4D6GA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the blood group a-trisaccharide (l19 mutant)
Total Genus 224
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
224
sequence length
587
structure length
587
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYHTSAHWLSTSWIDKMYQKYPNLHGIFSTESYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 224
structure length 587
sequence length 587
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6gA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6gA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6gA02
5JBDA 1V6YA 2B31A 1OGGA 2NT0A 1GJUA 4S3JA 1J01A 4JHOA 3CZJA 3VIPA 1CXKA 1UH2A 2J8FA 3CUJA 4LPCA 1CXEA 3W27A 4P7QA 4FLRA 2WBKA 2G4FA 3VD3A 3OLGA 4EK7A 4OZOA 5I24A 4M24A 3MSDA 1RH9A 4A3YA 3WNPA 5GNYA 3AIRA 4A3HA 3B8SA 2OWXA 5LYRA 3TONA 2E3ZA 2ZIDA 2WZHA 4ZENA 5A95A 1NARA 2ZX5A 3WDPP 1OWQA 1WKYA 1J18A 2VMFA 3ZR5A 3CHDA 4JCMA 1GOIA 1WZLA 2DH3A 1JZ6A 3W82A 1FH8A 3N11A 2XM2A 1ISZA 1HVQA 4H8UA 3ZM8A 3T2PA 5A6JA 2PC8A 4GQRA 3BH4A 2A3AA 3MANA 4GINA 1QBBA 2VZSA 3NJ3A 1C82A 5C71A 3L4UA 2A3HA 4PMUA 1JFXA 3AMLA 1JI2A 2XFFA 2C7FA 1E73M 3GBDA 3SUVA 2O9RA 1XYZA 1EDQA 4HA1A 4D6HA 2CETA 2BHZA 4GQQA 1AQ0A 1E1FA 4UFHA 4PTXA 4AD3A 4J27A 2WVVB 1CECA 1NP0A 3PZQA 3NCOA 3ZJKA 4J3SA 6A3HA 1M03A 1GVYA 3EMCA 1CIUA 2ZX8A 4W7UA 4PMYA 3L2LA 2W67A 4CN1A 1SYTA 3TTYA 4JKKA 2J7BA 4J3XA 2XSBA 2CNCA 1SR0A 3UG3A 1BFNA 4PBGA 2VURA 1VJZA 1HJWA 4UFIA 2WMKA 2VNCA 4WSKA 3N1AA 2OYKA 1B3ZA 4URIA 1BVZA 1O7AA 1LL4A 2J78A 1QNQA 3NDZA 3QOMA 1RD6A 1EH9A 2XFYA 2YL9A 2YL6A 3S6TA 1ZBCA 4DWSC 3FAXA 2V3EA 4HOXA 4PUDA 3ZR6A 1JYXA 5FIPA 3VMOA 4EKJA 2VCAA 2IXUA 3K4DA 1E56A 2VZVA 3WY1A 3GZAA 4B9ZA 1R85A 5HDRA 2WANA 2WMJA 2WKGA 1WDPA 5AYIA 4PMRA 1JZ2A 4MNLA 3AQUA 3BCFA 1C91A 1CGUA 1V08A 2EPKX 1Y7VA 1VBUA 4V2XA 3ARYA 3RPMA 3AHVA 4FMVA 3L4ZA 4AD2A 3VGHA 1BPLB 5DEZA 2IUZA 4FF5A 4HPHA 2GK1A 5BXTA 1ZBWA 1QNSA 3ARWA 3MS8A 2JEPA 3VGFA 4X9YA 4EAMA 1W1PA 1WCGA 3NYDA 5CGMA 1H09A 1ZB5A 2IXVA 3ZMRA 5LA0A 4GO8A 3CZ8A 3LPGA 1V3HA 1NM9A 1FA2A 2E0PA 1JD7A 5A1AA 4U2YA 2D23A 1W3JA 4H04A 1OCQA 1MW0A 4WIWA 1B3WA 3DYMA 1CBGA 2FGZA 2W91A 4AY1A 1FFRA 1FP8A 1HN0A 3OG2A 1E5NA 1WB0A 4HOZA 4JFWA 1E4NA 3FHAA 1E0VA 2ZXBA 3B9EA 3CHEA 4W8BA 5A2CA 1V3KA 4LYRA 3FN9A 4CN6A 1CGVA 3ZT7A 1LL6A 3ARTA 2WSPA 5A6BD 1Q6CA 3WEMA 3MUIA 1F9GA 3GNRA 3PZUA 3SCSA 5BCAA 3OLEA 4NRSA 1DHKA 1OJOA 3VILA 1H11A 1W2VA 1G01A 4QCEA 4H7VA 4TX6A 3WUFA 1JGIA 2W62A 3N04A 5CJ5A 3AMGA 5I23A 4LYPA 1DWIM 1XSJA 3ECQA 5A2BA 1ISWA 1MW2A 3I3DA 1UR9A 1UYQA 4AEFA 2VI0A 4HP5A 4WLCA 3KWXA 1J0NA 3WH5A 1PIGA 5F7UA 4U3CA 1V02E 4UQ9A 3WFZA 3UR8A 2DGAA 2UY3A 5JIPA 1WDSA 3UETA 5CZKA 4DM1A 1CXLA 4AD0A 3GM8A 1KB3A 1EOKA 4P8VA 3E1F1 3WNMA 3EDEA 3F5LA 1DWHM 1L8NA 1C3FA 4GKLA 1ZU8A 3SCOA 2ZUUA 3U57A 4QLLA 2WAGA 3GXFA 5TD4A 3CHFA 3WUBA 2YBTA 3AS0A 3U7VA 1IZKA 1N7RA 2EEXA 2HVMA 5I78A 2J74A 1QI3A 4H8VA 1DP0A 2NT1A 2A3EA 1W9BM 1J0KA 1J0IA 2OSYA 4DUXA 2WWDA 3D5HA 2NW0A 2UY2A 3CPUA 4CD7A 1OGBA 4JHZA 2WPGA 3VGEA 2OSXA 1E3XA 2YL5A 1B0IA 3ALFA 4AZGA 4NZCA 1E72M 2YDSA 1E55A 5FCZA 1I75A 4QAWA 4ATDA 1HN1A 1N7PA 2PWEA 3ARPA 4M82A 5E0CA 4OOUA 3LPOA 3ARRA 3W28A 3N9KA 1PAMA 4XZBA 3AICA 2EXOA 4H41A 1X1JA 1UKPA 2VRKA 1IZJA 1KXQA 4CCDA 1J11A 1XH1A 1XH2A 2XGBA 3ZJ7A 4UR9A 5BRQA 3VDCA 1J0MA 4JFSA 1VBRA 1BLIA 2VJXA 4CGTA 1V3JA 2J79A 3GBEA 2EPOA 3EDJA 3WSUA 1VRXA 2W63A 1UWSA 1UKTA 1E1EA 4HOWA 2JF6A 1W9UA 4UFKA 1UD2A 5JBFA 3AMDA 4JIEA 3MUY1 2WC3A 1GVIA 4IISA 1EHAA 3OBAA 1QI0A 3VNYA 2E8ZA 1WPCA 4RE3A 2CBIA 3AIBA 4UZUA 3WQ6A 1GNXA 1PZ2A 2CESA 1AMYA 2VCCA 3UERA 1C90A 2YJQA 2PWHA 5GNXA 3PZTA 4UFJA 1UWQA 4TX8A 3W81A 4D6FA 4V27A 5C70A 2QHAA 1JZ8A 3WNOA 1D3CA 4AWEA 3LMYA 5A3HA 2GK1B 4TXEA 3VDHA 1KWKA 4H8HA 2Q1FA 2ZUSA 4Y7EA 1HJUA 4BA0A 1G9HA 3F4VA 3UCQA 1R7AA 1E6XM 2ZX7A 3WELA 1K9EA 1UZ4A 2FGLA 2QV4A 2YIHA 1QHPA 1JG9A 2VC9A 2QMJA 1J9YA 1UWUA 1GZJA 1Z32X 2CKSA 2X0HA 3I3BA 1B3VA 5BROA 4HPGA 5ABEA 2ZE0A 4DUVA 2OWCA 1F4HA 4HMDA 2GFTA 3L4WA 2D3NA 1I8QA 4CVWA 1MXDA 1UA7A 1HVXA 1ZBKA 1V0KA 2GJPA 1KCKA 4OBSA 4FK9A 5A6BA 5A8PA 1JDAA 3RDKA 3WDQA 1XYFA 3KL0A 1NOWA 3AHZA 3MUAA 4PRWA 2BRWA 1QOXA 2JE8A 1C92A 1C93A 2CXGA 3M46A 3N15A 3QHNA 4CCCA 5D9PA 4MAZA 3K8LA 1HF6A 2VCBA 4QFUA 4MB3A 1CXFA 4XB3A 5LA1A 1GQKA 4WK9A 2YL8A 1N7NA 5I0DA 3RO8A 1KCLA 3GH5A 3W37A 1JZ5A 1TR1A 1XRVA 4HA3A 4QLKA 3WH7A 2XWDA 4CD5A 4MB4A 3U7BA 1OINA 3BSHA 3F5JA 2WYSA 3WF1A 1VF8A 3QOKA 5FKYA 9CGTA 1HT6A 1V03A 3LPFA 1CGXA 2V3FA 1RWFA 3UG5A 3A6OA 4CKQA 3RILA 5BXSA 4CU6A 4UQBA 2Y2WA 1W3LA 1WE5A 4W5UA 1UQYA 4W8LA 1HNYA 2DT1A 1EDTA 4UQAA 4GO9A 1UD5A 5EFDA 1VB9A 4Z2JA 4HZ8A 4PMZA 5CQ1A 2ZOXA 5AC4A 3T09A 2X05A 1VAHA 3MO4A 1UKSA 1W91A 1B3XA 3AZTA 1S46A 1K9TA 1J12A 1TA3B 2J47A 4BS0A 1TCMA 3VIFA 2ZXQA 2YLAA 1JFHA 5I5RA 3EMZA 3ZOAA 3MMUA 1CGWA 2YA2A 2XUCA 4MAVA 4OKDA 1GCYA 3DYOA 1UR2A 4UTFA 5A6SA 2FH8A 2YA0A 1QI5A 3EYPA 1V3IA 2WSKA 2VVSA 2XG9A 1XSKA 3M6DA 1OJNA 5A2AA 1XCWA 4AD4A 5I77A 1CYGA 1U2YA 2F8QA 1HMWA 1DEDA 1B3YA 1JAKA 4OOZA 4PCSA 1E5JA 4AZBA 4TVUA 3VIJA 1XSIA 1W3KA 1X1IA 3ARUA 1KBBA 4WJXA 1JYWA 1WAWA 1LOHA 4BQ4A 1BYAA 3SCNA 4WKFA 1JZ4A 4V28A 3W38A 2VX6A 1KGUA 2BY0A 2J7FA 1J0HA 1WDRA 4MNJA 5IDIA 1LG2A 3VOCA 3W29A 3IAPA 2MANA 3CUIA 5HNNA 1E0XA 4ZE5A 2XVNA 4F9DA 2WXDM 1CNVA 4E8CA 1JZ3A 1QBAA 1GORA 4PYSA 2XYLA 4IPLA 4CN4A 3OB8A 1KXTA 3WMSA 2DH2A 5GQBA 1RWCA 2Y5EA 3CIVA 3PHAA 2DSKA 2E4TA 1NWUA 3FW6A 1H41A 2E9BA 3O2LA 3U5UA 3OGRA 4AYSA 1HL8A 2XFRA 3EBVA 1A3HA 2JEQA 4IUGA 4PMOA 1W9VA 4GZJA 4UOZA 3CO4A 3G6LA 4M1RA 2WKLA 4W87A 1E70M 4AXNA 2BS9A 2VZUA 4PMNA 1CGTA 4N0RA 3VD5A 5A6MA 3T0DA 2CEQA 4PTVA 3UG4A 2J7DA 3AS3A 1V0NA 4J3UA 3DHUA 1MYRA 4C7GA 3WH9A 3GYCA 4KH2A 1JYNA 3VGBA 3FNDA 1ISVA 3U5YA 5DFAA 4P7NA 1ITCA 1UR4A 3NUKA 1ISYA 1TZ7A 3ARZA 1CXHA 3W53A 4ZEPA 1N7QA 5ABHA 4JKLA 2PWFA 2WVSA 1KR1A 3TTQA 1HX0A 3N13A 3OGSA 4YHEA 1ZJBA 1BAGA 2BVTA 3SCUA 1LLOA 3CHCA 3ALGA 1JDCA 3APGA 1BYCA 1B31A 1VFMA 1IT0A 1EGZA 1J0JA 2J7HA 3WBEA 2J8GA 1L0PA 2PB1A 1C8QA 2WNWA 1OB0A 1C8XA 3ZSTA 5LA2A 2D24A 2GVYA 3AFBA 3N18A 3VVGA 4GI9A 4MB1A 4AZ6A 1I1WA 3KL5A 1V6VA 1RWHA 1E15A 3BXWA 2WMHA 5CSUA 1F1SA 3W6LA 3VINA 1HKJA 4PN2A 1OSEA 1EXPA 5HXMA 2ESCA 1GOOA 1GHRA 3A3HA 1QI4A 2QPUA 1BSIA 1E43A 3WD0A 2G3NA 1HIZA 2X8RA 4F9JA 4Z2HA 1TMQA 2PBOA 3AXXA 4B3KA 1DWAM 2DT2A 4B9YA 1E0WA 1ISXA 2VX4A 5ABGA 1W32A 3VIKA 1DWFM 2VQUA 4XV0A 2XJ7A 1E4IA 1RP8A 2E8YA 3WDIA 3WDJA 1CWYA 1VENA 2J7EA 2WBGA 4H2CA 2V3GA 1CZ1A 1HJVA 2VR4A 1OGSA 3EDFA 4XX6A 1W3YA 1X1HA 1E4LA 3VDBA 1MWOA 4L4OA 2VR5A 3AZRA 2V5CA 5A8MA 1E6QM 1PJ9A 1E6ZA 2V5DA 3CZLA 1US2A 4KRTA 3TP4A 1B9ZA 1SFSA 1FP9A 3HU7A 4D6IA 3N17A 2CCRA 3W0KA 1HP5A 4DUWA 1H5VA 2WLYA 4QP0A 1UD6A 2XVPA 1PX8A 5ABFA 1B1YA 1ODZA 1JAEA 5GPRA 5CG0A 2YOCA 4C7FA 4EANA 3BAYA 3CTTA 2OWWA 4DM2A 4DWSB 1MW3A 2WZIA 3KZSA 1HP4A 5BWFA 2VO5A 4GIAA 4RE2A 4HMEA 4Z2IA 4N42A 3WNNA 2W5FA 5ECUA 4OUEA 4JFUA 5FOOA 1ECEA 2BHUA 3SCQA 2W4XA 4D6EA 1NOFA 1VEOA 3THCA 2ZWZA 4TTUA 1GPFA 1XHGA 1WO2A 1M7XA 4AEEA 4MNMA 4DWSD 1TA3A 4U3AA 2G3JA 1JDDA 4AIEA 1J0ZA 1RW9A 2VQTA 3RM8A 5IFTA 1H3GA 1HKMA 3AIVA 2VUYA 4LXFA 2GDVA 3CZEA 4HU0A 5JBEA 1CENA 1BF2A 3AIEA 2PWDA 2EJ1A 1E6SM 2RGLA 4TTGA 3WF4A 3WIJA 1OD0A 2ZICA 4P7OA 2X1IA 1CDGA 3T0AA 4MNKA 4AC1X 4Z2LA 4UQCA 1W1VA 2QLYA 1CPUA 4NI3A 3ARQA 3AIWA 4KGLA 5E70A 1V6WA 3CUFA 1K9FA 4QDMA 5DT7A 4AISA 3GDBA 2VVNA 4UFMA 3CUHA 1B30A 3IANA 3L2MA 2WDAA 2ZUNA 4NF7A 1E6NA 1KBKA 3WNLA 1JF6A 3AS1A 4MADA 1JF5A 1UQZA 1HJQA 3CH9A 1EGUA 2VTFA 1E3ZA 3IJ7A 2ZXDA 4C7DA 3VMNA 2PI6A 2EO7A 4UNIA 1JZ7A 2WMGA 1X6NA 4W7VA 4BF7A 4Z2GA 1GQIA 4AD5A 5E6YA 3SUWA 3NDYA 4GPNA 3WF2A 3BSGA 1US3A 2Y24A 1BG9A 2WZEA 4GZIA 1GOKA 4ATLA 3L4TA 3DC0A 1MFUA 2GJRA 5D4YA 3MMDA 1BGAA 2X2YA 3QR3A 1H2JA 3BAJA 3HN3A 1KWGA 1LWJA 1V0LA 4BQ2A 1WDQA 3OLDA 3QGVA 1VEMA 4MDPA 5CLWA 4UOQA 1EHNA 4QCFA 3WH6A 2Y8VA 3WL1A 3IAQA 3VD7A 1LXMA 2CITA 1RWAA 3EDKA 3PZMA 2EQDA 4CD8A 3VPLA 1SMDA 3WUGA 4WKAA 4KRUA 7A3HA 1XV8A 1H0GA 4W88A 2DPEA 1BYBA 3JUGA 1LL7A 5A8QA 2GUYA 3B9AA 1DWJM 2BY2A 1FH7A 3L4YA 3WD1A 1U33A 1JNDA 3AJ7A 4B3LA 1H1NA 4OIFA 1MXGA 2J62A 5EMYA 3AISA 1TVPA 3ZJ6A 1M01A 2JF7A 4RE4A 3WN6A 3RJYA 1MVYA 1OJMA 3SEPA 2XVLA 3RM4A 3VIGA 3BAXA 3AROA 1OD8A 3AZSA 2J77A 2PF0A 2E40A 2XSAA 3VD4A 2Y4SA 2VRQA 5BXPA 4D6CA 3BAWA 4M29A 1W3HA 4LYQA 3RIKA 5D9NA 4GI8A 2D1ZA 5A6KA 3BLKA 3WQVA 3WBAA 5IHSA 3VUPA 3FAWA 2O9OA 2JFEX 3DHPA 3NIYA 1K6AA 1MQRA 1W1TA 1R7OA 1UD8A 1V6UA 1R87A 2E9LA 5IXEA 5DF0A 1PIFA 1HM2A 2WW5A 2DEPA 1V3LA 1HL9A 3VO0A 2XIBA 3VX1A 4TUFA 2WCGA 3GH4A 4X0NA 3FXYA 4CCEA 2VRJA 2WMIA 5M17A 1TVNA 2XVKA 2WVUA 1C8YA 1TG7A 3SCTA 4OJYA 1BG4A 2X0YA 3PZOA 1H49A 1E9LA 3AMKA 4W89A 1KQYA 2XPKA 4TVDA 1CTNA 8CGTA 2E9MA 4LQ1A 2ZUWA 2G8ZA 2OYLA 2FHBA 2YBUA 4UZSA 2XVGA 4AD1A 1LXKA 1W9PA 1FFQA 2UWFA 4PSPA 2ZXAA 4AZIA 5ABFB 1BQCA 5DMYA 3SCPA 3ARVA 2GSJA 3OZOA 3AXIA 4BQ3A 2WVTA 1AQMA 3OLIA 1VIWA 1NWRA 5BXRA 4PMDA 2BXYA 4JFTA 4M81A 3VTRA 2BRVX 1HXJA 2HISA 1NQ6A 1XGZA 1OIFA 2C0HA 4BCEA 4MJ4A 3W24A 2A3BA 2ZUMA 1X1NA 1BYDA 2E24A 2CIPA 3DYPA 2YDQA 3QHMA 1NWTA 3NSXA 1LJYA 2BFGA 3KL3A 3SIMA 3A47A 4ATWA 4FLSA 4CUCA 5IHRA 4KGJA 2CHNA 1Q4NX 1BGGA 4P8UA 2V38A 4ZXLA 4DWSA 1M04A 1EA9C 2XWEA 4JAWA 1V3MA 5IFPA 1GOQA 5DT5A 3VM5A 1KQZA 4D6GA 4TVCA 1OM0A 1K9DA 1ZL1A 3IJ8A 2XHYA 2OSWA 2O9PA 4IM4A 2D22A 1W2PA 3AOFA 2PWGA 1TUXA 4W86A 2DIJA 1ZBVA 1FHDA 3PZNA 3WQ4A 2WHJA 5KZ6A 2VL4A 3CLWA 1OT2A 4FLQA 1EO7A 1PX4A 2DSUA 4ACZA 3K8MA 1RP9A 2D0HA 3IJ9A 2VX7A 5M03A 4MTVA 1V0MA 2WWCA 5HPCA 1GQJA 1KXVA 1XD1A 1R8LA 3ZSSA 1BVNP 3OA5A 5CPSA 1B90A 2EPMX 1Q6FA 3ZT5A 3N12A 3WMCA 3F5KA 5M5DA 5KEZA 2A3CA 1J0YA 2DT0A 1ODUA 1E71M 3VIHA 2CPUA 4UQEA 4CD6A 1FOBA 2JIWA 1TFVA 1H4PA 2J7CA 2CERA 3SCVA 4JCLA 3WD4A 5D8ZA 1HKKA 4AZHA 4W8AA 2C8NA 1UR0A 3AYRA 5HBFA 4JKMA 3BMVA 4MPKA 2BRPA 5M3WA 1W1YA 4J3VA 1PX3A 3A4WA 3L4VA 2CKRA 3WFLA 2PBGA 4WSJA 3SURA 4J3WA 2F2HA 2J75A 3BLPX 4PMXA 2YA1A 2WCOA 3DECA 1CLVA 2OYMA 1KR0A 5HPOA 4ZE4A 1ESWA 5DO8A 3L4XA 3BAKA 3K1DA 4AZCA 2J25A 3WQ8A 4D6DA 3PZGA 3PTQA 1KXHA 3LPPA 4MJ2A 4MB5A 5CXPA 1H0IA 5CSYA 1QW8A 3WDHA 1MFVA 2VOTA 3PN8A 1UHVA 3PTKA 4F8XA 1VJSA 5AY7A 2F61A 1G5AA 2Z1SA 1B2YA 3SUSA 4GXPA 3ZIZA 3IK2A 5EBAA 2WK2A 5I79A 5JUVA 2JALA 4RL3A 2CBJA 2J7GA 3B9DA 3CBWA 3A4AA 1FHLA 1HMUA 1DTUA 3RJXA 2ZUTA 5A69A 2W92A 1GQLA 2CYGA 1E6PA 3WD2A 4HZ7A 3VIMA 2BY3A 2V3DA 1G94A 3CUGA 4P8WA 1IV8A 4YN5A 3ZO9A 1OIMA 3WUEA 3W26A 4W93A 1CLXA 2QMKA 3FY1A 2DSWA 1UUQA 2ZWYA 1UH4A 3FHQA 3EMQA 4WF7A 1QNRA 2CBUA 2TAAA 1CB8A 1PPIA 1GW1A 3VIOA 2WMIB 4AIUA 1NH6A 5D8WA 4J28A 3W6MA 1NOUA 4JZ5A 3AYSA 1VEPA 2OLHA 4AW7A 4B15A 2DQXA 1UD4A 3SUTA 5A8NA 4R5EA 2O9TA 3OIHA 3VD9A 3WNKA 2J4GA 4W84A 3WH8A 1NP2A 1O6IA 5EFFA 3CMJA 3VNZA 3WQ5A 2ZX6A 1ITXA 5A94A 3AI0A 4PMVA 3VX0A 3THDA 2W66A 2VX5A 2BNJA 4PEEA 2VZTA 3TTSA 1JNEA 4PSRA 1EIBA 1HJXA 1MQPA 4M56A 5E0FA 1D2KA 4E8DA 2FDMA 2ZUVA 2EBNA 1UZ1A 4J7RA 3SCRA 2AAAA 2DT3A 4HMCA 2D3LA 4D6JA 3WMBA 1ZJAA 1UG6A 1XD0A 4U31A 4W85A 2GJXA 3VMPA 3CGTA 1BHGA 4PMQA 3UR7A 1HM3A 4WKHA 4E2OA 1Q6EA 3I3EA 4U2ZA 1JI1A 1XC6A 4PCTA 2VT0A 1WZKA 3GTNA 5AC5A 1N82A 5JIWA 2DDXA 4D71A 4Z2KA 3WEZA 4AZ7A 3WD3A 1QVBA 2EPNA 1WNOA 1TE1A 3CZGA 3AIQA 4K68A 2YKKA 1WP6A 1EOMA 2Z1KA 3O6AA 2WC7A 1G1YA 1UWIA 2X09A 1UKOA 1WZMA 4JL1A 3RCNA 4HZ6A 1D7FA 1EO5A 3M7SA 4XZWA 4AIOA 4A4AA 4JL2A 3KEHA 5D9OA 2WHLA 3UEQA 2DSVA 3RMEA 4UOJA 2E22A 3ZJ8A 3ZQ9A 5I3DA 1UOKA 2RGMA 4CD4A 3AMCA 2XTKA 1Q6GA 2WMFA 5FL0A 4ML4A 3T0BA 1HJSA 7TAAA 3RM9A 3WKZA 1JIBA 4TOQA 1J10A 4ACZB 3K4AA 4MDOA 1HKIA 4ZXOA 1JXKA 1JL8A 3AS2A 1GOMA 2CBVA 1QNOA 3T2OA 3W4RA 3HJEA 3QHOA 2XM1A 4U33A 3AHTA 6CGTA 1F4AA 3TTOA 1R86A 5AYBA 4F79A 3WL0A 3G6MA 2ZX9A 4D1IA 4P7LA 2BVYA 3UESA 3WEOA 4D1JA 1QPKA 5E9AA 1WZAA 3WF3A 4D72A 1JD9A 1QI2A 3SCWA 2BXZA 1YHTA 1PEZA 4CVUA 1NWSA 3GXIA 1QW9A 2NSXA 2BHYA 3AXHA 1E40A 3VU2A 4B16A 1YQ2A 1C7SA 3K46A 1OJPA 5CLTA 2Y8KA 4W7WA 7CGTA 4LX4A 1PZ3A 4ZFMA 2VZOA 1VFOA 3ZT6A 1SMAA 4GZEA 2WHKA 4E4PA 1C7TA 3BC9A 1UR1A 4YPJA 1QHZA 3BCDA 4XUYA 5A8OA 3O9NA 4R27A 1UKQA 5HOSA 4CU7A 4GI6A 4J3TA 4AZCB 3WF0A 3POHA 2YDRA 4KMQA 2QF8A 3POCA 4QLJA 1UD3A 6TAAA 8A3HA 4YHGA 3VIIA 2W61A 1QHOA 1DWGM 2WVVA 3TOPA 3K8KA 1XCXA 3TA9A 4LGXA 4HA4A 4UCFA 3BMWA 5GNZA 1MW1A 3T2QA 1X6LA 3NSMA 2WC4A 5EB8A 4FLOA 5E6ZA 1LQ0A 3KE0A 2UY5A 1EQCA 2BVDA 4NRRA 2BY1A 3MMWA 4UQDA 2G41A 1LF1A 1I1XA 2WHMA 1VFUA 4UFLA 3MV11 4S3KA 1V02A 1RWGA 1UWTA 4HTYA 2Q8XA 4EE9A 3GNOA 3WQWA 1XH0A 5CGTA 5FL1A 3CZKA 3BAIA 1W9XA 1LG1A 2DSZA 2G3MA 3MU7A 4PTMA 1ZS2A 1P6WA 1A47A 2WB5A 3WDRA 2FHCA 2O92A 3ARSA 4CU8A 3J7HA 3VGDA 3GXDA 2X03A 2CHOA 2FHFA 1EQPA 1KFWA 1KGXA 5I2UA 2WCAA 3OGVA 4L4PA 2G3IA 1CEOA 1AVAA 2BV9A 3PZVA 1BTCA 1UH3A 4Q7NA 2YLLA 1GONA 4X0VA 4PUEA 1KGWA 3MUZ1 5D9MA 1EDGA 4JFVA 1CGYA 1OBAA 3NSNA 4F66A 1UWRA 3II1A 1GOWA 3PZ9A 4IPNB 4OBRA 5C8BB 1PBGA 5BRPA 5BYWA 2AMGA 3GXMA 2WCSA 4AMCA 3MV01 2UY4A 3PZIA 3GH7A 1MQQA 3GNPA 2JIEA 2AOSA 1U30A 5A6AA 4Q22A 3PTMA 2DIEA 1G0CA 5A6LA 5E09A 3A4XA 4M8UA 2WLZA 3VKKA 3VM7A 4HU8A 4U5IA 2GJXB 3HMCA 3MKKA 3CMGA 3OZPA 2XIIA 1W9DM 3VDAA 2XGIA 1M53A 4KWUA 3D3AA 2GDUA 3AIUA 1JYVA 1OT1A 3EDDA 3W25A 1UR8A 2QPSA 1VFFA 3BGAA 1GHSA 4BQ5A 1AQHA 4P7RA 2D0FA 2EPLX 5I6SA 4W5ZA 3WENA 5CPQA 5FD0A 5CPTA 3AHXA 1QNPA 1LWHA 3S2CA 3MSGA 4NSBA 3AHYA 1GUVA 4AZ5A 3T08A 3SUUA 4U5KA 1N7OA 1V6XA 1Q6DA 3PBGA 4M80A 2D20A 1RPKA 1JXJA 1GJWA 2WM0A 1CXIA 4ACYA 3VGGA 1UA3A 2D0GA 3M07A 4PTWA 4BZYA 1FH9A 1E6RA 4P8XA 2D2OA 3ARXA 2FH6A 1E4MM
chains in the Genus database with same CATH superfamily
1OGGA 2NT0A 3NM3A 1CT5A 1A5MC 1CXKA 3ITCA 3KAOA 4DYEA 1UH2A 3W27A 4P7QA 2WBKA 5HJXA 1KFKA 2G4FA 3NOEA 3VD3A 3SR7A 1U83A 4DYKA 1D7KA 4C6BA 1YRRA 4IMAA 3NYZA 4LCRA 4M24A 3O0KA 3TYCA 3MSDA 1RH9A 3V0UA 3NPWA 3MA8A 2R94A 3B8SA 2OWXA 5LYRA 4FHAA 3Q58A 4ZENA 3RN6A 3U8GA 2J9XA 3TC7A 3PJWA 3ZR5A 3KDNA 3MP3A 8TIMA 3MY9A 1WZLA 3LTYA 3CHVA 1TWSA 3E0FA 5I3HA 4HJWA 1G69A 1JZ6A 1WAUA 2DU2A 3W82A 2VZKB 1FH8A 3N11A 1UZHA 1PVNA 1KM2A 1TQXA 2P1FA 4GINA 3KZPA 3EKLA 4DJDA 5C71A 4JXCA 4MKVA 4PMUA 2NUXA 1JFXA 1XRTA 2YCLB 3W75A 2JGYA 3SUVA 1EDQA 2QEZA 1R46A 5L9FA 1IGSA 3WLSA 4JGDA 1FBAA 1UUOA 4GE8A 3ANYA 3RG6A 1P5BA 3ZJKA 1UROA 3W7NA 1JPHA 1GVYA 3DI0A 4UR8A 2VENA 4PMYA 3JZEA 2W67A 4H3DA 4JTCA 3NPXA 4HCHA 2FZBA 3TU9A 1OG0A 2HEJA 1X97A 1L9WA 4WSKA 3AAMA 1W3NA 1TWZA 4URIA 3E2VA 4HSHA 2J78A 3F03K 1QNQA 3QOMA 1RD6A 2XFYA 3U2ZA 3WLRA 4MLRA 1ZBCA 4DWSC 3N6QA 2V3EA 4HOXA 4PUDA 3M1ZA 4I7WA 3VMOA 2JKAA 2VCAA 2VC5A 3K4DA 1E56A 3H70A 3OP2A 2J8TA 5HDRA 4EPKA 1WDPA 5AYIA 4C5YA 4FNQA 3EOEA 2EPKX 1VBUA 2BOEX 3MHGA 2Y1HA 2E5DA 2IMRA 3L4ZA 2Y6ZA 1M3UA 3N2OA 1J2WA 2JEPA 2QXWA 1F7BA 1OFEA 2DZXA 3I7SA 2CZ5A 5LA0A 3F4WA 3CZ8A 2E0PA 4JTGA 1W3JA 4LUTA 4WIWA 1B3WA 4AY1A 1FP8A 2RKXA 1E5NA 4JFWA 1E4NA 3FHAA 4HSOA 3FEQA 4ZODA 3UY8A 5TQLA 3USZA 1LL6A 3RFAA 3H55A 2V68A 3EKGA 5FF0A 3MUIA 5D32A 3I7QA 4J2PA 4B5UA 4OWGA 5H1WA 4OHQA 1W0MA 5GJMA 3GRIA 1DHKA 3CNYA 1A5BA 3CQ0A 4JX5A 4UBPC 1W2VA 4MHBA 1JGIA 3EOOA 1TTQA 2R1PA 3AMGA 5I23A 1BKSA 4AQLA 1EB3A 4LYPA 1XSJA 4FOJA 2Z29A 5A2BA 1LLZA 4FOKA 3C2RA 1UR9A 4RXGA 3QGKC 4AEFA 4GQBA 2FTYA 1QK0A 1J0NA 2PGEA 3WH5A 4FNSA 1KV8A 3BLEA 3EEZA 4I3GA 2ZDRA 3QC0A 1V02E 3WFZA 4QSHA 3TLLA 1CXLA 1KB3A 1EOKA 2VFHA 2G4JA 3GR4A 3PR2A 3W76A 4FXRA 3GU9A 3NQ7A 3H2NA 4HYVA 3NQGA 2VD9A 3MBFA 2DVUA 2NV9A 4O28A 1H5YA 2AL1A 3B8DA 3CHFA 2YBTA 3WK1A 3DGRA 2EEXA 5FJRA 2HVMA 4CEXC 2CLHA 1DP0A 3SY5A 4ROQA 3SRHA 5E9XA 1J0KA 4IPIA 1QCWA 3CPUA 4UR7A 1WDDA 1TWWA 2CLEA 1E3XA 1PB0A 5CPNA 1FWRA 4Z1YA 4F2TA 1DQUA 1XBXA 2AQVA 2O55A 4GUFA 4ATDA 4RUBA 3VI2A 3W71A 3LPOA 5LIKX 1O66A 2HK1A 3N9KA 4ZQNA 4ZO6A 4PR4A 4S3AA 4XZBA 5LIYX 1R3SA 1TPFA 1XL9A 4CCDA 3FKRA 4ZOBA 3KS6A 4X2PA 1SJAA 3KDOA 3N19B 5BRQA 5DRIA 4HT3A 1BLIA 5CBIA 3OZYA 1S1PA 4CGTA 5IOBA 4C6QA 1XS2A 3LXCA 3GBEA 4Q4QA 4MUZA 5F2IA 1XPYA 2GSHA 2CZVA 2Q3RA 3FSTA 1UWSA 1JPMA 3RRXA 3MP5A 1R3TA 1NDWA 4HOWA 3IGUA 3N4FA 3LSBA 3WLKX 4UFKA 5JBFA 1G7UA 4JIEA 3GR7A 4KIEA 4IISA 1EHAA 1T8QA 3V75A 3UXLA 2HS8A 1QRQA 3OBAA 2E8ZA 4EXAA 1H60A 2CBIA 4XK2A 3AIBA 4UZUA 2A79A 1AMYA 1S2VA 2YJQA 1RQHA 2G37A 3CQIA 1RA5A 3W7LA 4CQBA 1DKWA 3BANA 1JUEA 1KTNA 1U5HA 4HHMA 4IUOA 4V27A 4NHVA 1TO3A 1PIIA 1YTDA 4M5PA 4GNVA 3G8RA 5JH1A 3SDOA 1MZRA 3F4VA 1ZUAX 1R7AA 1RCXB 3WELA 1K9EA 5K9DA 1XIHA 3TYUA 3ZWSA 2TYSA 4LUTB 1JG9A 2OZTA 1UWUA 1GZJA 4HA0A 4GHRA 5G1YA 4CLMA 3ITXA 2NWRA 2ZE0A 5FJJA 3AYVA 1F4HA 3R58A 2NLIA 4F0RA 3CWHA 4UUIA 3PQIA 4XZNX 1HVXA 1ZBKA 1V0KA 1FDYA 4OBSA 1Q63A 4FK9A 5AHEA 2PDGA 3LRLA 2VXNA 3UA3A 3MUAA 1BVWA 4PRWA 5DMMA 3A13A 2OEKA 1X7FA 3QHNA 4I8DA 3K8LA 1CXFA 4QRNA 4HN4A 3VZXA 1U1UA 1BQGA 3BZJA 3VFLA 2C15A 1KCLA 3W37A 1JZ5A 4HU4A 1OK6A 3PNZA 2QIIA 4CD5A 3U7BA 3F5JA 1EX5A 3ISIX 2PDNA 5G1TA 3LPFA 1MSSA 2OQHA 1F07A 1CGXA 2V3FA 3UG8A 1RWFA 3MDWA 3PUGA 5EMKA 4UQBA 3QEZA 3R25A 4GC4A 3W2MA 4BFAA 3T07A 4C6EA 3EWWA 4DWDA 3STEA 2DT1A 1EDTA 1TX2A 2ALDA 2Z4GA 1VB9A 4HZ8A 3QR1A 1R3VA 1KFEA 2V5KA 3MO4A 1B3XA 1SJBA 4TO8A 1Q13A 3AZTA 2ZVIA 4AX6A 2INZA 1BEUA 1TA3B 2J47A 3C3NA 3TAKA 4AB4A 1LORA 4M19A 1DL3A 1IIHA 3VIFA 1T5AA 3NM1A 3ZOAA 4H9TA 4L56A 2XUCA 5D09A 3IARA 3UFYA 3DENA 1GCYA 3DYOA 1SZRA 1UR2A 4UTFA 4H6EA 1OFBA 3BCJA 1QI5A 4JHMA 3DFYA 3KCJA 4E4FA 2W79A 4NP7A 5I77A 1CYGA 2F8QA 1A4LA 3ZZ1A 1AL7A 1W3KA 1VKFA 3ARUA 1WAWA 3LQGA 3SCNA 4A05A 4U4MA 4V28A 4Z0SA 1Q7ZA 3WX7A 4FO4A 3B97A 2YW3A 2BY0A 2J7FA 5IDIA 3W29A 3UP8A 3IAPA 2MANA 2NQ5A 1E0XA 1ADOA 1FCUA 2WXDM 2AKZA 2XIMA 3HQOA 1QBAA 5TBOA 3NEHA 4IPLA 4L7ZA 1KXTA 3WMSA 3GC2A 1F3WA 3PHAA 2DSKA 1NWUA 2E5BA 3FW6A 3WK2A 2P10A 2E9BA 3O2LA 1S3HA 3OGRA 4AYSA 4R3UA 2Q01A 1HL8A 3HURA 1V7YA 4IUGA 1RXOB 3QV6A 4E5TA 2PP1A 4N0RA 4QDPA 3VD5A 3T0DA 2CEQA 1NIUA 2RHGA 3QV8A 4IOTA 3MHFA 4DI9A 1OZQA 4JIRA 3HGSA 4O54A 3W2JA 3TFXA 1C9WA 1LT8A 3P5ZA 4NUWA 4ZQMA 3WK0A 3VGBA 3FNDA 4GUIA 3DG6A 1ISVA 3CV2A 3E2SA 1UR4A 3NUKA 4AHPA 3ARZA 2QUVA 3OBKA 1XM3A 4JKLA 2R91A 2WVSA 4O1BA 3GFXA 1HX0A 4Q8MA 3N13A 3NL3A 2OVLA 5CGQA 1IEIA 3SCUA 1LLOA 1WQ5A 3CHCA 3APGA 3EWZA 4GKTA 1BSLA 3HG3A 3UPMA 3MW7A 3UJSA 1J0JA 3K30A 2J8GA 4WGHA 4C6LA 1TPH1 2PB1A 1Z7AA 3E6EA 3NEVA 1RV8A 3IIVA 4O0QA 1C8XA 1Y5VA 3E3HA 3VVGA 1UP3A 3OQ8A 4AMAA 4LALA 4AZ6A 1I1WA 2HWGA 4PODA 1V6VA 1E15A 3BXWA 1H62A 2PRLA 4MM1A 1F1SA 1HKJA 1OSEA 1EXPA 1S5MA 4WY0B 3M5VA 3NXLA 3C2EA 1O95A 2G3NA 1HIZA 3W73A 1Q2RA 1RK6A 4HZMA 1XLHA 1Z41A 4DLMA 3B8IA 4LEQA 4LJ3A 1PS9A 4Z2HA 1TMQA 2Z6IA 1P0NA 1VLWA 4IJCA 4WXYA 2VX4A 1W32A 1DWFM 3RGTA 2QJIA 3XISA 3PB0A 2E8YA 3WDIA 2H3DA 3ABRA 3WDJA 3W1AA 3HG4A 2J7EA 4O10A 4M7TA 1U1HA 4ERGA 1RY8A 3IIOA 4RDYA 4Y9AA 1S5NA 1IEWA 3LHWA 3EDFA 2J6XA 3HPAA 1W3YA 3O3RA 4JOMA 1A5UA 3RU8X 2V5CA 4ZO8A 3YPIA 1E6ZA 2V5DA 2PD5A 3TK7A 4B2DA 3CIWA 4HYRA 1SFSA 3HU7A 4D6IA 2NLYA 5CBBA 3HQPA 3W2UA 4DUWA 1H5VA 2F6XA 2WLYA 1FXPA 1G7VA 4QP0A 1B1YA 3P93A 1TTIA 3A9IA 5CG0A 5MF5A 3CYVA 1MZHA 3BAYA 3TJXA 1A53A 4HKPA 2OWWA 4M1BA 2WZIA 2YXGA 3LOTA 5BWFA 3TV8A 4GFSA 3CH0A 5HNTA 4DBDA 4C6PA 3H2AA 4OUEA 3TYBA 1K1DA 2BHUA 1ZSXA 3LTSA 2W4XA 1ZJHA 1GVSA 2GWNA 2J88A 2J9YA 4GQGA 3SQMA 2D2HA 4TTUA 1XHGA 1WO2A 3EX1A 2GL5A 3UWVA 4GBUA 1OYAA 1GOXA 4WZHA 2WQPA 3ERPA 4H2HA 1E6SM 1DJGA 1SFJA 3WIJA 2WM1A 1OD0A 5JMUA 4MNKA 4AC1X 2D2JA 1W1VA 1EWEA 3AIWA 1K9FA 3UGVA 3GDBA 3S83A 3PBUA 1YNQA 2WDAA 2ZUNA 4QG9A 4A6GA 1SJCA 3KLKA 3WNLA 1JF6A 1K4GA 1JF5A 1UQZA 1HJQA 1K02A 4H9ZA 3WJSA 1HTIA 2VFEA 3IGSA 4QTGA 4YVVA 2QCHA 3VMNA 2QIWA 3PS7A 3Q4DA 4UNIA 1EF3A 1JZ7A 2WMGA 3TN4A 4Z2GA 3TJIA 4XZ9A 1AUSL 1IEVA 3SUWA 3NDYA 3WF2A 1E9YB 4QE4A 1XLBA 1BG9A 4DXKA 2WZEA 3L4TA 3DFOA 1GK8A 2OCZA 4KWSA 3MMDA 3VCNA 2X2YA 3LV6A 4Z1DA 1K03A 4LC6A 3L21A 1L6WA 4JBRA 1XKYA 3TN3A 3QGVA 4Z08A 5CLWA 5D2TA 1S2TA 4HCLA 3WQPA 4JDBA 2Z1BA 3WL1A 2FTWA 3S6DA 3IAQA 3VD7A 2HTMA 3HM7A 1VH7A 3IUHA 5E1QA 3MUXA 3QLLA 2XIQA 5LHEA 4N2YA 4W88A 4NZ4A 3BURA 2DPEA 1Z9AA 3JUGA 1LL7A 1DXEA 2J24A 1JNDA 1YADA 3WQOA 3NL6A 1GZGA 2WO5A 1AJ2A 3GDMA 5EMYA 3G1AA 3HO8A 1TVPA 2CZDA 2H6RA 3S46A 3C2FA 2JF7A 5D04C 1FDJA 4JTRA 3FIGA 3IT6B 2EHHA 1DBTA 4K7YA 3BAXA 2Z00A 3AROA 1GVOA 3AZSA 2J77A 2PF0A 3TROA 4CQCA 4L6DA 1X8CA 5FACA 4D6CA 3BAWA 4W4QA 3CO8A 4IFKA 1ZP4A 4G1NA 2VM8A 3OVGA 2OX1A 3GZ3A 1MMFA 1Q8JA 1KTCA 1K6AA 2WJFA 1MQRA 5IXEA 1RJPA 4IP7A 2XIBA 1X98A 3CPRA 1YIXA 1HO4A 1M6JA 4NG3A 3FXYA 3QV7A 3VFCA 3O0FA 1S1RA 2QR6A 5M17A 1US0A 2XVKA 1H7PA 2WVUA 3IUIA 3SCTA 2FB3A 2WSRA 3KBNA 4TQTA 1R0MA 1YBQA 1E9LA 4W89A 2XPKA 1OYCA 2OODA 6XIAA 3RK8A 1CTNA 8CGTA 4LQ1A 2OYLA 4RKAA 4C6JA 2YBUA 4UZSA 4E4UA 3QPZA 3RX3A 5H91A 3UZ5A 2ZADA 4GIEA 2PD9A 5LGZA 2OEMA 3UWUA 2PCQA 4X61A 4KEVA 4HNVA 5I02A 3ZVHA 4KKXA 1Q66A 2ZRUA 1NFGA 3W9ZA 1YNYA 1S2WA 2GGJA 3FVMA 3OZOA 1LOQA 4BQ3A 2WVTA 1OADA 5C5YA 2WSQA 1NWRA 4IQDA 3V3WA 5BXRA 3GX9A 3LERA 2YYTA 4QDWA 4H6RA 3NQFA 2Y7GA 1HXJA 1OIFA 1PKLA 4IZGA 1W31A 4BCEA 2ZUMA 1Y0EA 4PA8A 1BYDA 2RDWA 4DZIA 5T26A 4TX9A 4RNJA 4EF9A 1LJYA 3A47A 3M0KA 4CUCA 4GY0A 4KGJA 4DWSA 1M04A 4GXWA 1Z3NA 2XWEA 1OCNA 2ZFAA 1GOQA 2Y0FA 4XG1A 2C1GA 4E6MA 4D6GA 4TVCA 4I90A 2P53A 3IJ8A 4OV9A 1KW1A 2PDLA 2OSWA 1DQXA 4D8OA 3GAKA 1TUXA 3IEBA 1KFBA 1ZBVA 2NUYA 1GVQA 2NV1A 2Y7DA 4GIYA 2QPXA 3CLWA 3IJ6A 1OT2A 4FLQA 4ACZA 4AXKA 3K8MA 1RP9A 3AWOA 3IJ9A 2CLIA 3EAUA 4R34A 2I7GA 1KKOA 1XD1A 3T0TA 1R8LA 2XH4A 1PUDA 1Q6FA 3ZT5A 3HQ1A 3N12A 4RPQA 2DZPA 3QQ1A 2ZE3A 1F3EA 3DC8A 2B0MA 3JU2A 1BF6A 1L2QA 5I09A 3PUDA 3KVKA 2JQXA 4HCDA 1TV3A 3LDVA 4CD6A 1FOBA 2JIWA 3K1GA 3V1HA 4LU0A 2C13A 2J7CA 6REQA 3IVUA 4JTHA 3QKEA 4AZHA 1UR0A 3ITVA 3FYPA 3QMTA 3RMJA 3A4WA 2CLKA 2C3ZA 2NUWA 2CLOA 4N9EA 3ONBA 3LEPA 3SURA 3EXRA 4GIRA 3KTSA 2WCOA 2DV0A 1ZALA 2OYMA 3QBUA 3UYCA 5HPOA 4HK7A 5JQ9A 1ESWA 5DO8A 4DELA 1KM6A 1PTGA 3SBFA 4KT2A 3W1MA 3K1DA 2CZEA 2PLCA 2A7NA 3WQ8A 1RY0A 4D6DA 1TSIA 4K8HA 1D8WA 3B0VC 1QW8A 3UZWA 3TN6A 4RZ6A 4MJZA 2PMQA 1XI3A 1KM4A 2P3ZA 3UY7A 4GACA 2Z1SA 2IKIA 4JTEA 2WK2A 2Z1WA 4NXSA 4XQ6A 1DTNA 1R2TA 3A4AA 1DTUA 2FYMA 1R6WA 1QXLA 1X7IA 5FF2A 1D3HA 4WGXA 1GQLA 3G1RA 3RPTA 3WD2A 3CC1A 3VIMA 3CUGA 1FUYA 4NAFA 1MNSA 1IEQA 1R9XA 1OIMA 3WUEA 3W26A 3BICA 4HHHA 3ZVIA 4GJIA 5DXYA 4YWIA 2ZWYA 1UH4A 1SZNA 4MY1A 4WF7A 3APTA 1QNRA 3SQSA 3QSRA 3PWAA 3VCRA 3TJ4A 3TSDA 1VS1A 1XINA 1XLIA 1NH6A 4NIRA 2YBVA 3M0LA 1IF2A 3DHDA 4Q4SA 4IFRA 4B15A 4AW7A 3KWSA 2E67A 3G1HA 1YBQB 1O12A 2O9TA 3OIHA 3WNKA 2J4GA 1O6IA 1W5QA 1NQKA 4IIFA 3DBNA 3O06A 4QQUA 5A94A 3HFTA 2VEPA 3HG2A 2BB0A 3CV1A 1YTEA 3FEMA 1K8XA 3ZVHB 4M56A 1B4EA 3UPBA 2FDMA 3FK4A 4RNIA 2HJPA 4J7RA 2EBNA 1JCNA 3WMBA 2A85A 3MDUA 2Z1XA 4REQB 1MRAA 3CGTA 4O1AA 2TRSA 3OA3A 1V51A 3QY6A 1Q6EA 5K7JA 1FWAC 1JI1A 5HATA 1XBZA 1U5VA 2JGQA 1E0TA 3UQNA 4FXSA 1XLCA 3EEGA 3GTNA 3VNJA 5HAOA 1N82A 3TOYA 3WEZA 2BGQA 2G3FA 3IRSA 2FTPA 3S9YA 3L9CA 2ZA3A 1NELA 2WC7A 2X09A 1WZMA 2X16A 4L9XA 1J5TA 4H83A 4XZWA 4PBFA 3DFSA 4Q3MA 3EX4A 4YYFA 3R10A 4XD4A 5FF3A 3RX2A 2E22A 3ZJ8A 5I3DA 1K7FA 2QCNA 3PAJA 1RQEA 2V67A 4LH8A 4ORMA 3TR2A 1HJSA 2YCIX 7TAAA 9XIAA 4HN8A 4TOQA 4ACZB 4MDOA 1HKIA 4RJEA 1GQNA 3NPVA 3P81A 3BSMA 2V5LA 3UBPC 1ONRA 4O12A 3HJEA 4PB3A 3QFEA 3TTOA 5AYBA 3WL0A 3U9IA 1NEYA 1VPYA 3WEOA 4D1JA 3F59A 1Y5XA 4EXQA 1UPPA 5E9AA 1EP1A 1OFDA 2QJNA 2VFDA 3B0PA 4O53A 2BXZA 1Q6OA 3EX6A 4CVUA 4P2VA 1BWLA 4GQ0A 2PUZA 5F2LA 2NSXA 3K46A 1C7SA 1OJPA 1KM1A 2GVEA 4W7WA 3TUUA 4J3ZA 2GUBA 2F6KA 4MKSA 3PFMA 5AHNA 1VFOA 3ZT6A 4JTJA 1SMAA 4L6OA 4GZEA 2WHKA 1Y8BA 4HTBA 4NT0A 4R27A 3VNKA 3S42A 1UBSA 4J3TA 1BTMA 4DUOA 2PP0A 1A5CA 2YDRA 3CT2A 3FXGA 3HV9A 2P3EA 4QLJA 3IRDA 8A3HA 3T8QA 3VIIA 3MVTA 1QHOA 4C6MA 3RPDA 2WVVA 4EWND 4JX4A 4IGHA 4LGXA 5E0KA 5C54A 5GNZA 4JTKA 3VE7A 3BE7A 3NSMA 3TTEA 1LQ0A 2BP1A 3KE0A 4NZJA 2UY5A 3UWWA 2Y7EA 3MMWA 2G41A 1I1XA 3MV11 4DN1A 5LNSA 1V02A 4WJEA 1B57A 5LNRA 4GABA 3CZKA 1LG1A 2DSZA 4PTMA 4NAFB 2GQ3A 3B4UA 5CPOA 4XO6A 4QEHA 3ARSA 5HWJA 2PDUA 2ZRXA 3MP4A 1A5NC 2GQ8A 1N8FA 2HXUA 4ML9A 4DO7A 4XKMA 1KFWA 1KGXA 5I2UA 1CEOA 3TW6A 2BX7A 2L5HA 4LEFA 1QDSA 5EA9A 3ABSA 1XDJA 2PSNA 4TIMA 1O60A 3GXNA 3TNBA 1GONA 4X0VA 1KLZA 5D30A 1EDGA 1RBAA 4H4IA 1FWTA 1LRTA 3SSZA 4F66A 1I2QA 4MMWA 3LBCA 1EP3A 1PBGA 5BYWA 2WCSA 3LMZA 4YMZA 2XIJA 4DVOA 1MQQA 3THAA 3IGHX 3WBXA 2QVNA 3NGFA 1G0CA 4QNWA 1XDLA 4UTKA 3VKKA 1F8MA 4GWEA 2QCDB 3UWQA 4YNGA 2XIIA 4A22A 3D3AA 1UC5A 1OT1A 3O1NA 3W25A 1VC4A 1GHSA 4P7RA 3GO2A 4W5ZA 3H23A 5CPTA 3AHXA 2TMDA 3S1VA 3S5NA 4US5D 3I65A 1N7OA 4IF2A 3RU6A 1EZ2A 2DUZA 4H9XA 3SSJA 1VHCA 4ZTYA 1TJ2A 4JEJA 1FH9A 2GDQA 1E6RA 4XISA 3WK3A 3EOLA 2B31A 3NXFA 4HHPA 5M1TA 2X1TA 1J01A 3KOXA 2TPSA 3VIPA 4DBSA 2BXVA 5G4EA 3UNTA 2J8FA 3LCIA 4BI5A 1CXEA 3DFHA 2OEJA 3V16A 3QXBA 3M5XA 5FSEC 5LZLA 2VWTA 5I24A 1GVEA 3ITOA 4Y96A 1DIOA 3W2NA 1KM3A 4JY9A 5GNYA 3AIRA 1PDZA 4A3HA 4RNFA 1W1A1 2IPJA 4CNTA 4H7ZA 2ZX5A 3GYEA 5JXQA 4H00A 2X1RA 1GJPA 1OWQA 4O1CA 5G5IA 3RHGA 4H6QA 4MUPA 3CHDA 1XLAA 4DJFD 4QSFA 4LAMA 2XM2A 4ES4A 3T2PA 5A6JA 2A3AA 4PZVA 2VZSA 2R6OA 2AGKA 3SJNA 1JI2A 3M0VA 3WQDA 3H4WA 2C7FA 3GBDA 3PF3A 2O9RA 1XYZA 2X41A 4FXFA 2DORA 5F4XA 3QYSA 3H53A 3LHYA 3GS6A 5K4ZA 1MEIA 4UFHA 5DCDA 4AD3A 3LTPA 2WVVB 4XTDA 4Q8QA 1NP0A 1LUCA 3MZNA 4AF0A 2PPGA 5EL1A 4J3SA 1FX6A 3EMCA 4IMFA 1CIUA 2ZX8A 4J3XA 2CNCA 1SR0A 4S2CA 2V69A 2P76A 3HB9A 1FWHC 5D37A 3DI1A 3PUOA 4LUIA 3HQNA 1LL4A 2PDQA 2Y70A 3PTDA 3P8JA 1EH9A 2OG9A 3RLVA 2YL9A 2YL6A 3BK0A 3S6TA 3FAXA 4X63A 3VKAA 1RA0A 1XGDA 3REQA 1TREA 4EKJA 2VZVA 1H51A 3GZAA 5HUOA 1R85A 4B9ZA 3TH6A 1AZ1A 1WX0A 1OG6A 4PMRA 1DPMA 4MNLA 1PV8A 4R9OA 4WEVX 1ENUA 1CGUA 5HINA 2A0NA 1V08A 5C2XA 2C19A 4NX5A 5I3FA 3CAQA 4V2XA 3RPMA 2INFA 1AH3A 1N7KA 6XIMA 4OFCA 4BI7A 4AD2A 1E0UA 2ICSA 3O63A 4FF5A 2XGZA 1RK5A 4UNLA 1W1B1 1ZBWA 1QNSA 3W6YA 3MS8A 3QTGA 1JQVA 3SFWA 3VGFA 1EL3A 4EAMA 5CGMA 4S23A 1ZB5A 2IXVA 1ZPTA 3LPGA 4DAFA 4N7QA 1FA2A 1JD7A 2D23A 4H04A 2G97A 1NU5A 2FGZA 1DXFA 3LUTA 4S2BA 1FFRA 2HVOA 2NQZA 4L80A 3LXBA 4G6CA 1DIDA 1E0VA 1RBOB 2ZXBA 3B9EA 5BU6A 3CHEA 4W8BA 3UCDA 1V3KA 1KM0A 4RK8A 2PZNA 3ARTA 4J9JA 3M43A 3W88A 4IGSA 1KC7A 3GNRA 3MQTA 4O18A 3WLLA 4DHGA 3URBA 5BCAA 3N34A 5AKQA 5BNKA 2CC0A 2R1LA 4NRSA 1OJOA 2Q71A 3IJIA 1H11A 5J5RA 3URNA 1G01A 4B3ZA 4H7VA 3WUFA 1JCMP 3N04A 1DORA 2DZVA 3HBLA 1DWIM 4Z42C 3CQKA 1PKNA 3I3DA 5HMEA 1U5JA 1VZWA 3DU0A 4P5UA 5AC8A 4HP5A 2MNRA 4WLCA 4O8AA 4TMBA 3KX6A 1UP2A 2V2CA 3OBEA 3UETA 4Z0JA 5CZKA 4RE0A 5E93A 3DERA 2Q02A 1UB3A 1UOZA 2R82A 3E1F1 3LZ5A 1TX0A 5HMSA 3F5LA 3B0UX 1L8NA 1C3FA 3PM6A 2O4QA 5G2HA 1YNPA 1ZU8A 3B05A 2A4AA 4AX7A 1KBLA 3WUBA 1XP3A 3MPGA 1IZKA 2C0AA 2E6YA 2QJMA 3BG9A 3GVQA 3M0JA 3MJYA 5HWMA 4M3PA 2A3EA 1W9BM 2IKGA 3LZ3A 2WWDA 2I1OA 3D5HA 4GGHA 1JCXA 3UD2A 1B0IA 3ALFA 3ANVA 4PCNA 4NZCA 1GTEA 2YDSA 2O0TA 5FCZA 1UZDA 1I75A 4GMEA 3VNLA 4GY1A 4QAWA 1K7XA 1HN1A 4IXHA 1XDMA 4L61A 5E0CA 1B9BA 1AFSA 2DZTA 4YYCA 3ATZA 2Z7KA 3LX9A 4GCAA 1LUCB 3AICA 3USBA 4AF0B 4H41A 5HJLA 4H9MA 1PCWA 2CFFA 1J11A 1M7PA 4YS1A 2BZNA 2ZKMX 4UR9A 3SRKA 4JFSA 3MUCA 2VJXA 2XH7A 1QASA 2HROA 3LLFA 3CM4A 3WSUA 3FJNA 3PSWA 1VR6A 4MYXA 3BL3A 5T9CE 2V82A 3PSVA 4US6A 1XIIA 4ZB5A 1EJUC 4IG2A 3I4KA 2VR2A 1FWSA 3LM7A 4EX4A 1W9UA 1UD2A 3GHTA 4ZR8A 3AMDA 3CAWA 3R79A 4MZYA 4PB4A 3REQB 1I2PA 2V2HA 4PGLA 3H2OA 4GXMA 2XH0A 5AVNA 3RLUA 4H01A 1SW0A 1Q8AA 3WQ6A 1PZ2A 4O52A 1LLQA 1HFBA 3PZTA 1UJPA 3ANUA 4RZ5A 3W81A 3JVAA 2QHAA 3CU2A 3WNOA 1GYMA 1EC8A 1D3CA 1KWKA 2Q1FA 1WKDA 3QF0A 3MI3A 2ZUSA 1R38A 4BA0A 3UCQA 1E6XM 4HSNA 2NQHA 2FGLA 3PB2A 2QV4A 1XJBA 4RZ4A 1J9YA 1K77A 4DJFC 2CKSA 2X0HA 3I3BA 3BW2A 5K4XA 4HPGA 1XIGA 4B5TA 2D3NA 4CVWA 5EU9A 1SW7A 1KA9F 3LXAA 3RUBL 4GUHA 1ZY9A 1FHVA 3TZFA 2PDIA 4QGCA 2WOQA 4YJ5A 3RDKA 1RVKA 4I7VA 3THUA 4DEFA 1F6KA 1C92A 2CXGA 4GYFA 4CCCA 1HF6A 2FLIA 4YVPA 1O68A 4FZIA 4XB3A 4Q8OA 4WK9A 3CL6A 1WA3A 1LBLA 1XG4A 5CBJA 4YWSA 3RO8A 3OW1A 4JTDA 8XIAA 3HG5A 1XRVA 4QLKA 1FWCC 4HJFA 3WLMA 1GYNA 5K2ZA 2ZQ0A 4MB4A 5AYZA 3KBMA 4FS9A 1PYMA 3BSHA 2AKMA 3KXQA 2NXGA 1VF8A 4RV3A 1HT6A 4IXXA 4EWJA 1S2UA 1EJSC 3UG5A 3PBWA 3RILA 4CU6A 1WE5A 4W5UA 1K8CA 3BJSA 4RDWA 1V4YA 3MTWA 4W8LA 4XBKA 3STCA 3A5FA 1FHUA 4Z2JA 5DN1A 2WQDA 1UKSA 4PUUA 1QMLA 2QYGA 1LT7A 3SI9A 1AH0A 1K9TA 3DFPA 4KIRA 2YEPF 4FA3A 1TCMA 3OJGA 5KZEA 2YLAA 3EX2A 3MMUA 1CGWA 2YA2A 4Q8VA 3M41A 1B5TA 3BDKA 4OGZA 4OKDA 1MO0A 3AALA 5A6SA 1EJXC 3C86A 1VPQA 1V3IA 2WSKA 2VVSA 1OJNA 4S3DA 1DEDA 1HMWA 1B3YA 1JAKA 4PCSA 4AZBA 2XSXA 4WJXA 3V36A 1Y65A 1PCKA 1TRIA 4B5VA 1BWVA 3P2VA 3DGBA 4AWUA 3GWQA 3NZQA 2BVWA 1PWLA 3MT1A 1JZ3A 1GORA 4PYSA 3W2LA 1GG1A 3KOWA 4WDTA 2HZGA 4ERAA 5GQBA 3GY1A 1RWCA 3GIPA 2REQA 3TN5A 1VD6A 1H7OA 3APYA 1UPMB 3EBVA 1X1OA 1W9VA 4GZJA 4DXXA 1A0DA 3CAVA 3G6LA 4W87A 1E70M 3NVDA 4AXNA 2Y88A 4AC7C 1CGTA 1Q6QA 4GH3A 2NX3A 1P0BA 1EP2A 3AS3A 4J3UA 3DHUA 2EG6A 4YTQA 8RUCA 1MYRA 4C7GA 2HE5A 2AQOA 4Q8TA 4K1WA 4KH2A 2OQLA 3GD6A 3OPSA 1EYWA 2FPVA 1TZ7A 3NZRA 3W53A 1N7QA 5ABHA 5U4NA 1KR1A 4FX6M 4YHEA 2A5HA 1BAGA 1JPKA 3DCPA 3VXGA 5KZMA 1B31A 1IT0A 2J7HA 1L0PA 3HV8A 3UW6A 1J6PA 2OLAA 4UTJA 5F1VA 1J4EA 2PDMA 1Z42A 3GDKA 5BWAA 4CCZA 3UXKA 3G0SA 2PRHA 4KCTA 5LA2A 2D24A 4QHRA 2GVYA 4HD5A 1UIOA 4XBJA 3ITLA 4GI9A 4H7CA 3UU0A 4C6IA 4BF9A 3UXAA 3GU2A 1DJIA 3VINA 3UR5A 2B7NA 4PN2A 5HXMA 4GVIA 2ESCA 3WYZA 1UIPA 2ZZ2A 1QI4A 3O6DA 1QPQA 3STGA 3WZ0E 2PE4A 4ZCWA 4IH3A 1IT8A 1RSCA 2P5NA 1FQ0A 4ICNA 4PFMA 1C8VA 4N9BA 4KEMA 3BV7A 4WDUA 4Q4PA 3TC6A 1NSJA 1T8XA 1E0WA 1XYLA 5ABGA 3VIKA 1DYSA 3MO7A 1E4IA 2PURA 4S39A 5C7VA 1YDNA 2FQIA 4ZSTA 3T7VA 5REQA 4B5WA 1YYAA 2V3GA 4ZQCA 3CMFA 1HJVA 3LCLA 5EMJA 2VR4A 3LHTA 5AN7A 3EXSA 2Q8LA 1X1HA 3VOGA 3VDBA 4NU7A 1MWOA 4L4OA 4LB3A 5LIWX 1QK2A 2YGYA 2J6VA 3H7RA 3CZLA 4DF1A 3BLIA 4KRTA 3N4AA 1YLVA 1B9ZA 3WQGA 4XIMA 1WBHA 3T81A 1CLKA 1J2BA 3P7YA 1GKPA 1C9DA 2XVPA 4ZB0A 3NA8A 3DUGA 3JZUA 5GPRA 4C7FA 2XIOA 1ONEA 4AU0A 1KRMA 3C2YA 4N9CA 2PDBA 3W2KA 2G50A 3BOLA 1IWBA 3KHDA 2CW6A 3ME3A 4Z2IA 5B7ZA 2W5FA 4JFUA 3JR2A 4RW3A 5AB3A 3NZGA 3W7KA 1NOFA 1QJWA 4MLJA 2ZWZA 2VGFA 4MNMA 4DWSD 1J0ZA 1R30A 3IJLA 5IFTA 1H3GA 1EC9A 2V5BA 1YX1A 2HQAA 3AIVA 2QDEA 1CENA 4G2DA 2PWDA 2RGLA 3EWDA 4P7OA 4OQVA 2RJHA 1A5LC 1O1ZA 3T44A 3ARQA 1V6WA 5EBUA 2I56A 5DT7A 1HUVA 1B30A 3AYTA 4H8NA 3NVTA 4NF7A 5PTDA 4GBDA 3RITA 3OIXA 2QVHA 2REQB 4MADA 1I0BA 4KBXA 1VRAB 1F8IA 3G1DA 3W7JA 5EY5A 2R1NA 4C7DA 2PI6A 2EO7A 3Q94A 1YW1A 2PU1A 3CXOA 1X6NA 4W7VA 4F40A 4BF7A 3AUJA 1VQTA 2FZNA 3OO2A 2I17A 5E6YA 2PZ0A 1MI3A 1S2AA 1ME8A 2OT1A 1EUNA 1US3A 3QMRA 3PPCA 4O1DA 3GE7A 1QPNA 3QQWA 1MFUA 3L5AA 5AZ0A 4F3HA 1QWGA 2XDFA 1H2JA 3T55A 3U3HA 4DZHA 1LWJA 4QCFA 1E9IA 2ASHA 2Y8VA 3RCMA 3RR1A 3EDKA 3PZMA 3VPLA 4RV8A 5FF4A 1EEXA 3OOQA 3WUGA 1KRAC 2DFAA 3IS4A 2VEGA 2VC6A 3CJPA 1XLLA 5M2FX 4UTLA 4NNBA 3WQFA 3LRMA 2IW0A 3L4YA 1S2CA 3AJ7A 1GWJA 3S8HA 1NDYA 3AISA 3DZ1A 3ZJ6A 3V18A 3RJYA 1P0EA 5DBTA 4EVZA 4ZBCA 3UWEA 4F2BA 2WPBA 4MY9A 2Z0IA 3VIGA 4QE1A 4ZQOA 3VD4A 3V7PA 3D46A 2VRQA 4M29A 1W3HA 3RIKA 1M41A 3O05A 4XZLX 2ZC8A 4GI8A 3GSMA 3GC5A 2Q3OA 5IHSA 4LUYA 1XICA 3FAWA 2PDCA 3C2VA 1LYXA 2JFEX 3NIYA 1R7OA 1UD8A 1V6UA 1R87A 2E9LA 5DF0A 3CS2A 3TEVA 3L7RA 1HM2A 2WW5A 1V5XA 1V3LA 1HL9A 3VO0A 1FWIC 1TE6A 5DY3A 2P0IA 1E9ZB 5REQB 3S4TA 3KCLA 2VRJA 3SM0A 3H2MA 1BG4A 5CJNA 4JEQA 3QGAC 2ZZ3A 2CWNA 4LVDA 3SY8A 4K3ZA 3PZOA 1W56A 3AMKA 1I2NA 5TNVA 4MIMA 2YYUA 3SQLA 3W1XA 2E9MA 4DRSA 2ZUWA 2G8ZA 3V1PA 2FHBA 3O7UA 1K6WA 3IIPA 3H6OA 4KQNA 2XVGA 2UWFA 4DNHA 4PSPA 3FX4A 2ZXAA 4AZIA 1AW2A 3QLDA 2IKJA 3NQMA 1NY1A 4KCWA 1BQCA 1F73A 3WJWA 4DAIA 2GSJA 3QZAA 3N29A 1Z44A 2MUCA 3RR4A 2DUAA 1QWKA 3VDGA 4AHOA 1I2OA 4R85A 4M81A 4YIWA 3ES8A 3VTRA 2ZA1A 2BRVX 2EAWA 3GVGA 1GEQA 4FX7A 1XGZA 4MJ4A 4P61A 2A3BA 5FEXA 4GX9A 2V8ZA 1KO0A 2E24A 2YFNA 2CIPA 2CWXA 3DYPA 2QCCA 2YDQA 3QHMA 1AD1A 1NWTA 3S5YA 4JYFA 2E7FA 2BFGA 2H9AA 4NQ1A 2EF9A 3KL3A 3SIMA 3NR0A 4XZMX 3RNDA 2CHNA 4IQLA 4ZXLA 6PTDA 1EA9C 4N9DA 5DT5A 2X0SA 3M0YA 1JVNA 1OX5A 1KQZA 3OVPA 1IQ8A 4ZO9A 2QULA 1OM0A 1K9DA 3KTXA 1ZL1A 2PS2A 4N02A 3NDOA 2O9PA 3V5OA 3LRKA 1M5WA 4IM4A 4QITA 1W2PA 4W86A 3MHUA 3P14A 1PTAA 1RQBA 1J79A 1IZCA 3C6CA 2VL4A 3H7VA 3W7HA 1DJNA 3B40A 5M03A 1KM5A 5J8LA 3WG6A 1H7NA 1H1ZA 5AECA 7ENLA 3E5PA 4GK8A 4H19A 3G0XA 3SN0A 1XKJA 3EWXA 4GISA 4BJHA 3WMCA 3S1UA 4JNZA 5M5DA 5KEZA 1UR3M 2A3CA 4HNOA 1ODUA 5HULA 1E71M 3VIHA 2CPUA 3VZZA 3QY7A 4UQEA 3DX5A 3GG7A 3AUOA 4K7VA 2I5QA 3GIQA 4YLWA 3ITGA 2FJUB 3WD4A 1VLIA 1O1HA 2VEMA 4K37A 2C8NA 5HBFA 2BRPA 4XZHA 1XXXA 1IXQA 2CKRA 3KVLA 2PBGA 3G1SA 3BLPX 5C9WA 2YA1A 4PCPA 3BGGA 3L23A 2EGZA 1TB3A 4GY7A 5BMWA 4A8IA 3TNOA 1FXQA 4GD0A 3MYOA 2OXNA 3GDRA 2FVLA 3ABQA 3PTQA 1XIDA 1H0IA 4O57A 3R2GA 4QXIA 4LFYA 3ITYA 4DJED 1S5WA 1MFVA 2DQWA 3E2QA 1EJVC 2VOTA 1ELSA 3CASA 4HYWA 1TQJA 1UJQA 1XYBA 3OEXA 4HK5A 2VYOA 1B2YA 4HPXA 4GXPA 5CSRA 4KFPA 3IK2A 5I79A 5JUVA 3GNDA 3W7MA 5LIUX 2CBJA 3HGJA 4WHBA 3TYAA 3VOHA 2PDFA 2VHLA 1XUZA 2ZUTA 5A69A 1KLYA 4L4LA 3PBYA 1RD5A 1E6PA 3GFZA 4BK9A 2HV5A 4YN5A 5FJIA 4L1GA 4C6KA 4W93A 1XYMA 4ZGYA 1CLXA 2QMKA 3NURA 4EXBA 3TX9A 3FHQA 3TLQA 3OVRA 4YCOA 2ZC1A 4N6EA 4QIUA 3W84A 2A3LA 2OTDA 2YB4A 3O8AA 1KCZA 1OFPA 5T8GA 3DH7A 3FGCA 4KCVA 4JZ5A 3AYSA 1KTBA 4LTSA 3W1PA 2EJAA 5A8NA 4R5EA 2QDHA 5D2XA 3VD9A 3WH8A 4W84A 1NP2A 5HR6A 5BOFA 2ZX6A 4AIBA 4PMVA 5H6HA 3KFTA 4UCGA 3PY2A 3T6CA 2GUUA 3H4XA 2BNJA 3TR9A 4A3QA 3CV6A 3TTSA 1JNEA 2R1MA 4KFNA 2AL2A 3QN3A 1EIBA 4PSRA 1SSDA 5B7YA 4AEOA 5BOOA 4E8DA 1TV7A 3KRSA 1M1BA 2DT3A 2VOMA 1XD0A 4U31A 3LM3A 2GJXA 2Z26A 1TMHA 3VMPA 4L65A 3UR7A 4US5A 1HM3A 4WKHA 2VGGA 4E2OA 3B0XA 3VOJA 4L9ZA 1TTPA 4PCTA 2QT3A 2VT0A 2H9AB 1H7XA 3AXMA 2GLKA 4IMCA 2OLSA 5JIWA 4S3EA 4KWVA 5C9RA 4Z2KA 3HF3A 1Y5WA 2EPNA 3AIQA 3SW6A 1JDEA 4F0KA 4E38A 2HK0A 1WP6A 1EOMA 2Z1KA 3UF9A 1UKOA 4JL1A 4KERA 4UTUA 1UUMA 1VFLA 3VYLA 1E1CA 5KTLA 5HNRA 2IPWA 3UEQA 2QDDA 3RMEA 3QTPA 3UGRA 4S38A 3ZQ9A 1JJKA 4CD4A 3AMCA 2XZ9A 1B4KA 1EJWC 1V7AA 5FL0A 4ML4A 1I6NA 3LCXA 1LROA 2IKHA 1TMLA 2F9RA 3FJLA 2CBVA 4J2MA 1R3QA 7PTDA 3W4RA 1VFSA 1QPOA 4U33A 3ABXA 1SGJA 4FSAA 3AHTA 3BW3A 4O4WA 6CGTA 1F4AA 4WDWA 1H7WA 4F79A 4D1IA 3G6MA 2V63A 4DJFA 5KZDA 3W1NA 4JX6A 4MWAE 3H7UA 4FALA 1VCVA 4J1OA 3SCWA 4I7UA 1TIWA 3N6JA 5AC7A 4Q8PA 1PEZA 3CWOX 4NVTA 4DLFA 2BHYA 3CLMA 2RUSA 3QJAA 5CLTA 3P80A 4RXFA 1TWIA 2AMXA 2O7QA 3B4YA 4LX4A 1EGMA 1PZ3A 4ZFMA 2FPYA 2W9MA 3LY0A 2VDGA 4XD3A 1C7TA 4WX2A 1KFJA 4GVGA 1UR1A 4YPJA 1QHZA 4YCPA 3BCDA 4XUYA 5A8OA 3O9NA 3NFUA 4D8ZA 5HOSA 1OJXA 1CX9A 4CU7A 4JQAA 1IWPA 1RLCL 3Q45A 4A2SA 1N2VA 1GEHA 3TOPA 3K8KA 4XIAA 3B06A 1XCXA 3M0HA 3TA9A 3TAOA 4HA4A 1IYXA 2I9UA 1X6LA 3BLLA 1VYRA 1XGEA 4LYKA 5EB8A 4FLOA 1EQCA 2BVDA 2BY1A 3GUGA 2ISWA 3QM3A 1LF1A 3R43A 2WHMA 4R7JA 4KS0A 4LRTA 4UFLA 4E8GA 3WO8A 2OO6A 1UWTA 2BSLA 4HTYA 5DELA 2KAUC 1F6YA 3WQWA 4KW2A 5FL1A 4HNUA 3GTHA 4LW7A 1ZS2A 3U0HA 2WB5A 3KBSA 2O92A 4FXJA 4XSLA 4N4QA 4X22A 3VGDA 4ZA0A 4A29A 2DZBA 3GXDA 2QCFA 2X03A 3KM8A 4QJ5B 5JU6A 3CEUA 1ZAHA 4QROA 2Y5JA 3OGVA 5H8MA 4IIDA 1AVAA 2BV9A 3PZVA 3FGCB 1UH3A 2NX1A 3V5CA 4Q7NA 3H26A 3N3MA 3P84A 3WLNA 5KITA 4LV9A 5LXEA 1SM9A 3NSNA 2HE8A 2AGTA 4OBRA 5C8BB 4L6HA 1JCJA 4JIHA 2EPHA 1I4NA 4AMCA 5C55A 2AL2B 3MV01 2UY4A 4JTQA 4GUGA 1U30A 3GUWA 3UNDA 5CEWA 1XR2A 4HNTA 1KV5A 2DZSA 1HW6A 4JTLA 3QYQA 1AMKA 2DIEA 2J13A 4PUKA 3A4XA 2Z6JA 4M8UA 1OVDA 1LBMA 2QCLA 2FZDA 2GJXB 3HMCA 5A6TC 3MKKA 3OZPA 2YCJA 4IMDA 4KWUA 4FB7A 3WLHA 3OTRA 2GDUA 3AIUA 4YU1A 3GAYA 4A35A 1UR8A 1VFFA 5DANA 3T78A 5FJPA 4ZQPA 5CPQA 5FD0A 1NDZA 1LTDA 3P61A 4UTMA 5TAOA 4WSHA 5FJTA 3W7OA 1LQ2A 3AHYA 1L6GA 4AZ5A 4DJEC 1X6UA 3GU1A 3SUUA 1HO1A 3K2GA 1E1CB 3P60A 4NASA 4U5KA 2VDHA 4GC3A 1T0OA 2YCKX 3IV8A 1JXJA 4ACYA 3VGGA 2D0GA 3M07A 4M0XA 5ECVA 5CZSA 3NZ1A 1GJUA 5AC6A 3HGOA 5C6MA 4LUJA 2VP8A 4Q4OA 1VYPX 3N25A 3UJFA 4LPCA 1IT7A 4FLRA 1FKXA 2WZTA 1FTXA 2OZ3A 3RRAA 3QW4B 1J5SA 4KCUA 4Z1CA 3GHSA 4FR6A 4OZOA 1QOPA 2HRWA 3VC6A 3LCWA 4A3YA 4QG8A 3KW3A 3IVTA 2ZIDA 2HS6A 2WZHA 5A95A 4B5SA 3WDPP 4LY8A 4MWAC 4HPJA 3R7MA 1J18A 3BG5A 5CPLA 1XFCA 4N4PA 2A6NA 4JN6A 5I3GA 2QUNA 2QCEA 3M5YA 3ZS4A 4GX8A 4H8UA 3PPHA 2PC8A 4GQRA 3BH4A 3E49A 1QBBA 4I9MA 1C82A 3CAKA 4OT7A 3L4UA 1FWJC 3AMLA 2XFFA 3FA3A 1E73M 3EWYA 4D6HA 2BHZA 3U6WA 4GQQA 1AQ0A 5LNVA 1E1FA 2Q09A 4G56A 4H1ZA 4UTWC 3TA6A 3AU2A 4ZB2A 2HDJA 4B5XA 3T0CA 1OC6A 3PZQA 1QT1A 3NCOA 3O16A 4WY0F 1B3OA 3A22A 2YCEA 3EPNA 1U1JA 3L2LA 4F4RA 4MVAA 3S2JA 4PUNA 4POCA 2Y5SA 3VKBA 1I8JA 3SGUA 1BFNA 4PBGA 2FMNA 1JUBA 2VURA 4FIQA 1G6CA 3CK5A 2VNCA 3V5FA 4CQDA 2OYKA 3PJXA 1O7AA 4K8EA 1TCDA 2DP3A 3ZR6A 1JYXA 5FIPA 1DVJA 3B0YA 1XLFA 2IXUA 3A5VA 4C1NA 1Q65A 3AQUA 2AQWA 4XVEA 2WNZA 4ICMA 3P8IA 3TQVA 1KBIA 3LA4A 1J6OA 5IDZA 3VGHA 1BPLB 5D03A 4XTIA 1VHNA 3MB9A 2GK1A 4MSSA 4XUGA 3N2XA 1EJ7L 3VE9A 5AZ1A 3CUXA 3ICJA 3H2CA 1EEPA 1OC5A 1W1PA 1WCGA 3NYDA 1OFQA 1H09A 1NDVA 2HSAA 3BO9A 4GO8A 5A1AA 1A0CA 5I07A 4NJIA 4LBUA 5D2VA 3DYMA 1CBGA 1B54A 1Q6LA 1HN0A 4V1YA 4HOZA 2YR1A 2VDIA 3M47A 1O5RA 3P5YA 3ID7A 5A2CA 4CN6A 1XQLA 1PDYA 2WSPA 1Q6CA 3WEMA 3L65A 3ZLHA 1F9GA 4IHCA 2BMBA 3PZUA 4G9PA 3CIXA 3LGDA 2QJHA 3LSCA 3VILA 3TWAA 3TFCA 3MMTA 4G1KA 4RR4A 4CQ9A 3WBYA 4JDYA 4QCEA 1IHIA 5CJ5A 3ECQA 1ISWA 3QH2A 2BGNE 3TZNA 3GNNA 2BDQA 2YZRA 1KRBC 2PU0A 2VI0A 4K39A 1PIGA 3ITTA 2ATMA 2PGFA 1TVLA 4A8NA 3QMSA 1WKEA 4UQ9A 2FJKA 3UR8A 4RPPA 1J93A 3DKJA 3N9RA 4C5ZA 4AD0A 3UT0A 4WDXA 4YTTA 3VK5A 3BW4A 3P67A 3RAOA 1DWHM 4Y6GA 1KKRA 3GXPA 2GVJA 2FZMA 4GKLA 3SCOA 3KHJA 4EOUA 4QLLA 3GXFA 5A5WA 4I9TA 5TD4A 5U7SA 2NQ9A 2H8XA 5I78A 3N4EA 2OX4A 4H8VA 4AAJA 2AAMA 2OSYA 5K9CA 2C18A 4C91A 1TZZA 4CD7A 1OGBA 4JHZA 3VGEA 2OSXA 2YL5A 4AZGA 3S2MA 1HGWA 1E72M 1E55A 4BF5A 3ZLFA 1I9CB 5CPMA 1N7PA 3UJ2A 3TDFA 1XBYA 3ARRA 1AJZA 3W28A 2XN2A 3Q37A 1SW3A 1PAMA 1ZZMA 2FPTA 2V30A 3N9SA 5HK4A 4K2SA 3WQCA 1YPIA 2E09A 3S2NA 1XH1A 1REQA 1ZCCA 2YCLA 1X96A 3ZJ7A 3KRBA 2FFIA 1V3JA 2EPOA 4E0CA 3EDJA 1EZWA 1ZJIA 4BKNA 4GA8A 1VRXA 2Q6ZA 3OHIA 2D2GA 2W63A 3W7IA 2ISVA 4M6UA 3M0MA 3TVAA 4IWWA 1P6BA 3G1FA 2PGWA 3DOPA 1SR9A 4LANA 3MUY1 2WC3A 3M0XA 4C60A 1WXJA 1D8CA 1AA1B 4EPBC 1IXNA 3VNYA 1QI0A 4TV5A 3LHVA 4AVFA 2INEA 4C1NB 1GNXA 1RAKA 4DO6A 1QNVA 2Z2BA 2VCCA 3UERA 3C0LA 3BG3A 3FKKA 3STPA 5GNXA 3H54A 1UWQA 4TX8A 4X60A 4D6FA 1MUWA 3TCSA 2Z2AA 5C70A 4PUMA 2F38A 1JZ8A 4AWEA 1ECQA 1ME9A 2GK1B 4TXEA 3VDHA 4DF0A 4H8HA 4I9AA 4Y7EA 3EGJA 3GIYA 1HJUA 3DEQA 1XG3A 2V4IB 1TR9A 3KBWA 4B4HA 4NAEA 1UZ4A 3KOFA 4IICA 3B8VA 1PKMA 4MJMA 2YIHA 1QHPA 5E5CA 4AVOA 2QMJA 2E28A 4IQEA 5D38A 4L1XA 2I9EA 1AL8A 4ADSA 3L5MA 3UD1A 2OWCA 1ITUA 3FYYA 1R3YA 2GFTA 1I8QA 4ZOCA 1V6TA 1EKOA 5DCEA 3K5XA 1UA7A 4RDZA 1GVFA 2GJPA 1KCKA 1XF0A 4NY2A 2I16A 3I10A 3LNMA 1WOAA 5A6BA 5A8PA 2E1WA 3WDQA 1AODA 4HPNA 3AHZA 1I60A 2JE8A 3MI2A 3U48A 4K1GA 3N15A 4JTSA 4MAZA 2EG8A 2VCBA 3A12A 4QFUA 4NI8A 1RUSA 1GQKA 1GG0A 2YL8A 5I0DA 2NXHA 1XRFA 1MUCA 3GH5A 1TR1A 3MYPA 1WBJA 3EWCA 2PAJA 1O0SA 2GZXA 3PWGA 2XWDA 4HVXA 2JKPA 3WF1A 3BTNA 5FKYA 9CGTA 1YPFA 2Z28A 4DO5A 3F4NA 2Y2WA 1DE5A 4AUBA 3KTCA 1UQYA 4TU1A 1S5TA 4WOQA 4UQAA 2Q8ZA 2W27A 5EFDA 2BASA 3P0XA 4LSBA 3VZYA 1P48A 1JDFA 2PLMA 3I68A 1XLDA 2ZOXA 5AC4A 3T09A 1VAHA 1W91A 3A3WA 1N8IA 3UCCA 3FDKA 2ZXQA 1JFHA 5KSWA 1JPIA 5I5RA 3SIZA 1XPGA 4JQ1A 2FVKA 4MAVA 4Q33A 4O8RA 2YA0A 3MWCA 4WR3A 3A64A 2BWGA 1X8FA 2XG9A 5A2AA 4B90A 3VOIA 4AD4A 2XU2A 1U2YA 1R9YA 3VIJA 4M51A 4JYEA 3FFSA 1JYWA 7ODCA 1LOHA 1OF6A 1W1ZA 4WRHA 3LNPA 4WKFA 4E3VA 1XCFA 4O14A 4LF2A 4LOCA 1T96A 3H2EA 4BEQA 1OABA 1WDRA 1AW1A 2WJEA 3VOCA 3CUIA 3FVDA 4G7FA 5HNNA 2ZRWA 4ZE5A 2XVNA 4F9DA 1REQB 4E8CA 2POTA 2PLJA 4LC8A 5A8GA 1JEZA 1K70A 2DH2A 4JICA 2YSWA 1RVGA 1CB2A 1VJIA 2E4TA 3LG3A 4ZMGA 1X1ZA 5FJOA 1EJTC 3ELFA 2XFRA 1A3HA 4H9UA 4PMOA 4UOZA 4DBEA 1SZEA 4MOZA 4PMNA 1ZNNA 2Y62A 1A3XA 2NZLA 1GT8A 2JKEA 3UG4A 3NAVA 2C71A 2RDTA 1KD0A 1YE6A 4I5UA 3EWBX 3B9OA 3PG9A 4X2RA 2ONEA 3UWZA 5DFAA 3RYSA 1RR2A 1ZLPA 2XZ7A 5CC7A 3NO1A 5B80A 2OT0A 3C8NA 1LOLA 3OGSA 4GGBA 4HMNA 4O15A 3ALGA 1JDCA 5HANA 4MG4A 4XZIA 1TELA 3WCZA 1BYCA 3KP0A 5F4WA 3BWWA 1RHCA 3HA1A 4NAEB 2FKPA 1C8QA 4L4MA 2WNWA 3W7EA 3NQCA 1OB0A 1IR2A 3CUZA 3ZSTA 5EGRA 1KFCA 4XO7A 4IFKB 4MB1A 2PGRA 1RWHA 2NVDA 2DIKA 4MY8A 2WMHA 3W6LA 1E51A 4S3FA 2C14A 1EBGA 4Y9NA 1GOOA 1GHRA 3A3HA 4INFA 2W6RA 1CB7B 3IUDA 3HIJA 2QPUA 4IL2A 3WD0A 3KBUC 2PDYA 4L9YA 2ISDA 5HJYA 3F2BA 2X8RA 4F9JA 2ZZ1A 4JTUA 3W7PA 2NXIA 4EIVA 3LCFA 1R2RA 2PBOA 2OMAA 3AXXA 3ZLGA 2DT2A 4LCQA 4B9YA 3L0GA 1P4CA 2ZCGA 2VQUA 4XV0A 3TJLA 2XJ7A 7TIMA 2RH9A 1EIXA 1CWYA 1VENA 2BGSA 1DJZA 5C2GA 2WBGA 4H2CA 2V6AA 3CWNA 3E38A 1CZ1A 1XYAA 4Z1AA 2DW7A 5DXXA 3NQAA 4IT1A 4FNTA 2VR5A 4AVNA 4HGXA 1TPVA 5CC3A 5A8MA 1G4TA 2PRMA 3G2GA 4C6DA 3UZYA 1US2A 3HJZA 1FP9A 4LT9A 4QS6A 2CCRA 3W0KA 2RDXA 2FMOA 3WMLA 1HP5A 3M9YA 2A21A 4R7OA 1JAEA 5LKYA 4OVXA 4V15A 2YOCA 3R0DA 1UCWA 3FDGA 1R47A 3CTTA 2PDWA 4DM2A 4EPDC 4DWSB 1MW3A 3KZSA 3AO0A 4PUJA 4F2UA 5BW6A 2VO5A 2P8BA 1K8ZA 4GIAA 1DJYA 3IWPA 3OVQA 5FOOA 1KRCC 2GVLA 1ECEA 3GG8A 4D6EA 4X3ZA 1AQFA 4AHQA 4D8AA 1VEOA 3THCA 4RLIA 1SU5A 1LZOA 1TA3A 1JDDA 3ES7A 4AIEA 4HQVA 3FS2A 2VQTA 1BXBA 1M65A 3R5EA 3HPZA 4C1KA 2WV8A