1C7SA 2Y85A 1KM6A 1V6WA 3SCNA 4P7OA 5CGMA 1UB3A 1S3HA 3MSDA 3KOWA 1PDYA 1PIFA 1UUMA 3WG6A 3F4VA 1UP2A 1XIJA 3UZWA 1D8CA 2G3IA 1PAMA 2PWHA 5J5DA 3N9SA 1J0NA 2J88A 3ISIX 3B8TA 3FS2A 4QROA 1N8WA 1TUXA 4IFKB 1CGYA 5EBAA 1RD6A 1XCFA 1I1XA 4XZIA 1H5VA 3V0SA 4Q8VA 4FLSA 2CIPA 2H9AA 1Y0EA 1HJUA 4GIEA 5EPDA 2ZA3A 3KTSA 3SRHA 4ZO8A 1JRCA 3Q2DA 2Q8LA 2GGGA 4GIYA 4JIEA 3W7IA 2CFFA 4EXAA 2VCAA 5D2VA 4DB7A 4DPQA 3CWNA 3LCWA 2Y61A 4JY9A 1O5QA 4UZUA 2YL9A 1W9PA 2PCEA 1VIZA 2XH2A 3KRSA 3GH4A 1PZ1A 4Z1YA 3W1LA 4H2CA 2EO7A 3F5KA 3CHVA 4YJ5A 4E5TA 4UR8A 5HINA 5I09A 1Y5WA 2V69A 2ALRA 2OTDA 1SU5A 4CNNA 4JQ4A 4PN2A 3IGUA 3SCUA 4I6KA 3RXZA 4QAIA 4K6AA 2CZ5A 4RUBA 3PZMA 1H41A 3MYOA 5IXEA 4Y6GA 5BZAA 1CLXA 2FZDA 1WYIA 4MWAA 2D3NA 2PF8A 5HXMA 3KOZA 3AIVA 3W71A 3SRFA 2J47A 3L5LA 4XZHA 3GLCA 1PYMA 3KL0A 2YZRA 5DELA 1XHGA 3VZYA 3H4XA 1ZY9A 2CHNA 4I9MA 4LUJA 4V1YA 3WDRA 3D6NA 4DNMA 2ZTKA 1V0KA 1FA2A 1A50A 1G01A 2EPHA 3B97A 1LG1A 4M7SA 3BJFA 3NM1A 1XH1A 2BZNA 4XUGA 5AZ1A 2CETA 4DQWA 4B3ZA 4H3DA 4BI7A 1K4GA 1CI1A 1UHVA 3M0LA 4PR4A 1QVBA 2JKPA 3W4RA 4JIHA 3E0VA 2A21A 2YCJA 1L6GA 3EKGA 4AIEA 1OF6A 4HHHA 3PNUA 1JL8A 1K8YA 4IG2B 1EP1A 3FA5A 3E0FA 4OOUA 3GNNA 4GQRA 4IMFA 1X6NA 5BU6A 1WBHA 1VF8A 4NI8A 3DCPA 3K1DA 3ICJA 1G69A 1S46A 3WH7A 3P7YA 2DEPA 3PTDA 3NSNA 1JNEA 1LT8A 2UV8G 2BY1A 3TSDA 3CZEA 5CZJA 3IV8A 3NQ6A 3KL3A 4E2BA 3EBVA 4P7LA 3CQKA 3BLFA 1DJQA 4IM4A 1V6XA 4X2PA 4W8AA 2DUZA 2HRWA 4U31A 2QVHA 3VOCA 4XTDA 3LX9A 1IEWA 2VDIA 3BAIA 3M5XA 3IVUA 1EA0A 1YDYA 4DJFD 3MS8A 4MGGA 3FIGA 1EA9C 3AS0A 4X63A 1OX5A 3CXOA 1VFSA 3WDQA 1QR7A 4I9JA 1S3TC 5FJIA 2EPNA 1S1RA 5IBXA 4UTIA 2VCCA 2DGAA 3SECA 2JK2A 3APTA 1KFWA 5JBFA 3OJGA 3PZNA 1XBXA 3A12A 1Q6QA 2V3GA 1DE5A 4ZQPA 1V6YA 4Q8QA 4S3CA 1PE1A 5CSSA 3DBNA 1G4SA 4N9DA 4O11A 5FSEC 5A5WA 5BXSA 3A4AA 3SCRA 3CUJA 4QNWA 2BY2A 2G95A 4R34A 2G3MA 5JH2A 3WJYA 2PAJA 4NYUA 2FFCA 2VDGA 3E2RA 1MFVA 1UWAA 2DIEA 1O0SA 2A2IA 4ML9A 4UTWA 4Z1BA 3VX1A 3OGRA 2G37A 4UUIA 3LM7A 1JZ6A 5F2IA 4GQGA 1F05A 2J7GA 2INZA 3IWPA 5FJPA 1NF7A 2VOMA 5LGZA 1S2CA 3M44A 3PJTA 4O1EA 4YWSA 5L6UA 5I06A 1ITQA 1JYXA 4QEEA 1U1JA 3AIUA 4BQ4A 2PLKA 1G5AA 3CLMA 3B06A 4DWSC 4GKLA 3PN8A 4YCPA 4HZ8A 2ZADA 1F6YA 3GWQA 1FHLA 4Z2IA 2TYSA 3VNKA 1KXTA 1RWCA 2PDYA 1FWTA 3HG4A 4JTSA 5E1QA 1CLKA 4RLIA 3URQA 2NX9A 4CNUA 1ONEA 5FL0A 3TQ0A 1E3ZA 1XIHA 5CC6A 4V2XA 4GLEA 2D24A 4LUSB 4UQBA 3MUIA 1GOQA 3O6YX 1X1HA 4ZOAA 3T0DA 2X2YA 3QKZA 1MSSA 3I4KA 2LLEA 1IEQA 2ASHA 4HJWA 3U0HA 3F5JA 4GPNA 3DYPA 1KCKA 3TOPA 5B80A 4D6HA 3ABZA 3KS6A 1VJIA 2QF7A 3I7RA 3W7CA 1E9ZB 1Z48A 3VZXA 1JJKA 2E6AA 8TIMA 3H26A 3AUOA 3R89A 4DWSD 5FF2A 1Z41A 4Q33A 4O57A 4ACYA 2BWGA 4YPJA 1NH6A 2PRLA 1Q4NX 4IGHA 1TFVA 4JIIX 3EWWA 4E4PA 1W91A 4AWSA 3AISA 1QNVA 1K8XA 3DFTA 3SB0A 3UNTA 4NL1A 1IWAA 4IL2A 3OVQA 5AB3A 3WLMA 3L4VA 2QCLA 1M7JA 1JZ7A 3PAJA 4LBSA 3BV7A 1TV5A 3PBMA 3EX3A 2E4TA 3FOKA 4KCTA 4JTFA 3M47A 5AYIA 2ZA2A 1V8EA 2FQIA 4UMCA 3RAOA 3TJ4A 1ZBWA 2WNQA 3TUUA 1WNOA 2PRHA 4N42A 2PDXA 1LLZA 2PTYA 3AICA 3RIKA 1W9DM 2YL6A 3U57A 4GY7A 1XFCA 5CSRA 2QDEA 1X39A 3E12A 4RDVA 4Q4RA 4FOUA 5M2FX 1Y5VA 2VL4A 4CCDA 4CNPA 3C0LA 3W75A 1KXQA 4QDPA 1NFBA 4FNSA 1UWRA 4NZFA 1CGXA 3GDLA 2AAAA 2VVSA 1XXXA 1YADA 2V2CA 3LDVA 3IIPA 1ZBKA 1UP0A 2HS6A 4IMAA 2FPVA 1H11A 4FLQA 4R27A 1DJWA 4GABA 2YW3A 4PMQA 3NQCA 1E55A 1G4PA 3S5ZA 4N9EA 5LZLA 3WUBA 2WO5A 1ZS2A 1P7TA 1HGYA 2UY3A 3JS3A 1LUCB 3SY5A 1O66A 1G9HA 2V82A 2VC9A 3W37A 2GJXA 2ZC1A 1M41A 2FGBA 1O95A 4X61A 2ZXAA 5C9ZA 2FKPA 4GZEA 3CV2A 1UIPA 3SCSA 2Z1XA 3O6AA 1KD0A 1A5UA 3PPGA 3V5OA 3G1SA 3LB0A 1E9IA 3WJWA 1UA7A 1VBGA 3PZOA 2UZ9A 1ISZA 1XBZA 3VI2A 2ZBTA 1NM9A 3U8GA 1J79A 4DBSA 4V28A 3MO4A 5LNSA 1QI3A 3NZGA 2Z1BA 1XD1A 2KXRA 3NSMA 6XIAA 4ZE4A 4D1IA 3HQ1A 1OHLA 1Y65A 2I9EA 2QHAA 3BQ5A 2NXIA 4MY1A 3QR0A 3TYZA 1SR0A 3W2MA 4HU8A 1XIDA 2POZA 4MZ8A 1PB0A 1DHKA 3I3EA 2DZWA 3SRKA 2VEPA 1PIIA 1U5JA 2WBKA 3AMCA 3GG1A 4FIQA 2RFGA 5D2XA 3WDHA 5CZSA 1EX5A 1X8CA 1EC9A 2XGIA 5RUBA 4AHQA 4QAWA 1E70M 1QWKA 2ZRYA 3HOJA 4GISA 3AXKA 3NDOA 3FLUA 1WDSA 1YDVA 4HSNA 3WLIA 4XTIA 1ONXA 4KCUA 1P6WA 3WQFA 2G50A 5K4XA 4JTTA 1NP2A 4Z08A 3SIZA 3WYZA 1O94A 1UKQA 3DERA 4W8LA 3NL5A 2R1LA 1H51A 3LI0A 2YFNA 4K1GA 2WW5A 4DNHA 1Z89A 1VLIA 3QQWA 2QVNA 4F2BA 4QITA 4F0LA 1CGVA 4S3KA 3HGSA 4WY0F 1Q2RA 2BHUA 3GR7A 1RCXB 4L7ZA 1U5HA 5TAOA 4YVPA 1B3VA 3CH0A 4RNFA 3S0CA 5FA5A 1WQ5A 1RBLA 4TMCA 3H2FA 3Q67A 3GVQA 4WEVX 1ZJAA 4CNOA 3EWXA 1XDMA 1WOAA 2ZZ1A 5TF0A 2DW6A 1TREA 5BXRA 2P0IA 1E43A 4OT7A 2VZSA 4E6MA 3NZQA 3WELA 1TV4A 4LT9A 4XX6A 1TR1A 1HX0A 2W91A 4N6EA 3UGRA 3HO8A 1GW9A 3WCZA 3MHGA 4ZQMA 1LXMA 1IF2A 1UWTA 3O9NA 3KHJA 3C86A 1CX9A 3ARTA 5D03A 3ZSSA 3R79A 3CZJA 3GYEA 2YPIA 5AYZA 1MUMA 2VUYA 1HIZA 3LGGA 4O1AA 5DY3A 1VFOA 3GTFA 4HNLA 1CXHA 3STEA 1PDZA 1UR9A 2J77A 2HQAA 1GVEA 4B5WA 4AZ6A 3THAA 3PZ9A 3QH2A 1JULA 2WM0A 3O3RA 3C2EA 1UZDA 4GHRA 4XZWA 2GK1B 3W7QA 1W3LA 1WZLA 1PWLA 3I7QA 1JAEA 1JVNA 1KLYA 1FWFC 3CMGA 1OJOA 3HGJA 1E6SM 5IDIA 4E2OA 4FIRA 4BEQA 2YW4A 5GJPA 3LCGA 2VEGA 3K8LA 3FX4A 2B7QA 5HJYA 1HJQA 3WQOA 1U1UA 2E9BA 3GR4A 2FGZA 1RWHA 1BYAA 2Z29A 2V6AA 4HD5A 1M01A 1J0JA 1E73M 2I9UA 4MAVA 3A47A 1WA3A 3ZVHB 1W3KA 4HNUA 3UA4A 3JZEA 1L2UA 4KWOA 3BG5A 4M56A 2A6LA 2QZRA 5A6BD 4CD7A 2UBPC 4JX5A 3UCQA 1DJZA 3UZJA 3ARRA 4GH1A 4H9UA 2HZGA 4E3TA 3DFSA 4PGLA 2CLOA 3NDYA 3PZIA 4JKKA 3W7HA 1MW0A 3AFBA 2W61A 4J2MA 4H9ZA 4GA8A 3ITGA 3C0SA 4UFIA 2EKCA 3U9IA 2HNEA 3GXIA 5EB8A 1YDNA 1TX2A 4AZCB 1E1EA 3NVDA 1QWGA 1QASA 2FH8A 1DTUA 2OSYA 1AW5A 4GYJA 5TIMA 2VR5A 5CLWA 4PRWA 5FEZA 3VU2A 2X7VA 1CYGA 1GOKA 5EMKA 5AOUA 5A8MA 2TPSA 1JZ4A 2QDGA 2DIKA 4PRTA 5AC8A 3W7OA 8A3HA 4YTRA 1CT5A 1OFBA 1RJRA 2C14A 4KW2A 3RLVA 3B40A 3L0NA 1RA0A 1WPCA 2EBNA 3SADA 3B4UA 3M7WA 1XBVA 4LVFA 3FN9A 1Q6GA 1EHAA 4S3JA 3IIOA 4MVAA 3QHNA 2QUTA 3UPWA 3H24A 4M5PA 4OOZA 3VABA 1I6NA 4GBUA 4G2DA 3SI9A 1W1B1 3TYUA 4HB7A 1AW1A 5D8ZA 3W7NA 2E09A 4YIWA 1MYRA 2ISSA 4JN6A 1JYNA 1K7XA 2CLLA 4PMYA 4C1KA 2ZICA 1U30A 4Q6XA 5CAHA 5C7HA 1HQTA 3PWGA 5BYWA 3I3BA 1LL7A 3LHVA 4Q3MA 3VDHA 1HT6A 3SCVA 4R9OA 1R0MA 1EBHA 2WPBA 1GUVA 5H8UA 1V7AA 1V3IA 3AAMA 1YPXA 3DFQA 5G1MA 1VC4A 2Y70A 1KB3A 3SCOA 3QW3A 4KRTA 2EPLX 1KM4A 1IE7C 1EDGA 5CAKA 2IMRA 2ADAA 2WSPA 1DWAM 3OPSA 4ZO7A 3N9KA 3ARSA 3W1NA 1ZQ5A 3PUEA 4FK9A 4YN5A 3OIHA 3OYZA 2PP0A 4TR9A 1OQFA 3SUTA 5HQEA 1UW9A 3EWZA 4D8OA 1C8QA 3AROA 2HK0A 3HPFA 5IDZA 3UERA 3DUGA 3WBEA 1C29A 4RZ4A 2OWCA 1H7RA 3FYOA 2BXVA 4MFEA 4B15A 1GKRA 3VFLA 1XLCA 2QPSA 3MANA 4XKYA 3FSUA 4AIUA 4C6MA 1HJVA 1LQAA 1TJ1A 3BGAA 4R5EA 4JTEA 2BY3A 1E0UA 3MUAA 1C7TA 3IEBA 4NJHA 4K2SA 1DIEA 3EKZA 1LOQA 1BXCA 1C8XA 1BWLA 3GZAA 3UZYA 4KH2A 1WKDA 4MPKA 5EMMA 2XN2A 4CNSA 1HF6A 1EQPA 2NLYA 3MB9A 2OZTA 2YX0A 3SN1A 2D2GA 3CHDA 3CTLA 3BSHA 5A6SA 2JKAA 4WGHA 2IKIA 5CZKA 1SMDA 3UG3A 3U7VA 3B4YA 2J7CA 3OLGA 3G24A 4ROQA 4I3GA 2OJPA 1EYEA 4PFMA 2A7PA 4JKLA 2ZRUA 1T8QA 3NYDA 4JKMA 1XRSA 5DCDA 4PTMA 4D8AA 2ONEA 2EF9A 2NXHA 3AJ7A 2OZ3A 2F2KA 3IJLA 1GVQA 1AA1B 1X97A 3GXFA 3SCWA 3CS2A 2BODX 4BK9A 2PDIA 2WCSA 1TTIA 3QKEA 4M3PA 1VYRA 5C71A 1FCQA 1H09A 2EHHA 4DBDA 4JGDA 2HMCA 2PWDA 4XVEA 4Y8EA 4PMXA 2O55A 4XB3A 5AC4A 4JIPA 2C1IA 4KEUA 1MUCA 3F59A 4B4HA 3B3DA 2ISDA 1TZ9A 3NXFA 3S6DA 3AMDA 1ESWA 5CEWA 1CB7B 1R2TA 1UR0A 1S2UA 2VDHA 4L1WA 1R9ZA 5H8PA 3TIMA 2Y88A 3S4TA 3WF0A 4DPPA 5AECA 2Z0IA 4FO4A 3RF9A 1N7QA 1S38A 2TAAA 1AQMA 2EKGA 4I5UA 1KA9F 2NVAA 1EJUC 3QXBA 2FTYA 4LCSA 1KQYA 1IWBA 1QHZA 3KWXA 3TN3A 3C2OA 1W9VA 4DJEA 3ONCA 4AUBA 3SN0A 2GGIA 4P7RA 4V27A 5FAGA 3POCA 1E6RA 2E0PA 3EOOA 4MKNA 5LIXX 1HL8A 1K4HA 3CIWA 2WANA 3R13A 4OGZA 3DGRA 1FRBA 1RR2A 5C55A 3UWQA 3VCRA 2GDUA 2IW0A 2PC8A 4GG9A 4KBXA 2PGFA 2RJGA 1F4HA 1EB3A 3GR8A 1YKWA 7XIMA 4UBPC 2YLAA 1H61A 1WAWA 3ZT6A 1Z42A 4B5NA 4N9CA 4WGXA 1I0BA 3GIPA 5A69A 2ZZ2A 3P61A 3DFPA 5TNVA 3M0XA 1VHNA 2Y0FA 3WH9A 1RQBA 5CC7A 1MEIA 1A5LC 1H7WA 3FVMA 3HIJA 2WAGA 6A3HA 5A6JA 3PULA 1W54A 3TR2A 1H50A 3T0CA 4NT0A 1AFSA 4UFLA 3E0LA 1YTKA 2Y62A 4E4UA 3T0AA 3LTSA 3N6HA 3R12A 1UMYA 4CQBA 2R6OA 5A6BA 4MYAA 2QPXA 1J6PA 3FY1A 4XD5A 1PL9A 4GO8A 1N55A 4B5XA 1YPIA 4MY9A 5HMSA 3B9NA 2AL2B 4BA0A 2YA0A 4PMDA 4LYKA 3L2LA 1VFMA 3L67A 5FF4A 4S3BA 3AMKA 3M0MA 3EA1A 1V3KA 2YBTA 3N12A 4DM2A 1FP8A 4H9YA 4YTTA 1I2OA 2GWGA 1E15A 3WJXA 2A3HA 3UBPC 3F7JA 3KOYA 1CXEA 2R9RA 3LOTA 3DFOA 1EPVA 3VOHA 4D71A 4AXKA 1XW8A 1HN1A 4GH3A 4TTGA 4ACZA 1PCKA 4FOJA 2VWSA 1CIUA 3IIZA 3B9EA 2F38A 4S3AA 3BC9A 1NY1A 1S2WA 3ZXWA 4FF5A 3HA1A 5FL1A 2R8WA 4M19A 1DQXA 2JEPA 5AKQA 3R0UA 3RPDA 4XO7A 3QQ1A 3SN4A 5DRIA 2WHLA 2VZKB 2Y8VA 1AG1O 2QNEA 3FJ4A 2WCGA 1KR1A 2YCLB 4V33A 4UTTA 4MKVA 3EEZA 2Y5EA 3NUKA 4ADSA 2BASA 4HU0A 4XAZA 2RDUA 1RCOB 4C5ZA 4B3LA 4WXYA 3KZPA 1JG9A 4MKSA 3OZOA 3CUFA 2Q1FA 3T55A 3LQGA 4HMCA 4DVOA 1PSCA 3IPWA 1NAL1 2C0HA 2VYOA 2GJNA 1R3TA 2PU0A 4H00A 2CLHA 3Q37A 3IGSA 4HGXA 1W8SA 4Z2GA 2CBJA 4QDMA 3PG8A 4HPHA 1M9HA 4H6KA 4AF0A 2AQWA 4FNPA 1XRTA 3MO7A 4XQ6A 3TSBA 4M1BA 2WV8A 4NNBA 4PB4A 3TLLA 4GWEA 1XH0A 5EL1A 5T8GA 1SJCA 4RE0A 2QMKA 3CPGA 4MLJA 1DVJA 2C1GA 4W85A 3TWAA 3RPTA 3CYJA 3W7GA 1GKQA 5K9XA 2PGWA 3IJ9A 3VILA 1GGOA 2PLMA 1L2QA 1B9ZA 2FFIA 1EIXA 2I5QA 2XTKA 3G1FA 2YDAA 3T05A 2ON3A 4O52A 3NXLA 3C2YA 4B2DD 1OSEA 1A5SA 3M0VA 1DORA 1RALA 4UC5A 4PB5A 3M0IA 4H19A 3L2IA 4AU0A 4ZEPA 3CO8A 2GFTA 2GQ3A 1I1WA 3UWUA 4GQ0A 2WNZA 2NWSA 2VZOA 1CXFA 1W1VA