2WMFA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in its native form.
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
555
structure length
555
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIENYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLSGHTGHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 206
structure length 555
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmfA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmfA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmfA02
1Z32X 5CPQA 1G94A 4PMYA 1HXJA 4JFUA 1SMAA 2IXVA 1C90A 1BG4A 2OSYA 2ZOXA 1UKSA 4TUFA 2J78A 3OLGA 3UEQA 1US3A 4PN2A 1B3XA 1DP0A 2DT1A 2E9MA 2W63A 4UFLA 3RJYA 5BXRA 1Q4NX 2D3LA 1RWFA 2J7DA 3MMWA 1CBGA 3IANA 1R87A 1FA2A 2XFYA 3TP4A 2E0PA 3WQ5A 3AMDA 2CBJA 1MQQA 5DT5A 3N17A 3VIPA 3GXFA 1AQMA 2UY5A 4HTYA 3CZLA 2CBIA 1KR0A 1R85A 1NWRA 1TE1A 1QW8A 3AHXA 1I75A 4W86A 5F7UA 5A6BA 1WZLA 3VMPA 2EEXA 2XFRA 1WPCA 3VX0A 2PI6A 3OZPA 2Z1SA 5A6LA 4H8HA 4W93A 2VRJA 3PZVA 1JD9A 1EQCA 3EDEA 1IZJA 4PUEA 4EK7A 4CUCA 2BNJA 1ZU8A 4MPKA 4RL3A 1EDQA 4UOZA 5ABFB 5EMYA 2C0HA 1I1XA 4K68A 2Q8XA 2PF0A 1U30A 5D9NA 4DWSA 1ITCA 1G9HA 2OLHA 1BAGA 2J8FA 2VRKA 3VMNA 1E0VA 2WDAA 5GNXA 2RGLA 3AMCA 2O92A 1GOMA 4C7FA 3FHAA 1ISZA 3TOPA 4P7NA 3DC0A 2GVYA 3A3HA 1UWSA 3HMCA 1BYAA 3VDHA 5E70A 1BF2A 4Z2JA 1GCYA 1NWSA 3N11A 3S2CA 1UH3A 4ZENA 1JFXA 1JDCA 2VQTA 5HOSA 1HF6A 1P6WA 1TVPA 2D0GA 4CGTA 4D6IA 1JNEA 1CDGA 3N18A 1WP6A 3AHZA 1OSEA 2RGMA 4GI9A 5I0DA 1HT6A 1FH7A 1R86A 1E0XA 3BGAA 3CUFA 3E1F1 3AROA 2A3CA 3VDBA 1RP8A 1GVYA 2E40A 4WKAA 1H49A 3SUTA 5ABGA 3L4ZA 5KZ6A 1JNDA 4HMCA 3SCRA 1JZ5A 2V5CA 4C7GA 2A3HA 2J77A 3DHUA 4XZBA 5M17A 4IUGA 1JFHA 1V3IA 1IZKA 3AS3A 2X03A 3WSUA 3A4XA 4U33A 2Y24A 1XHGA 2J7EA 4MAZA 3SCUA 1DWGM 1NOWA 2PWGA 3N12A 1J0KA 2DSZA 5DF0A 1VF8A 2X0YA 2BVTA 1G01A 3AMLA 1V0MA 4Q7NA 5IDIA 1CXLA 3OZOA 1GUVA 2YA0A 4PMVA 1R7AA 2CCRA 4B16A 2D2OA 3PN8A 1XV8A 1JZ8A 2YA2A 2DT2A 3RILA 3AIEA 4PMXA 4AY1A 3PZMA 1XRVA 4W8LA 2EPKX 3THCA 1W3YA 4JAWA 2HISA 3SCSA 1D2KA 3GBDA 5A6KA 2CNCA 1BLIA 5FKYA 4CVUA 1HP5A 3F4VA 1M53A 5IHSA 3NSXA 3AIUA 3MMUA 2WPGA 3CMGA 4PRWA 1VBRA 2W61A 5D4YA 2D22A 1XC6A 1H09A 3D5HA 3UESA 4JFSA 3GZAA 1V0KA 4QLKA 4UZUA 1R7OA 2GJXB 4HMDA 1M7XA 1B2YA 3SUSA 1F4HA 2CERA 2W5FA 2EXOA 4TVUA 4CD6A 3NUKA 3N13A 4ACYA 1LG1A 3VM7A 3QOKA 3UETA 3WNMA 4AZGA 1X1HA 1UOKA 3VD7A 3OLDA 1EQPA 4AIUA 1Q6DA 1A3HA 1E73M 3LPPA 5E6ZA 1XH2A 2YL9A 1QNSA 2J62A 1IT0A 4QCEA 1HMUA 3BXWA 1WDPA 4U5IA 2JF7A 4TTGA 4KRUA 2E9BA 2WXDM 4PEEA 4UFIA 2BRPA 2WHLA 3NCOA 3CPUA 1GQIA 4CU8A 1RH9A 4YHEA 5IXEA 4AW7A 1W9DM 2CYGA 3ZJ8A 4KH2A 1TCMA 5BROA 1E6RA 3GH7A 2WLYA 1UD2A 2UY2A 1VFMA 3OBAA 3UR7A 1VEPA 5M03A 1OGGA 1JI2A 1N7PA 5CPTA 4JZ5A 1MYRA 4N42A 5CQ1A 4CN1A 2DQXA 3RO8A 2Y4SA 3FAWA 4WK9A 2OYKA 1UKQA 1CYGA 5FD0A 1EOKA 4M24A 4PTXA 3PZ9A 1LL4A 4A3HA 1NWTA 3ZJ7A 1UA3A 3KZSA 4GPNA 1J10A 3A4AA 4LGXA 6TAAA 3IJ7A 1LG2A 1KXVA 2DPEA 1V3JA 4XV0A 4BQ5A 4UQCA 2WWCA 2GJRA 4WSKA 4IPLA 1E4LA 4E4PA 1VEMA 4WIWA 4ATWA 1YQ2A 3EMQA 1O7AA 1UR1A 5C70A 3WF0A 2XFFA 4D6GA 2YOCA 5I2UA 3WH6A 4CU6A 1JL8A 3AIWA 3RM8A 3NIYA 3TTYA 4UQEA 1PBGA 2EO7A 2GUYA 3CUJA 1QI0A 1W1VA 3CZKA 3M46A 1UD4A 4PBGA 1W3LA 4GO8A 4UQBA 1EA9C 2J8GA 5DMYA 4W7UA 4H04A 3T0DA 2BRWA 4CCEA 3MO4A 2WSPA 1L8NA 3WNOA 1GZJA 4UFMA 1KQYA 2JEPA 5GQBA 4ZE5A 1H11A 4P8VA 5CGTA 3VILA 5CGMA 4JKKA 1B31A 3ARUA 4PTMA 3AICA 2W62A 3W38A 3VIIA 1XSIA 1BVZA 2VX5A 1QHOA 2V3GA 2XJ7A 2XVKA 2ZUMA 3W81A 2J25A 5A6SA 1OD0A 1C92A 3ARQA 4GIAA 4NSBA 4X0NA 3THDA 2D23A 2E22A 4L4OA 4EKJA 1WB0A 1MW1A 4W85A 3IAQA 1R8LA 5CLTA 3GM8A 4P7OA 1M04A 2X8RA 2EPMX 4MADA 1E6NA 3AXXA 3AXIA 4MNJA 1N7OA 1NP2A 2J4GA 1CECA 3AHTA 3DYOA 4Z2LA 4D6FA 4NF7A 3VOCA 1H1NA 2XVGA 3I3DA 3OG2A 3ZO9A 2GK1B 2GJXA 3WUEA 1VJSA 3WBAA 4B15A 3ZT7A 3RM9A 1K6AA 1G1YA 3UR8A 1CGTA 3WUBA 1VAHA 1J0IA 1ESWA 3HJEA 5GPRA 2A3AA 1JYXA 3UERA 1V0LA 3ZSTA 3WNKA 1CGVA 2WBGA 4AZCB 1U33A 1UR0A 1ISYA 1JAEA 3MUAA 1Y7VA 2V3DA 3OIHA 4OIFA 4ZFMA 2YJQA 5A6JA 4AEFA 2E9LA 2ZUVA 4M29A 3VINA 1KGWA 4AZHA 1DWJM 4HA3A 2CHNA 2GSJA 3RIKA 5ABHA 1WZMA 3GH5A 3FAXA 2VVNA 1KR1A 1WNOA 4WSJA 5DFAA 2VL4A 3KL0A 1HJSA 1A47A 4PSRA 4U3CA 3QR3A 2B31A 4JFVA 3K4DA 3MUZ1 4J27A 1UYQA 1HKIA 3ARXA 1ZJAA 1BPLB 3A4WA 3DECA 4D1IA 2JALA 3EDKA 1W3JA 2J74A 2E8ZA 1NH6A 2G3JA 4D71A 1EH9A 3EDJA 1GQJA 3OGVA 1TZ7A 4M8UA 4J3XA 1RD6A 1OINA 3PTQA 3B8SA 4WLCA 4WF7A 1ISVA 5C71A 1UG6A 2DEPA 4CD8A 1G0CA 3ZJKA 4PMRA 1J01A 3ARTA 2XVNA 3RMEA 2OWCA 2WVVA 4MNMA 2DH2A 1KBKA 1OJNA 3U57A 4AD4A 2VZTA 2XTKA 3WF3A 2QLYA 4AZ6A 1FH9A 1OGBA 2BV9A 3WQ4A 2ZE0A 1OJOA 1D3CA 4RE4A 1GNXA 3PTKA 1E72M 4KWUA 3TONA 2XYLA 4AIEA 4DUXA 3WDPP 5A2CA 4MB3A 3RDKA 1ZBCA 1RPKA 4AD2A 1AQHA 1JAKA 2E24A 2XWEA 3WDIA 4W8AA 4DWSC 3BSHA 3SCQA 2ZX8A 5E09A 1SMDA 3CIVA 4AD1A 3WY1A 4YPJA 5CPSA 3U5UA 1H0IA 4J3WA 5IFPA 2PB1A 3PZQA 4Q22A 2D0HA 4ML4A 3EDDA 1WCGA 4KRTA 4LX4A 1LQ0A 6A3HA 3QGVA 4GQRA 4PTWA 4D6JA 3FW6A 3WDRA 1ZS2A 1E43A 3WNLA 1V03A 3BAXA 4ATLA 1V6WA 5I6SA 3GTNA 1AVAA 1J11A 4BS0A 5FCZA 1WZAA 2FGZA 1IV8A 3SCPA 3BLKA 3WFLA 5JIWA 5GNYA 3MUIA 1ODUA 1QI2A 7CGTA 3WUFA 3SUVA 3VD3A 3ZMRA 1NWUA 3AOFA 1G5AA 3VO0A 1E3ZA 4X9YA 1EDGA 3VIKA 2D1ZA 1UD6A 4NI3A 5E0CA 1L0PA 2FHBA 1CWYA 1HMWA 2VCCA 1CZ1A 5A8MA 2JE8A 1UZ4A 4OKDA 2XIBA 3WD1A 5A2BA 2W4XA 3VIMA 1J0MA 2WC3A 3AMKA 2C7FA 4AIOA 2GDVA 4HU8A 4Z2GA 1E6SM 5ABEA 1SR0A 1EOMA 2A3BA 1CGYA 1PIFA 2GK1A 3MSGA 1J0HA 2V3FA 3NJ3A 1RP9A 4BQ3A 3BLPX 1X6LA 3WKZA 1E1FA 4MNLA 4QLJA 1TUXA 3AIRA 1XSJA 1I8QA 3W37A 4KGJA 5A6AA 1GJUA 4MAVA 4GQQA 4J3VA 2VR4A 4AZCA 4D6HA 3OGSA 5D9PA 3WD3A 3SCNA 4W8BA 3CUHA 2D0FA 3FNDA 4E2OA 4QFUA 4BZYA 3AIBA 4LQ1A 3CHCA 3EMZA 3ZR6A 1HN0A 4CN6A 4GI8A 1JYWA 3ARVA 3B9EA 1NARA 4OOUA 4AZIA 5E9AA 1V08A 2DIEA 1BVNP 3BCDA 3BAWA 7TAAA 1RW9A 2YIHA 1BSIA 1WO2A 3ARZA 1DWAM 4DM2A 5D8WA 3AYRA 2X09A 4UOQA 2BXYA 2FHFA 1J0NA 1GONA 4FLRA 3CMJA 3VVGA 4HZ8A 1XH0A 2J47A 5DO8A 3ARSA 1D7FA 1KFWA 2VJXA 1J12A 1E6ZA 1X1JA 3CZGA 4Y7EA 2QPSA 4M80A 3F5KA 3RCNA 1O6IA 2G3NA 1UWIA 3W29A 3SCOA 2EBNA 1QHPA 2W67A 1KBBA 2DT3A 5A94A 1HJQA 1C8QA 3II1A 1K9FA 1QNRA 3HN3A 1EO7A 3WF2A 2CKSA 3B9DA 3BSGA 1UA7A 2WMIB 4JFWA 1CXEA 2XGIA 1E4IA 4MJ4A 1E3XA 3ZR5A 1QI3A 3PZUA 4ZXLA 1GPFA 2CESA 1B9ZA 1JD7A 2V3EA 4GI6A 1ISWA 2CXGA 4N0RA 3WIJA 2WM0A 3NSNA 5M5DA 2FH8A 5I5RA 1TVNA 3T2OA 1H2JA 1FHDA 4A3YA 1OIFA 3LMYA 1PZ3A 1CLVA 1JDDA 5FOOA 4HPHA 5IHRA 2FDMA 1EXPA 3M07A 3B9AA 2IXUA 3GNPA 5BRQA 2VRQA 4PMZA 2WCSA 3MUY1 2WC4A 4UQDA 3L4TA 1BQCA 5JBFA 1LF1A 4HZ7A 3APGA 3CGTA 3VIHA 4BCEA 2FH6A 1QHZA 2OYMA 2WZIA 3BMVA 3T2QA 2F8QA 1KCKA 3S6TA 3I3EA 3MU7A 1OT2A 3O6AA 1V02E 2EPLX 3MMDA 1HNYA 3T09A 2WMHA 1JGIA 4IISA 2BS9A 1MFVA 4GZJA 4P7QA 2G4FA 5LA0A 3LPOA 4CD5A 2Q1FA 1FHLA 3VGGA 1HIZA 5HDRA 1PX8A 4XUYA 4UQAA 3WDQA 1FFRA 4EAMA 1VFUA 4FK9A 1GOWA 1PJ9A 4MJ2A 4XZWA 2F2HA 3VTRA 2XSAA 3ZOAA 1LOHA 1CENA 3KWXA 1LWHA 3WEZA 3WQWA 4HZ6A 4FLQA 3CTTA 1HL9A 3ZM8A 5HPOA 1WKYA 4GZIA 4S3JA 3CUIA 1W9UA 1Q6FA 1RWCA 4BA0A 3VIFA 4AZBA 2WAGA 1GW1A 2YLAA 3M6DA 1CGWA 2WVVB 4QP0A 1K9EA 3U5YA 3SCVA 4JHOA 1BYBA 3AIQA 3ARWA 4BQ4A 2VZOA 4CU7A 1HN1A 3MKKA 1V0NA 2VURA 3J7HA 2ZUNA 2HVMA 1F1SA 3BAJA 1OBAA 2GJPA 2ZXAA 1DHKA 3PZTA 4OOZA 4W87A 2OWXA 2UY4A 1ECEA 3CHFA 1KWGA 1E56A 2ESCA 1UWUA 3WDHA 3T2PA 2WVTA 1W3KA 4OUEA 1BHGA 1CB8A 1C8XA 4PMQA 1MQPA 4TTUA 4IPNB 1GOOA 4WJXA 5I23A 3ARYA 4V28A 1N82A 1KGXA 1C93A 1U2YA 2WYSA 4E8DA 2EJ1A 3WQVA 3PTMA 3RJXA 1UH4A 3K4AA 3QHMA 2C8NA 4AZ5A 2D20A 1ODZA 4URIA 1KB3A 1PZ2A 5LA2A 1VFFA 1K9DA 3W26A 2EPOA 5BRPA 2ZX7A 4H2CA 3L4XA 1MXGA 2Y8VA 1V3LA 2VCBA 2BRVX 1J0JA 4F9DA 2QPUA 3WMCA 2WW5A 3VGBA 5A8QA 1JF5A 2CPUA 4PMNA 4D6CA 5M3WA 5ECUA 3W25A 1XH1A 2J7BA 1UUQA 4C7DA 4BQ2A 2VZUA 2WBKA 1H5VA 4TVCA 1KXHA 2JIWA 4PMUA 1UKPA 4M56A 5JBEA 4AWEA 1F4AA 2DSVA 4LYQA 3DYMA 4J3SA 1OIMA 4UTFA 3F5JA 2QMJA 4B9ZA 1V3HA 1FP9A 1FFQA 5A8OA 2XWDA 1DTUA 3PHAA 4M82A 4W88A 3EMCA 4AD0A 3GXIA 1JIBA 4JFTA 2WMIA 3ALGA 5HXMA 1RWGA 3W27A 2XUCA 3BAIA 5EFDA 1ZBWA 4MB1A 5CSYA 3N04A 5A69A 1ZL1A 1WDQA 2F61A 2XSBA 1KXQA 4HOZA 3SCWA 1M03A 3WFZA 1HKJA 4PUDA 1MQRA 1HJXA 1DWHM 2J7FA 1ITXA 1F9GA 4LYRA 4PYSA 1US2A 2WSKA 5CSUA 3LPGA 5D9OA 3FXYA 3SUUA 1E1EA 4P8UA 3NYDA 1M01A 3ALFA 3K8MA 2VTFA 1B30A 2MANA 1CXIA 4OBSA 3O2LA 1W3HA 3AS0A 4UOJA 1OWQA 1CTNA 5AY7A 3CO4A 2VT0A 4B3KA 4D6DA 2QMKA 4U2YA 1E0WA 1H3GA 4FLOA 4TOQA 1EHNA 3AS2A 2TAAA 2VR5A 2WHJA 3UG3A 3K46A 2Y5EA 4WKHA 4LPCA 1QI5A 3WD2A 2XPKA 2ZIDA 3DHPA 1KXTA 1UQYA 2BVDA 1B90A 3AZSA 4D6EA 2JEQA 2X05A 2QHAA 4BF7A 1CXHA 2YBUA 4B3LA 1TA3B 2J79A 5D8ZA 1E6PA 1JF6A 1BGGA 1K9TA 3N9KA 5AYIA 3UG4A 4H41A 1EHAA 4MB4A 3T08A 3EDFA 3L2MA 3G6MA 4Z2IA 1GOQA 4QDMA 5JUVA 4UCFA 2XGBA 1XYZA 1SFSA 2VQUA 1UWTA 5FL0A 2BHUA 2VO5A 3AMGA 4MTVA 3AYSA 1B1YA 2WVUA 4U2ZA 3W53A 4JL2A 2ZICA 4OJYA 2ZXBA 4RE2A 2YL8A 4P7LA 2YDQA 3MANA 2ZXQA 1JZ7A 1HVXA 1W9XA 4AD3A 4J3UA 2UWFA 3T0AA 1JXKA 2D3NA 3VGHA 3WMBA 4J7RA 4M81A 3VGFA 1N7NA 3FY1A 4J28A 4JHZA 2PBOA 1PX4A 3FHQA 4H8UA 3MV01 1BG9A 3DYPA 1GHRA 1TG7A 2ZWYA 4UFKA 4YN5A 1TFVA 1J0YA 2VC9A 4HP5A 3ECQA 3VU2A 1H4PA 1UH2A 1UZ1A 5A6BD 3WBEA 1WDRA 2VI0A 1H41A 4QAWA 2BFGA 3NSMA 2PWDA 1HKKA 1KWKA 4L4PA 2WMKA 1QOXA 3ZSSA 1NM9A 2O9OA 2X1IA 2G3IA 2AOSA 5AC4A 1X1NA 4AD5A 1CGXA 1BTCA 1OGSA 1YHTA 3POCA 1JXJA 4HOXA 4V2XA 1W1PA 2CHOA 2VX6A 5E0FA 3U7BA 9CGTA 1PX3A 3OLIA 4EANA 1N7QA 2AAAA 1B3YA 1JDAA 4QCFA 5I77A 2WMGA 4DWSD 1UKTA 1J0ZA 4F8XA 3ZT5A 1QNQA 1MFUA 5A6MA 4V27A 2XIIA 1PIGA 3PBGA 2GFTA 2WHKA 5EB8A 1KCLA 1VB9A 5HBFA 1FOBA 3TA9A 2AMGA 5EFFA 5FIPA 2E3ZA 5BXTA 2YDSA 2G3MA 2XM2A 4W7WA 4ZXOA 4A4AA 1ZBKA 1UHVA 1E6XM 1E71M 1V3KA 3A47A 2YDRA 3VNZA 1XYFA 3GNOA 3ZT6A 1H0GA 2E8YA 5I79A 2VOTA 2CKRA 3QOMA 1PAMA 1RWHA 1X1IA 1CXFA 2D24A 5I3DA 4FF5A 4CCCA 2VCAA 1VFOA 5DEZA 1VJZA 2A3EA 2DGAA 2BXZA 2Y8KA 1HM3A 2YL5A 1UD3A 3RPMA 1NOUA 4ACZB 2XVPA 1E4MM 2VZSA 1E5JA 2UY3A 1MW2A 3A6OA 4F79A 4ZEPA 2WMJA 3WL0A 3GYCA 1CLXA 5A95A 2NSXA 3IK2A 1FP8A 4CD7A 4JKMA 5C8BB 2PC8A 3W28A 1UR8A 2PWHA 4MB5A 4JKLA 3VDAA 1UR9A 4OBRA 3VIGA 1W1TA 3ZQ9A 3KL5A 5IFTA 3GDBA 1CEOA 1I1WA 3QHNA 2EQDA 1TA3A 4GINA 1X6NA 3VKKA 1Q6EA 3WNNA 3BAYA 3L2LA 5CJ5A 3WN6A 3AHYA 1OT1A 1QW9A 1XSKA 1BYCA 2DH3A 3WELA 2W66A 2XVLA 1GQKA 3VPLA 1XD1A 2VX4A 3MSDA 2BY2A 3BH4A 1B3WA 2J75A 1W2VA 1J9YA 1UWRA 1EGZA 3PZGA 5CG0A 1OB0A 4XB3A 2VNCA 1PEZA 2WANA 4Z2KA 1LJYA 4F66A 4GO9A 1CNVA 3AFBA 3WQ6A 1EGUA 1ISXA 3AZTA 3OLEA 1JZ4A 2BVYA 2WZEA 2O9TA 3WUGA 4QLLA 1MVYA 4CN4A 4PCSA 1ZJBA 4CVWA 2VMFA 2NT0A 3KE0A 2X0HA 1UD8A 4E8CA 1W32A 2ZUUA 3CZ8A 4TVDA 1QBBA 2WZHA 3F5LA 1MWOA 1UKOA 4W7VA 3K8LA 4MDPA 1N7RA 2WNWA 1HJUA 2J7HA 1VBUA 3RM4A 5I78A 2J7GA 1UQZA 2WMFA 5I24A 2FHCA 4PMDA 1NOFA 1AMYA 3AI0A 1LL7A 3BAKA 3BMWA 1BYDA 1TR1A 3SIMA 3L4UA 4F9JA 1LWJA 1MW3A 2ZUTA 3NDYA 3CHDA 1W91A 4R27A 4AYSA 3WMSA 2PWFA 1JZ2A 4PCTA 2G8ZA 5JIPA 2VUYA 4H8VA 3VGDA 3WH7A 2E4TA 4TXEA 5DT7A 5HNNA 3NDZA 4GZEA 2OYLA 4J3TA 1CPUA 8A3HA 1UD5A 3WEOA 2BHZA 4S3KA 4TX8A 5A8NA 2IUZA 3WNPA 2ZWZA 4FLSA 2OSXA 4AXNA 4U5KA 4W5ZA 2WKLA 1E70M 3OB8A 4HMEA 3ARRA 1SYTA 1BFNA 4U3AA 1C91A 4P8XA 1HX0A 2YLLA 3ZJ6A 4B9YA 1XD0A 3D3AA 4JCLA 4LXFA 1E5NA 5BXPA 4Z2HA 1HM2A 1HP4A 1V6VA 4UFJA 3VM5A 3WEMA 4NZCA 3U7VA 1RWAA 3TTOA 4NRRA 5A8PA 1B3ZA 1C3FA 1DWFM 2BY0A 3K8KA 4HA1A 4UQ9A 5BXSA 3W6LA 5BYWA 1B3VA 3GH4A 2JIEA 3L4YA 3L4WA 1CIUA 3LPFA 5JBDA 3G6LA 4HPGA 4DM1A 5ABFA 4PTVA 2XG9A 4D1JA 1C8YA 1OJPA 3AQUA 3IJ8A 3CUGA 3TTSA 1WE5A 3UG5A 2WHMA 1TMQA 2CETA 3K1DA 5TD4A 2DT0A 5HPCA 1HKMA 2BY3A 2BY1A 3BCFA 2OWWA 3VMOA 2PBGA 4ACZA 2GDUA 3N15A 4UR9A 1JYNA 4JIEA 5LYRA 5LA1A 2WCGA 4JCMA 3SEPA 2ZX9A 3WF4A 2J7CA 3VIOA 3VIJA 4YHGA 2DIJA 3WH9A 2WCAA 5A2AA 2VX7A 1GVIA 4X0VA 1V02A 3GBEA 3W82A 3GXMA 5D9MA 4D72A 3MV11 1V3MA 4EE9A 1MW0A 3KEHA 2FGLA 1OM0A 1KGUA 4UFHA 4P7RA 4M1RA 2VZVA 4GXPA 1J18A 1ZBVA 1OCQA 2ZUWA 3BC9A 3M7SA 1FH8A 1S46A 2Z1KA 2ZUSA 8CGTA 1MXDA 1E4NA 3AZRA 3CH9A 3WDJA 1UWQA 4AMCA 5AYBA 4FMVA 4H7VA 3I3BA 3CZJA 1C82A 1LLOA 1V6YA 3UCQA 1C7SA 1EDTA 1GQLA 1CXKA 1LXMA 2CIPA 4ZE4A 1HJVA 3OGRA 3N1AA 3SCTA 1LXKA 2CBUA 2DSWA 1JYVA 3AHVA 2WWDA 1GORA 1ZB5A 1WDSA 4AEEA 4KGLA 3W6MA 3CHEA 3VUPA 4DUVA 1NP0A 3WL1A 4ATDA 5CXPA 3T0BA 2CITA 4OZOA 4KMQA 2W91A 4CCDA 3SUWA 4P8WA 4WKFA 3WH8A 1E9LA 1QBAA 2CBVA 2DSUA 5AC5A 2YL6A 1QVBA 2WVSA 3OA5A 1Q6GA 2X2YA 4AZ7A 3VDCA 1JG9A 4IM4A 3GNRA 4CKQA 4PSPA 2XHYA 1JZ6A 4NRSA 2Y2WA 1VIWA 4PMOA 1XGZA 4XX6A 1GJWA 2OSWA 3SURA 1W9PA 2PWEA 4DWSB 3EBVA 2WLZA 2WKGA 1PPIA 3VD5A 3PZIA 1EO5A 1LL6A 2V5DA 7A3HA 2QF8A 4CD4A 1GHSA 4UNIA 1VRXA 1QNPA 3VGEA 3CBWA 1HJWA 1W2PA 2ZX5A 2WCOA 5EBAA 4DUWA 1GOIA 3VD9A 1VEOA 2WC7A 2ZXDA 1UR2A 1E6QM 4AC1X 2VVSA 3WD0A 3VX1A 1OD8A 2CEQA 3L4VA 4HA4A 2BHYA 2ZX6A 3WD4A 1JI1A 1NQ6A 5CZKA 1C7TA 4AISA 1W9BM 3CZEA 2O9RA 1E15A 1VENA 2G41A 2JFEX 1HVQA 5BCAA 2YA1A 1JZ3A 3QHOA 1E40A 2V38A 3TTQA 3AIVA 1V6UA 2NW0A 1E55A 2NT1A 2JF6A 1DEDA 2DDXA 3WF1A 3MS8A 3ZIZA 1V6XA 3IJ9A 3W4RA 1QI4A 3FN9A 3AISA 3W24A 4GKLA 1QNOA 1XCWA 3AS1A 4HOWA 1CGUA 3EYPA 5GNZA 3PZNA 1HL8A 1AQ0A 5E6YA 2YBTA 1XCXA 2XM1A 5BWFA 3HU7A 3CLWA 3JUGA 1UR4A 3W0KA 4R5EA 2DSKA 4RE3A 4W5UA 2WB5A 4U31A 3WQ8A 4UZSA 3WENA 5A1AA 3VD4A 4TX6A 3PZOA 1GOKA 4MDOA 4MNKA 1W1YA 3ARPA 3VNYA 1WAWA 6CGTA 1BGAA 3KL3A 1DWIM 1QPKA 3AJ7A 1B0IA 1W9VA 5CLWA 5KEZA 5FL1A 1EIBA 1KQZA 4W84A 4W89A 3POHA 1OJMA 4HU0A 4JL1A 3O9NA 2QV4A 2O9PA 1WZKA 4LYPA 2YKKA 3AXHA 2W92A 5A3HA 1Q6CA 3WH5A 3GXDA 3IAPA 2EPNA 2WK2A
chains in the Genus database with same CATH superfamily
1VFTA 1Z32X 5CPQA 4PMYA 3W6YA 1SMAA 2NXIA 3BGGA 1UKSA 4AVOA 3TFXA 3UEQA 2F6KA 3DKJA 4RNIA 4KQNA 3CAKA 2GGGA 1LP6A 4A22A 1PCWA 3RCYA 5T8GA 2VC5A 2O0TA 2RDWA 3NQMA 2E9MA 3LLFA 1I2NA 3E02A 5BXRA 2D3LA 1RWFA 5DELA 3IANA 2OO6A 2PTYA 3RU8X 1PTAA 4ECLA 1DJGA 2XFYA 1UP0A 2E0PA 1RK6A 3ZLFA 4YTTA 3PG9A 3GXFA 2UY5A 1EWEA 3TJIA 4DO6A 2CBIA 1R85A 4Z1YA 4IX2A 1I75A 1SM9A 5F7UA 1O5XA 4O12A 2ZC1A 3FIGA 2ZZ4A 4ORMA 2X41A 2YW3A 3BW3A 1KFLA 4H8HA 4IHCA 4EK7A 2XISA 4RL3A 1MEHA 4Q8TA 4GWEA 3UA3A 5ABFB 1EJVC 2QIWA 4K68A 2Q8XA 2YBVA 3QTPA 3VNJA 4C6PA 1REQA 1DXEA 1ITCA 1G9HA 3VMNA 5I00A 3TJLA 5AHIA 1I2PA 1A4LA 2RGLA 3GR7A 3KOWA 3HQOA 1SU5A 4KT2A 3TOPA 4P7NA 3DC0A 1BYAA 1BF2A 1XYBA 1O5RA 3GHSA 4Z2JA 2XN0A 3TE9A 3URAA 3BZJA 2REQB 4F2TA 1JDCA 1NJJA 1P6WA 4Q32A 3O0FA 4D6IA 4R7JA 3WG6A 2WJDA 3N18A 2VENA 4GNVA 3CM4A 3SSJA 3PFRA 4CNUA 2ACQA 2RGMA 2Z24A 2ABBA 1VP5A 1FH7A 1R86A 2Z4GA 4L61A 4YTUA 3CUFA 3M7WA 4EWJA 1RA5A 4QJ4B 1XBZA 2E40A 2V9DA 5L9FA 1QPNA 1RBOB 3QW3A 3MTWA 1NFGA 4RKAA 1Q5MA 4XAYA 2A3HA 2J77A 3H7RA 3JRKA 4C6EA 3RMJA 1JFHA 3VXGA 4GFSA 1IZKA 3AS3A 2X03A 3IT6B 3A4XA 4U33A 1S5VA 2HSAA 2J7EA 5JQ9A 1DWGM 1X7FA 2DSZA 1VF8A 1K7FA 3TK7A 1G01A 3TROA 5C9XA 4YXGA 3SSZA 2YA0A 3SW6A 3W9ZA 4D8AA 2DZXA 2D2OA 2YA2A 4JDBA 3AIEA 3E2QA 3GVGA 1XIDA 5HWMA 3PZMA 4MKSA 3G1FA 2FQIA 3KFTA 1D2KA 3QZAA 3MWAA 2V63A 1M53A 2Y5SA 1ZY9A 4UTMA 3E96A 3MMUA 3TZNA 3CMGA 4DLMA 1I2RA 3QW4B 1XC6A 2NLYA 4JFSA 3M0HA 3GZAA 1V0KA 4LUTA 4QLKA 1R7OA 3BE7A 3SUSA 4O0ZA 4XSLA 3FYYA 4TVUA 2CC0A 3RF9A 3VM7A 3WFAA 1ADDA 5KZMA 2QDEA 3W86A 3WNMA 1UOKA 1Z8AA 4IZGA 3ABOA 2GOKA 4I6VA 3OLDA 1EQPA 3L21A 1Q6DA 1Y5WA 4PRTA 1R30A 4LCQA 4ZFCA 1WDPA 3LUTA 3UWZA 2PA6A 4KRUA 4GG9A 4GY0A 4O11A 5DQPA 4FOKA 2RDXA 1FDYA 4DJFA 1DJHA 3QYSA 2E28A 3M16A 4FS9A 3KTCA 4Q4OA 1W9DM 3ZJ8A 3PUEA 3VFLA 4K8HA 5BROA 7REQA 4EXAA 1CW2A 3NZGA 3MI6A 2GGHA 2WLYA 5D2WA 1QUMA 2XH4A 3S47A 4DNMA 2UZ9A 4IMAA 4Q4KA 5J5DA 1G7VA 1N7PA 4YLWA 4ZO8A 2PLKA 2ZRUA 4N42A 4CNOA 3DDMA 2DQXA 1MI3A 3RO8A 5MKGB 5D2VA 2Y4SA 4GIRA 3CEPA 3HGOA 1ZSXA 2VDIA 4DWDA 3A4JA 1LL4A 2YXGA 2YCIX 2JK2A 4A3HA 3ZLGA 3KZSA 4GPNA 3I68A 4LGXA 2DPEA 4RZ4A 4XV0A 3P5YA 4WIWA 1YQ2A 5BU9A 4JIRA 5FESA 3ITTA 4ZB2A 2XFFA 4DBWA 1SR9A 2YOCA 4CU6A 4CEUC 5IM51 3TTYA 1A0EA 4UQEA 1PBGA 3TSMA 3LCGA 3CUJA 2CW6A 3CZKA 4H9VA 4I7VA 4UQBA 4GY7A 3G1VA 4S3CA 2C18A 2VEPA 4LBSA 4QNEA 3CH0A 1BF6A 4UFMA 1KQYA 1POJA 5GQBA 2FPYA 3DBPA 1GEHA 5D38A 1EJSC 4IFKA 4JKKA 2PDQA 4PTMA 4WVXA 3IUIA 4ADUA 1IE7C 1BVZA 1QHOA 2VZKD 1PKYA 2ZDRA 3R8RA 4JICA 1QATA 1JUBA 4LANA 3UFYA 4NSBA 4QXIA 1X1ZA 1FWWA 1W5OA 1MW1A 2HPIA 4W85A 1WUFA 1GQNA 4KIEA 3VDGA 1R8LA 4P7OA 4IP7A 3CU2A 2CHRA 1GOXA 1DTNA 4XD6A 4Y9AA 4JTHA 5K3VA 3AXXA 4WEVX 4MNJA 3BSMA 3AHTA 4NF7A 1KCZA 3QY6A 2R1PA 4PEKA 3TCSA 1EYEA 2QDHA 3BG3A 1K6AA 5IOBA 2QJMA 1J0IA 3HJEA 5GPRA 2A3AA 3W7CA 4LS2A 1BXBA 4RDZA 2PE4A 3T8QA 4P2VA 1XCFA 2PCEA 4C1NB 1TJ0A 3HO8A 3NO1A 3OW1A 4QEHA 4H1ZA 3MUAA 3OIHA 4B5XA 5A6JA 3TOYA 4F0HA 4HTBA 4AZHA 1DWJM 4HA3A 1TWWA 2VVNA 1WNOA 3B4UA 5AC7A 4FA3A 3KL0A 5AYXA 4IGNA 1HJSA 3PFMA 4J27A 1EKOA 3ARXA 5JH1A 3C4UA 2J74A 1YDOA 1TR9A 1X39A 2NQ5A 1WKFA 4M8UA 1XRFA 1OINA 4WF7A 3IJLA 1H7RA 1SGJA 3N2OA 3E5BA 1UG6A 2DQWA 2DEPA 1TPH1 3GXNA 3R1ZA 4MLJA 4MLRA 3B0VC 3QPEA 1WDDA 3UWQA 2XVNA 5DRIA 3WBXA 2OWCA 1FWCC 2WVVA 3DC8A 4MNMA 4G6CA 2OLSA 3KDNA 1L6WA 3NQGA 3BW4A 4XSMA 4JNZA 2EGZA 2X42A 2VGFA 2VZTA 4Z42C 6REQB 3WF3A 3L5AA 3WQ4A 2OZ8A 4WY0B 4RE4A 4JIQA 3PTKA 2Y62A 1M6JA 4KWUA 2AMXA 3A5VA 3QH2A 2GGIA 1XWYA 3NPWA 3GY1A 1ZBCA 5D33A 1RPKA 3PBMA 1AQHA 2XWEA 4DBEA 4IFRA 4W8AA 3W7OA 2VEKA 1UBPC 5E09A 3PK7A 1SMDA 3LU2A 3WYZA 5AC8A 1F7BA 3CO8A 3WY1A 4QJ5B 3JU2A 5BOOA 1H0IA 5IFPA 4LRTA 4WDTA 1WCGA 2ZDSA 4LX4A 1GVQA 6A3HA 3LM3A 3W87A 1ZS2A 1KV5A 3HGRA 2PGRA 5U7SA 3KHJA 3V75A 4ATLA 4GYJA 5I6SA 4NZ1A 1TX2A 3DGBA 4IG2B 1S5NA 4B5UA 3BLKA 4C91A 2Y63A 5GNYA 4IXHA 4OWGA 3QQ0A 1ODUA 3V7PA 1QI2A 1DIOA 4NAFB 5CZ0A 1NWUA 1VBJA 3AOFA 5JU6A 4X9YA 5AYZA 1VFHA 3VIKA 3PBVA 3VNIA 3FJNA 2KXSA 2WSYA 2E09A 4Z0SA 4GQBA 1UZ4A 4JYFA 3UZ5A 5A2BA 1S38A 3LRKA 1J0MA 2PCQA 3DFYA 4GOAA 4QRNA 3CT2A 4OQVA 4HU8A 1E6SM 5ABEA 1K70A 3D47A 3NJ3A 3W84A 1A3WA 5AHEA 3BLPX 1X6LA 1TUXA 4G7EA 3AIRA 3KWSA 2IQTA 3G1DA 3OZYA 4F0LA 1K4HA 3E38A 4MAVA 3U6WA 3FVDA 4DY1A 2VR4A 4D6HA 3SCNA 4CNPA 3L65A 3FNDA 5F4XA 3KOFA 4LY8A 4BZYA 1SO5A 4WUIA 4LQ1A 3V5FA 4GI8A 2BOGX 3EWUA 5LHFA 1Q13A 3TQ0A 1AFSA 2JBMA 1HTIA 1BVNP 1ZCOA 3GDRA 4AF0B 3PP7A 4O0QA 2BXYA 1XLBA 2FHFA 3KBVA 1AW2A 1J0NA 3TN5A 1GONA 3TMLA 3VVGA 1XYMA 2J47A 5DO8A 5BZAA 2OLAA 3ARSA 3OBEA 3IGHX 1L8PA 1TRIA 4JEJA 4MSSA 1LCOA 3F5KA 4S38A 4DVOA 3VNLA 1O6IA 3W29A 3AXMA 3SCOA 4B5NA 4GJ1A 3NNTA 3WCZA 1PTGA 4NL1A 4K38A 4AWUA 1PE1A 4DJFC 1QNRA 2OT0A 3MWCA 1EO7A 3WF2A 5DXXA 2YZRA 3U2EA 3M6YA 1UA7A 3UU0A 3EEGA 4M0XA 2XGIA 1EEPA 4MJ4A 1QI3A 4XZHA 1BQGA 4L64A 3LXCA 3GU2A 4N0RA 2CXGA 5T9CE 3WIJA 1WBJA 1ICPA 3GUWA 2FH8A 1TVNA 2E67A 4A2SA 5EKYA 1PZ3A 1OFDA 3UY8A 1P1MA 4GC4A 5D2TA 4DAIA 2PTWA 3DBNA 3S5SA 4DXVA 1EXPA 1SO3A 3B9AA 2PDKA 4PMZA 1UZHA 1AL8A 2WCSA 3MI3A 4UQDA 1E9IA 1X96A 3L4TA 1BQCA 4LUYA 3GNXA 1G69A 2WZIA 3FSUA 3XIMA 1VJIA 2PMQA 3QSTA 3BLFA 3MU7A 2I5IA 3M64A 1V02E 2V81A 1M7PA 3CV7A 5GVJA 3S1GA 5C55A 1HNYA 3T09A 2WMHA 4UCGA 4YS1A 4E2BA 3N2TA 7XIMA 3STGA 4P7QA 2G4FA 4ZQPA 3UD6A 2QR6A 5KTLA 1QK0A 2HK0A 4N4QA 4FK9A 4UUIA 1GOWA 4FPSA 4XZWA 3VTRA 8XIMA 1DHPA 3ZOAA 3SRDA 4ERGA 2ACRA 3FGCB 1UPMB 1U83A 3CTTA 3UCDA 1HL9A 3ZM8A 4GZIA 3C0LA 3B8IA 5HQMA 2DFAA 5LIYX 3VZZA 4WOQA 3QRHA 1Q6FA 4BA0A 3HV8A 3QN3A 3VIFA 3NL3A 3OG3A 2PTDA 3GG0A 3U5YA 2YFNA 1A5UA 3AIQA 3GHUA 1TTIA 2VZOA 3QBUA 1FWNA 1B54A 2A1YA 3V1PA 2D2JA 1TV7A 4Q8VA 1A50A 2GJPA 2R82A 1DHKA 3PZTA 4W87A 2BG5A 1ECEA 1P48A 1WV2A 2F6XA 1Q7MA 2ISVA 3CV6A 4TTUA 1YADA 2X16A 5I23A 3IIXA 4LBUA 2RJGA 2H8ZA 3FJ4A 4HHPA 1F6KA 1XLKA 2HNEA 1NF7A 3M0YA 3WQVA 4EWND 4F3HA 1RJQA 1UH4A 1ADSA 4K7YA 2D20A 1EJUC 1PZ2A 5LA2A 2EPOA 1UJQA 1JRCA 3T8LA 2ZX7A 1W1ZA 2J24A 3NL2A 2VCBA 2BRVX 1J0JA 4F9DA 3QC0A 1SSGA 2I17A 4JTSA 3WMCA 2W9MA 2P10A 1O5KA 1E1CA 5A8QA 1W8GA 4ASTA 4IIEA 4I7UA 2FVMA 2F2KA 4RZ6A 1FCVA 3VFCA 1UUQA 2ACSA 3MCOA 3P8JA 4BKNA 5BOEA 5JBEA 4LYQA 3W02A 5FAJA 1OYAA 2X1SA 4X2RA 4XAZA 2E6AA 1DJWA 1TUFA 4Q3MA 2E6DA 1LLZA 2XWDA 4AD0A 1TV5A 4W88A 3EMCA 1W56A 1JIBA 1NDVA 4JFTA 1TJPA 2OEJA 4MWAB 3W27A 5EFDA 3GHTA 2I1OA 2A5HA 5CSYA 5A69A 1ZL1A 2XSBA 3SCWA 3IK4A 1HKJA 4REQB 3MW7A 3E0WA 2AL2B 3A22A 3LHVA 3KCJA 1AUSL 1R3QA 2FYMA 5D9OA 3KZPA 4G56A 1E1EA 3NYDA 1J93A 4H6EA 1EZ2A 1FKXA 3MB9A 2MANA 1CXIA 4QGCA 1TIMA 5KITA 2IPFA 1NIUA 1W3HA 3AS0A 2IPWA 3LRLA 3G18A 3F59A 1OWQA 2C15A 2VYOA 2CLEA 2X40A 3BJFA 5F1UA 4IJBA 3PSWA 4U2YA 1E0WA 4A8IA 4UR7A 2TAAA 2VR5A 2Y85A 3T9PA 2EAWA 3DHPA 1EPVA 3IIVA 1WKDA 4D6EA 2X05A 2QHAA 1OC7A 1CXHA 4B3LA 4DYEA 2J79A 5E9XA 1E6PA 1BGGA 3KBWA 4Z2IA 3RLGA 4KEMA 4QDMA 4UCFA 2XGBA 1XYZA 4QX4A 3OZMA 1XBXA 4FR1A 2IKJA 1MXSA 1XIGA 4MTVA 3R25A 1YDNA 4U2ZA 4JQ2A 2DVUA 3A24A 4JL2A 3VOFA 4XBJA 3SY8A 1F6YA 4D2JA 5HULA 2A7NA 2YL8A 1ICSA 4BF9A 3F7JA 4EACA 2YDQA 3MANA 1JZ7A 4B4HA 2QAPA 4R34A 3EA2A 3N2BA 1HKVA 1Q8JA 1TQXA 3FYOA 4M81A 4JN7A 3G5EA 4RW3A 1EJTC 4JHZA 3PB2A 3KVKA 3MV01 4GYPA 1V93A 4L6DA 4K39A 4MZ1A 3S4TA 4YTRA 3UXIA 1Q4WA 1EF3A 3LCHA 4JTKA 3QFEA 3DXIA 1PKMA 4HPNA 1CB2A 4HP5A 3RN6A 2V2DA 4O50A 4LEFA 2Q02A 1UZ1A 4HHMA 5A6BD 1H41A 2QCHA 1RCOB 3A9IA 4L4PA 3ZSSA 2XN2A 1NM9A 5AC4A 1XRTA 2YSWA 1YHTA 4GIEA 4DI8A 4QG6A 2ZVIA 1SPQA 1OFAA 5E0FA 3P5ZA 2B7QA 3BARA 1N7QA 2NVAA 1Z44A 2ZA3A 4QCFA 2QGHA 3CV2A 4E3VA 1JCYA 3ZT5A 1EF2A 1MFUA 5A6MA 4HNCA 1PIGA 3W3OA 2GFTA 3E0FA 2J27A 1R3VA 3EOLA 5BXTA 1W5NA 4FEZA 3EX1A 1ZBKA 3TN3A 4KF1A 1E6XM 4ICMA 1V3KA 4I5RA 4S2BA 3SN0A 2VFEA 3GDKA 5DXYA 2R1KA 5I09A 1KFCA 4DF1A 1ME9A 2KXRA 4JIHA 5HNUA 1CXFA 2CLIA 1LM1A 3HA1A 3QLLA 3U2ZA 2D24A 3F1QA 4FF5A 2VGIA 3RLUA 2WV8A 2PU0A 1UD3A 3N3MA 1NOUA 2XVPA 4A8RA 1GEQA 4BWLA 3VKDA 2WSQA 5TQLA 4F79A 2WMJA 1FWJC 3AYTA 4DBSA 3GYCA 4B2DD 5G1TA 2J6VA 4GA8A 4DYJA 2NSXA 3PBUA 4CD7A 1IWAA 5C8BB 2Y0FA 3UR5A 2Y89A 4MB5A 4GYFA 2E77A 5CZJA 3R12A 4QG8A 4AIBA 1W1TA 4LWWA 3RRXA 3M5YA 2Y5JA 2ZZ1A 3F2CA 4DNHA 4WXZA 3GDBA 1CEOA 3ORWA 1I1WA 3QHNA 2DUXA 1A5SA 3VC5A 4GINA 2Q3RA 2NV1A 3WNNA 3L2LA 5G2IA 4OU1A 5HQLA 4NP7A 1N7KA 2YCKX 3MI2A 4H9XA 2INEA 2DH3A 3M0XA 3LEPA 4G8TA 1XL9A 1O1HA 3ABSA 5EA9A 1B57A 1XLIA 5HJYA 1B3WA 4LH8A 1W2VA 1UWRA 5CG0A 3EA1A 1OB0A 3H2FA 4JS3A 4Z2KA 2FTWA 5HWJA 1POKA 3WQ6A 3OYZA 3A9BA 1U22A 3LBMA 3NM3A 2WZEA 2O9TA 3I7RA 4ZR8A 4CVWA 4AU0A 4E8CA 3T55A 3LBCA 1QOQA 5CBJA 2QJIA 1ZAJA 3BWWA 4IUOA 3K8LA 2J7HA 4NT0A 4E4UA 5LXEA 2WMFA 4L65A 2QIIA 2FHCA 1NOFA 4JY9A 3S5OA 3BMWA 4F9JA 1LWJA 2D73A 4H7ZA 2QPXA 4C1KA 5REQB 3L0GA 1LT7A 3F2DA 3B05A 3A21A 1DJNA 4LFYA 4PCTA 5JIPA 3VGDA 5DY3A 2O7QA 4TXEA 4FP1A 5HNNA 1SO6A 3KCLA 4RDWA 3CEUA 3H23A 3NDZA 2OYLA 4J3TA 5AHNA 1CPUA 3T1GA 3VCCA 8A3HA 4Y9NA 2PDHA 3SQLA 5K4ZA 3WNPA 3ONCA 4U5KA 2WKLA 2PAJA 2QCMA 2E25A 1VHNA 4MPQA 1BFNA 4U3AA 4P8XA 4ERIA 1E5NA 3FK4A 1XRSA 2PP3A 3DOPA 2OZ0A 4HK7A 1WOAA 3WMLA 3U7VA 1RWAA 2OZTA 2BZNA 4BEQA 2BY0A 5BYWA 1R6WA 1HKWA 3B9OA 3LPFA 5LGXA 2X1TA 2XG9A 1ZP3A 1C8YA 1OX4B 2PPGA 3KTXA 2A6NA 3L5LA 2Y1HA 4KS0A 3R94A 1SQ7A 3WBWA 2QUVA 2WHMA 5TD4A 4K1WA 2AQVA 2BY3A 3OU8A 3WJZA 2BY1A 4Q4RA 3E2VA 3BCFA 4LU0A 1FUYA 4ACZA 1ZALA 4O28A 2GDUA 1GPWA 4JIEA 1R2SA 3WLHA 2UV8G 3WF4A 4Q7IA 3HPXA 1KM0A 1VYSX 4PL1A 1GVIA 3NZ1A 4G1KA 1V02A 2GUBA 3GC2A 3EWBX 5D9MA 3HV9A 4H19A 1V3MA 4EE9A 1OM0A 1KM2A 1XIEA 4GXPA 1J18A 3LY0A 3ES7A 3BC9A 3AJXA 1XLAA 1R3YA 4FX6M 1WYIA 1FDZA 3AZRA 4IP5A 3NL5A 2IKIA 2HVNA 4E0CA 5CJMA 3ITCA 4GD0A 1LLOA 1FWTA 2ZZ3A 1CXKA 3TKFA 5AC6A 4ZE4A 5LGZA 3CB8A 2BWGA 3N1AA 3UZJA 3TIMA 2XH7A 2H9AB 3CQIA 1GORA 1ZB5A 4KGLA 3W6MA 3VUPA 3OHMB 4QJ1A 1Q2RA 3EWWA 1WKEA 2CWNA 3T0BA 3B4YA 4KMQA 3EA3A 2XSXA 4NIRA 4WKFA 3S2LA 4JQ3A 3VDCA 4IM4A 3R89A 4NU7A 1FWSA 2XHYA 2R94A 4NRSA 3T78A 1IXOA 1EP3A 3SURA 1W9PA 3FVMA 4RZBA 2PWEA 3EBVA 1DQWA 3VD5A 3HG3A 1O68A 3MO7A 1P6BA 7A3HA 1OFEA 4CD4A 1P0NA 1GHSA 1VCVA 1VRXA 2XZ7A 1TPEA 3HG5A 1QNPA 3VGEA 3CBWA 3BLLA 3C3NA 1OCBA 3G1SA 2NXGA 2WCOA 1GOIA 4GABA 2NQHA 2WC7A 3O6DA 2DU2A 1E6QM 3BLIA 2VVSA 4AC1X 2ADAA 1NELA 3W2NA 4HA4A 1RHCA 3WD4A 3CWHA 4GYPC 5CZKA 1W9BM 1XJBA 3CZEA 4E6MA 4XIAA 1VENA 1FRBA 2G41A 3GNNA 4C6CA 5BMWA 5BCAA 2YA1A 3QHOA 1JDEA 1F6PA 2ONEA 1A3XA 3WF1A 3MS8A 1MO0A 3NVTA 3CAVA 3W4RA 3USBA 3W2JA 3STFA 3AS1A 2ZZ7A 3CL8A 1M1BA 1DYSA 1FWAC 2FB2A 4DN1A 3SBFA 1QOPA 1UBSA 2YBTA 1Q2SA 1FWRA 2XM1A 2X1UA 3EKZA 1V6TA 2QJGA 4R5EA 4B5VA 1BXNA 4RCXA 4U31A 2C71A 3VD4A 3PZOA 1GOKA 3E5PA 1GTHA 2PU1A 3CUXA 1Q6LA 3ARPA 3EWDA 3VNYA 3UPBA 6CGTA 3CB3A 3FDGA 1SW7A 2NV9A 1QPKA 3AJ7A 1MUWA 5CC3A 2C6QA 5CLWA 5FL1A 2KZHA 4IMCA 1KQZA 4KCTA 2VFIA 3POHA 3LD5A 3ZWSA 4DO5A 4J4KA 4HA0A 4O15A 3AXHA 3V3WA 1ZAHA 3GXDA 3IAPA 2EPNA 1W6TA 2V82A 5CPMA 1G94A 1E0UA 1HXJA 2WJEA 2A7RA 3RITA 1BG4A 4TUFA 3AWOA 1US3A 2F6UA 4PN2A 4DIAA 3GFXA 2B7OA 2DT1A 4UFLA 4C6IA 3W7KA 3C0SA 2J7DA 4XKYA 2A2IA 4ROQA 2YW4A 2QYGA 3IIOA 3WQ5A 5H8MA 1R47A 4MM1A 3MSRA 4M5PA 4HTYA 2ZTJA 1W5QA 3RPDA 1R3SA 3AHXA 4W86A 3PQIA 5A6BA 1V51A 1WZLA 3VMPA 4GVFA 3VX0A 1OF6A 2Z1SA 1Z89A 5A6LA 4O8RA 4LUJA 4W93A 2GSEA 2VRJA 3MC5A 1JD9A 1EQCA 3EDEA 4PUEA 3GKAA 4CUCA 1ZU8A 3R58A 3TW9A 2YXXA 1QAPA 3M0JA 4I7WA 3CTLA 4GQ0A 1PYFA 2PZNA 4MF4A 3EWZA 2B7NA 4GCXA 1S2CA 3M9YA 5FJTA 1BAGA 3P7YA 3GRIA 2J8FA 3O6CA 1I8JA 2VRKA 1G7UA 3A64A 4IICA 3W23A 2WDAA 3C0QA 3H2EA 2O92A 2ISDA 1GOMA 2R24A 3A3XA 3DH7A 4IL0A 4C7FA 3OJGA 3NG3A 3CQ0A 3LENA 3URBA 2GVYA 3A3HA 1UWSA 4GQGA 4O1BA 1GCYA 1DBTA 1NWSA 3N11A 3S2CA 4PUKA 4V15A 1RQBA 3FA4A 3L12A 5HOSA 3UVAA 1YPFA 4CGTA 3UD1A 4GLEA 1CDGA 3GO2A 2ZA1A 3P62A 1XW8A 3AHZA 3UW6A 3WLRA 3B40A 4GI9A 3KM8A 3SFKA 3UWVA 3W2LA 1HT6A 3AXKA 1QPQA 2X1RA 5ECVA 1IEQA 1P0BA 2XIQA 4G7FA 2VD8A 2WZMA 3SRKA 2DJLA 3CXOA 1RD5A 1PVNA 3ZVHA 3TW7A 1JZ5A 1VBGA 4XZBA 5M17A 4B2DA 4IUGA 3HB9A 2EKGA 2Y7EA 4TMCA 3WSUA 1YYAA 3WQGA 1XHGA 5HUPA 3C2EA 4MAZA 4KW2A 3O05A 1WXJA 4HCHA 2PWGA 3L23A 3O0KA 3L2IA 3WO8A 1M3UA 3E0LA 2F38A 3AMLA 1V0MA 4XAPA 1CXLA 4WRHA 1H63A 1A5CA 3ERPA 1FX6A 1OG0A 2DW7A 2AQWA 1XV8A 4MY1A 1DQUA 1W0MA 3N6QA 3ITLA 1QPOA 4PMXA 4AC7C 4AY1A 3RCMA 1XRVA 4NJKA 4W8LA 2EPKX 1PDZA 3WJYA 4JAWA 2HISA 3SCSA 5A6KA 4PRRA 4CVUA 1XIBA 2ZZ6A 2PEVA 2R14A 5AZ0A 3APYA 3PB0A 3W2UA 1BKHA 2W61A 1OFPA 2D22A 3D5HA 3CASA 4F0MA 4Q6JA 2GJXB 3CS2A 1M7XA 1B2YA 1F4HA 2CERA 3NQ8A 1TMLA 1SZRA 2GUUA 4QM1A 3TLLA 3UWUA 3VAVA 2VZKB 4AZGA 2XGZA 3NQ6A 4AIUA 2GVGA 5E6ZA 3LXAA 3W22A 1SZNA 4KEUA 2INFA 3LHZA 3DKLA 3QV6A 5C2XA 5FJUA 5EMKA 4HHLA 4QE4A 1HW6A 2E9BA 4PEEA 2TMDA 4UFIA 2C1HA 1ONEA 4NJGA 3VE9A 3WJSA 2Z1WA 1A5BA 3QMRA 1QWGA 3A23A 4NAEB 1YXCA 4JTTA 4QAIA 2I16A 3P14A 3M41A 3UYCA 3OBAA 3GG1A 1KTNA 7ENLA 1VEPA 1DOSA 1OGGA 2GLKA 3MA8A 4GGHA 4ZZ9A 4DF2A 4CN1A 4DXKA 4IPPA 1UASA 3O15A 3MQTA 1TQJA 1BWKA 5IDZA 1XQKA 3FAWA 4A8NA 1UOZA 3WLMA 1CYGA 2P1FA 5FD0A 4LW7A 1EOKA 1ICQA 4GGBA 3R11A 4FNSA 4IIBA 3IJ7A 2REQA 3Q58A 2WWCA 1KKRA 2GJRA 2HV5A 4CQBA 4GH1A 3Q2DA 4ATWA 9XIAA 3B0UX 1O7AA 5AKQA 1UR1A 4GJIA 2NUWA 5I2UA 3WH6A 3UJ2A 3AIWA 2DVXA 3I4EA 4K8GA 1O5QA 3VCRA 4XD5A 1BRLA 2EO7A 2ZADA 1QI0A 3QJAA 4K36A 2G97A 2C14A 3JVAA 3U2OA 2Z2BA 4DBDA 4H04A 3T0DA 4CCEA 3MO4A 5GJMA 2Z26A 4KKXA 2PS2A 3BOXA 5I3JA 3W74A 4M51A 3L7RA 3BDKA 4KWVA 5CGMA 4HPXA 3TN6A 2OEKA 2DZPA 1EJWC 3ARUA 3EPNA 3WLOA 4IX0A 2W62A 3V0TA 1VPXA 2G96A 1XSIA 3N25A 1EJRC 2VX5A 5KINA 2YEPF 1WX0A 3KP0A 3ARQA 1R9YA 4Q4PA 1FWGC 4PUWA 4X0NA 3S9YA 2E22A 4L4OA 5EMMA 1D8WA 1REQB 4QITA 4PE8A 3IAQA 4AEOA 2X0SA 3GM8A 3S0CA 1M04A 4ZOEA 3QGAC 3UXKA 4MADA 2GPTA 4LRSA 4P5UA 5BRBA 1QFEA 1XIIA 1NP2A 1F61A 3HPFA 2NQZA 3OG2A 2Y88A 2GK1B 2GQ9A 3WUEA 1VJSA 3OHIA 2FTPA 3I7QA 1CGTA 1VAHA 2QUTA 2FZBA 3MUXA 1JYXA 1V0LA 4PULA 3PBYA 2ZYFA 4FXRA 3GW0A 1AODA 1CGVA 4AZCB 1U33A 2Z7GA 2GGJA 1JQVA 4QE5A 4ZFMA 1KM5A 3B9NA 4AEFA 2E9LA 1SUXA 4PCPA 3UJRA 3LTYA 3U4AA 1KGWA 3B04A 2V6AA 3N2MA 3KBUC 4L5ZA 4BHYA 1WZMA 3FAXA 5DFAA 3CQKA 3S5YA 2VL4A 3EXTA 1A47A 3SY5A 4BF5A 1NAL1 2YFOA 2B31A 3QR3A 4JFVA 3LHYA 1HKIA 5G2WA 1JDFA 1BPLB 3DECA 3W1LA 1GG0A 2E8ZA 1HUVA 3S8HA 1NH6A 2G3JA 4B5WA 1JGMA 1IGWA 3MYPA 1EXBA 4WXYA 5U4NA 2PTZA 3OGVA 1TZ7A 1XLCA 4WLCA 1SJBA 1NY1A 3QR1A 4TMBA 4PB3A 1P0DA 1TMHA 2J9XA 4IQJA 4OV4A 4K7VA 1QNVA 4XZMX 3IV8A 4NJHA 5MKGA 3B0YA 4PMRA 4O18A 1VHCA 1M41A 3BICA 4HK6A 3TQPA 3ARTA 3RMEA 1YTKA 2DH2A 3D3FA 2HWGA 4UBPC 3U57A 4D8OA 4PTNA 4FZIA 5CC5A 1KW1A 2XTKA 1XPGA 4YWIA 4AZ6A 1FH9A 1OGBA 4CNSA 4DZAA 1H7XA 1BD0A 1LYXA 2QEZA 3G1YA 2OCZA 2JGQA 5A2CA 5AHMA 4Z0JA 2HEJA 4MWAE 2E24A 5H2ZA 4GVIA 1ME7A 5DX7A 3ES8A 4J1OA 3CIVA 3ENLA 2VXNA 2ODOA 5CPSA 3GZ3A 3U5UA 2PB1A 3PZQA 4Q22A 4DZ5A 4ML4A 1MMFA 4MWAD 4KRTA 4ZO9A 4V33A 4MGGA 3O1NA 4GNKB 4D6JA 2GQ8A 1KM4A 3GXTA 3S42A 1E43A 3WNLA 1V03A 4FIQA 3BAXA 3L67A 4BS0A 2YB1A 2EG6A 1IV8A 2FFIA 3S83A 2VEFA 1JPMA 1KO0A 5JIWA 3R10A 4K1GA 2FZMA 2OKOA 1VQTA 3MUIA 3W1TA 2YEPB 7REQB 1LUCB 4O16A 3O3RA 5XIMA 3WUFA 1VKFA 2PODA 3DU0A 3A13A 2YCEA 2V68A 3QLDA 1E3ZA 4DHGA 2RHGA 1UD6A 4QEEA 5E0CA 2FHBA 4X3ZA 1HMWA 2VCCA 4AUBA 5F1VA 4OKDA 2XIBA 4JTEA 5LIUX 2WSRA 3NTYA 4FXJA 3VIMA 1IIHA 4RV8A 2G0WA 3KUMA 3EPOA 3VE7A 1NDZA 4Z2GA 2A3BA 1EOMA 3MSGA 3NQBA 4R88A 3S46A 1ZGDA 4MNLA 1XSJA 3BOFA 1I8QA 4E38A 3W37A 4L9XA 1OYCA 3TW6A 4FF7A 1MNZA 1A0CA 3W1PA 1IHIA 3N6HA 4FX7A 4IIGA 2NWSA 5BWAA 3H26A 4AQLA 1KTCA 3CHCA 3UXLA 1HN0A 1JYWA 4DJDD 2ZRYA 2P8BA 4OOUA 2J13A 1ML1A 1PKLA 4LY4A 3PPGA 3BAWA 1RW9A 1DWAM 2HBVA 3GW3A 1AJZA 1LRQA 3FDKA 3JS3A 1KCXA 2GSHA 3AYRA 4UOQA 2V8ZA 4ERAA 1N8WA 2E7FA 4IFKB 4ZOCA 4GFIA 4FLRA 4I5UA 3GAKA 3QV7A 1XH0A 1HGYA 3TSBA 4IPIA 4Z1CA 1D7FA 1G4SA 1KFWA 2VJXA 4N2YA 3KVMA 4Y7EA 1X1JA 3CZGA 1T5AA 2QPSA 4H83A 4M80A 4GNJA 2ZRVA 1U5JA 1DXIA 2Q01A 4HMNA 1H7NA 2VC6A 4FXFA 4IJRA 1D8CA 4Z1BA 1PSCA 4C60A 2DT3A 3KHDA 4OV9A 1YW1A 2XH2A 5A94A 1HJQA 1X97A 4IIHA 3II1A 2HVOA 1M9HA 1VH7A 2O7SA 1FQ0A 3NO5A 4UC5A 3E3HA 2VC7A 3PWGA 2WMIB 6REQA 3P3BA 4UMBA 1TV4A 1YEYA 1TIWA 3G24A 4IFOA 1A5MC 1JD7A 2IKGA 3BV7A 2R1NA 1ISWA 1IXPA 1GJPA 2WM0A 1H1YA 4JGDA 3LM7A 1ECQA 3LMYA 3RFAA 2PC4A 3FFSA 5FOOA 5IHRA 2FDMA 5C54A 4LVFA 6TIMA 3UWWA 2E68A 2IXUA 3C3UA 3O07A 4RX0A 2GZXA 2VRQA 3IVTA 2QZRA 4HZ7A 5JBFA 3VIHA 4AY8A 5HJLA 1QHZA 2OYMA 3H8AA 1UUOA 2ATSA 1WA3A 2F8QA 1TTQA 2VELA 4MZ8A 1OT2A 4JBRA 3MMDA 4N9DA 2Z25A 1ONWA 3VOGA 4AYGA 5TAOA 1VPYA 3EX6A 4IISA 2BS9A 3R8GA 1U1JA 1PTDA 4XBKA 4YYFA 3NDOA 3NO3A 4NAFA 4XVDA 4ZOAA 3KXQA 1PJ9A 1TO3A 2F2HA 3UY7A 3FEMA 3KWXA 1CENA 3WQWA 2ZQ0A 2PWVA 4S3JA 2O56A 4QR6A 2Z1BA 3F2BA 2ANUA 1RWCA 2RKXA 2YLAA 4QP0A 2WVVB 3SCVA 3NXFA 3M0MA 3PWAA 2MUCA 3QEZA 1PWLA 1SJDA 2GWNA 3MKKA 2VURA 3J7HA 1BTMA 2HVMA 3BAJA 1OBAA 2OWXA 3CHFA 1E56A 3LDVA 3RLHA 2DJXA 3WDHA 3FJ6A 3T2PA 2WVTA 4OUEA 4WGXA 1BHGA 1CB8A 3VA8A 3ARYA 3GTFA 1XYAA 2QCGA 4QSFA 3THQA 1N82A 3TNOA 5CSSA 4XVEA 3WJWA 4ZTXA 1U2YA 4TV5A 4E8DA 4MY8A 1A53A 1O66A 4RE0A 1KKOA 3DIPA 2JKAA 2XFWA 2C1IA 3B8VA 3RJXA 1ZJIA 1P4CA 3IUHA 4S3EA 2J9YA 3R79A 4AF0A 4URIA 4XAGA 1KB3A 1U1UA 5BRPA 1KFKA 3FJLA 5I3GA 3U0HA 1MXGA 1V3LA 4QG9A 4AVNA 2I9EA 4EOUA 4FALA 2I5QA 5G2HA 4PMNA 4NKCA 3EXSA 1LBLA 2VZUA 1H5VA 2V5KA 4TVCA 1KXHA 1TWZA 4X61A 1F4AA 2DSVA 5K9CA 4LT9A 3ISIX 3HJZA 3ONBA 1W3TA 4UTFA 3WLJA 3F5JA 4FAMA 1XXXA 4K3ZA 4C6JA 4XK2A 1S5MA 4B9ZA 3W1MA 1FP9A 3GC4A 4EVZA 1SW0A 3GIYA 3GU1A 1UROA 1DTUA 4M82A 3HQPA 3GXIA 4KFNA 3ALGA 3S1UA 3M4HA 1ZBWA 3NEVA 4JYDA 3VNDA 4UTUA 1DIKA 4HOZA 5K4XA 1VYPX 1M68A 3TJXA 4PUDA 2J7FA 5E1QA 1ITXA 4M7SA 3LLXA 4A6GA 4PYSA 3QMSA 3V1HA 5C9WA 5T26A 2RDUA 3TJ4A 3I4KA 3O2LA 4JQAA 2DV0A 1RBLA 4QJ3B 2YCLB 4B3KA 4UMCA 2QMKA 3RAOA 1O1ZA 4FLOA 5A8GA 2Y5EA 3UP8A 4WKHA 1HFBA 1QI5A 2XPKA 2ZIDA 2Y61A 2BVDA 3ZLHA 1B90A 2JEQA 4QHRA 5CKSA 3T07A 2YBUA 4OFCA 1TA3B 1YNYA 4JEQA 3MHFA 4PCNA 4YU1A 4NUWA 5AYIA 2VKZG 3BO9A 3EDFA 1GOQA 1OC6A 1RA0A 4ZQOA 1P6CA 1UWTA 3ZVIA 2BHUA 2VO5A 1XFBA 3AMGA 3AYSA 1B1YA 2WVUA 4JTAA 2C1GA 3MVIA 1H1ZA 2ZICA 1D9EA 3FGCA 4OJYA 4HVXA 1EC9A 4HYVA 1V5XA 4US5D 3T4CA 2ZXQA 3LX9A 1CLKA 4C65A 4AD3A 4J3UA 3T0AA 3WMBA 1JXKA 2D3NA 4J7RA 1K77A 3VGFA 1CB7B 1G6CA 4KIRA 3EOEA 4O53A 4HNVA 4F40A 1KTBA 4LVGA 3W7PA 3C5QA 1OEPA 3W75A 2VC9A 3GVRA 3VU2A 5A5WA 1UH2A 2PRLA 2BFGA 2Z6IA 2XZ9A 4N4PA 4MVAA 3MJYA 1X1NA 1CGXA 1BTCA 3PNZA 1ZPTA 2AKMA 2OFJA 3ZZ1A 2Y7DA 1W1PA 1H7PA 4MMWA 2CHOA 3U7BA 9CGTA 1PX3A 3K30A 5AHFA 3W88A 4EANA 2AAAA 1RLCL 3NR0A 3TH6A 3E2SA 3R5EA 3MMTA 2WMGA 5TNVA 1UKTA 3TYDA 4F8XA 3TYUA 1MZRA 1GVFA 4KWSA 4L1GA 3PBWA 3QR8A 1RZMA 3FSTA 1O0SA 4YVPA 2ZE3A 2YDSA 1NDYA 2VEIA 2G3MA 4A4AA 1XLGA 5CPOA 3NQAA 2QGYA 1YTDA 3RXZA 3FA5A 3OYXA 3A47A 1XYFA 3GNOA 1JQXA 1U5HA 3ZT6A 2E8YA 5I79A 4CQAA 2CKRA 3Q4DA 4DLOA 4L4MA 2PLMA 1PAMA 2FZ9A 3I10A 1YXYA 3DENA 4MWAA 2QVNA 5I3DA 2VCAA 2BODX 3DFNA 1VFOA 1QK2A 5DEZA 3ANVA 3WLPA 2YL5A 3C2YA 1E4MM 1EA0A 2VZSA 1E5JA 2AL2A 1WAUA 4LSBA 3W1UA 4DJED 1MW2A 4ZQCA 4FX8A 4ZEPA 5F4SA 3WL0A 1H51A 4YYCA 2OMAA 4OVXA 5A95A 2OQYA 4W4QA 1IT8A 3IK2A 5CAHA 2PC8A 1V8EA 4JTIA 2PWHA 5EPDA 3W85A 3CL6A 1Y8BA 1XUZA 5LNSA 1IIGA 1L9WA 4O57A 4US6A 5CZSA 2AKZA 1UR9A 3VIGA 3U8GA 3R7MA 1IZCA 4RDVA 3DFHA 3DG6A 4OE7A 2PDCA 3LOTA 2EQDA 1EYWA 2PDWA 3VKKA 3ZWTA 4LB4A 1OFOA 5CJ5A 5LIKX 3U3HA 1TTJA 2FZ8A 3WN6A 3OA3A 1XSKA 1BYCA 1YPIA 1GQKA 4HJFA 3VPLA 2VX4A 4IGHA 3HFYA 4LAZA 5AFDA 1A5OC 1TRDA 1E1CB 4LB3A 5CJNA 2ZZ5A 3PZGA 1TWDA 4XQ6A 1QASA 4ZQRA 2VNCA 4LTSA 4MY9A 4JTUA 3OLEA 1WXYA 2BVYA 2WPBA 1JPHA 4PCSA 1A5AA 2NT0A 1C9DA 4YTQA 3LCIA 1GKQA 3A12A 2WZHA 1P0KA 4DJDA 1YMYA 3REQB 4MDPA 1N7RA 1DQXA 2WNWA 2XIJA 1VBUA 1L6GA 4EIVA 3RM4A 2HQAA 5HQEA 4PMDA 3CYVA 5BU6A 1DJXA 3VYLA 3AI0A 1JCMP 3L4UA 3IJQA 1EB3A 4AHOA 4O1FA 3CHDA 3WZ0E 1W91A 4R27A 1AD4A 1TPC1 2PWFA 2P88A 1JZ2A 3T05A 3INPA 1QXLA 2C3ZA 3ABZA 3I6TA 1BEUA 2R8WA 1XFCA 4H8VA 4ILSA 5DT7A 5L6UA 1IWPA 5F4WA 3SN4A 1F8MA 5E0KA 1VZWA 1QO2A 4S3KA 4TX8A 2IUZA 2ZWZA 1XM3A 1IT7A 4XBSA 2PGFA 1N8IA 1I4NA 3VK5A 4YVXA 3NURA 4HMEA 1SYTA 3WK2A 4IPJA 3BZGA 4B9YA 1B9BA 4JCLA 4LXFA 5BXPA 7ODCA 1L2UA 4E2VA 1EX1A 3URQA 1KFJA 1B3ZA 3K8KA 4NI8A 1OFBA 2JIEA 1KRAC 5JBDA 1SZGA 3G6LA 1EP1A 3FV9A 3S5NA 4WDXA 4PTVA 1ZTVA 3FA3A 3P67A 4H01A 3TTSA 3CUGA 3HIJA 4JD4A 3CJPA 1TMQA 4ZODA 5KSWA 4Y8EA 1XUUA 4MIMA 3VMOA 2FJKA 2PBGA 2HXTA 2HE8A 3EXRA 2GJNA 1KFBA 4HN4A 1JYNA 1AG1O 4ZVJA 1SO4A 3SEPA 1WOBA 1I6NA 3UZXA 1NVMA 3GLCA 3MPGA 2B7PA 5A2AA 3IARA 2VX7A 1IEWA 5HUOA 3C86A 1T41A 3HPSA 2GVJA 1KV8A 3W82A 3GXMA 4D72A 3MV11 3KEHA 2FGLA 4MKVA 4WY0F 1U1HA 5D03A 3TSDA 4UFHA 4P7RA 3C2RA 4OUIA 4MJMA 1OCQA 4JN8A 1SSDA 3N9RA 1VGAA 4ZQNA 4ZA0A 3M7SA 1FH8A 3HM7A 4GE8A 1S46A 3P0WA 2Z1KA 2ZUSA 4WCJA 5AOUA 3W7RA 3W76A 4L56A 4AMCA 5D05A 2Z00A 4FMVA 4FXSA 5CG7A 4HYRA 1X8FA 3I3BA 3T4WA 1I60A 3CZJA 1C82A 1V6YA 1C7SA 1S1RA 3HF3A 4O13A 3ATZA 4WSHA 1HJVA 3IIZA 3IGXA 2CBUA 4DLQA 1JYVA 1TKKA 3QF0A 3R0UA 4G5DA 2G3FA 1WDSA 4JDYA 3T42A 3T6CA 4DUVA 1NP0A 3WL1A 4ATDA 5CXPA 2Z0IA 1NQKA 2CITA 5J8LA 4CCDA 3SGZA 2Z1XA 3WH8A 4GJJA 4J5NA 1QVBA 2WVSA 4Q8WA 2DZVA 4AZ7A 2H3DA 3COTA 4PSPA 4PMOA 4ZO7A 2OSWA 1GJWA 5LNWA 5KMYA 2BDQA 3CAWA 4DWSB 3THUA 2WKGA 3B03A 3PZIA 1DE5A 2TSYA 2CU0A 4O0KA 3EWCA 5REQA 1NSJA 4UNIA 3SY1A 1JCXA 2BXVA 3V0SA 3DFTA 3VD9A 2E5DA 4RW5A 1TYGA 2ZXDA 1A4MA 4EX4A 3W1NA 4Q4SA 5HMDA 3WK0A 4P61A 1W5MA 3VX1A 2CEQA 3W2MA 1TV2A 3A3WA 4FB7A 2HZGA 1WUEA 2QCFA 1JZ3A 1VCFA 2V38A 2X30A 2A6LA 3BTNA 3GVWA 2DY3A 1TPDA 3H2NA 1XLMA 1QI4A 2QUUA 3B0XA 3W24A 1LTDA 3CWNA 1QMLA 4IQEA 3HURA 3CLWA 3JUGA 1UR4A 3W0KA 4GACA 4HNOA 2DSKA 4RE3A 5DANA 4W5UA 2Z6JA 1OX4A 4JPGA 1EUAA 4BFAA 4UZSA 3WENA 4EXBA 4RR4A 1UB3A 5LNUA 2NQJA 4MNKA 4C5ZA 1KRBC 1BGAA 3LI0A 3V16A 1DWIM 5GJPA 1O95A 2ISFA 2XIMA 2AQOA 3PS7A 4N9BA 3KVLA 1PDYA 2IQDA 2EF9A 4JL1A 3H21A 2QV4A 2NQ9A 3PNUA 1WZKA 4R85A 4LYPA 3DG7A 2FZNA 5A3HA 4CQ8A 1Q6CA 5G5IA 3TEVA 1TWIA 4M6QA 3M5ZA 3KLKA 1OK4A 2G95A 2RFGA 4PB4A 1FWHC 2TPSA 2IXVA 2YYTA 3VABA 1C90A 4KBXA 2QDDA 2OSYA 2FKPA 3PY2A 3OLGA 3UWYA 3BV4A 4HZMA 4QQ3A 4MWAC 1B3XA 1LZOA 4US5A 1NU5A 4LOCA 1JUEA 1TX0A 3GDMA 4DAFA 3FCPA 4FNQA 3RJYA 3LB0A 1Q4NX 3W1XA 4ZMGA 3MMWA 1CBGA 1FA2A 4PL2A 1PIIA 6ENLA 1YTEA 4H9UA 4DI9A 1RCQA 2CBJA 4HU3A 2JKEA 4O10A 2W6RA 3VIPA 1AQMA 1DJQA 2QW5A 3CZLA 2OODA 3HG2A 4QDPA 1TE1A 2H9AA 1QW8A 3LBOA 2OOFA 4RNHA 1ZCCA 2EEXA 1WPCA 4BI7A 5HMFA 3OZPA 3RLVA 3QY8A 4OT7A 1AW1A 3H22A 1G4TA 2BNJA 4JNMA 1G4EA 3E12A 3CL7A 2G5WA 5EMYA 1I1XA 3U9IA 2PFHA 3EWYA 1XGEA 3RHGA 2EG7A 5B7YA 7TIMA 5D9NA 3B0PA 2OLHA 4MG4A 3MUCA 2NVDA 2CLKA 3AUOA 2HK1A 3M47A 4BK9A 5GNXA 3GIPA 1U5VA 3AMCA 2DIKA 2I7GA 3FHAA 4NNBA 4C5YA 3NAVA 1L2QA 1ISZA 2L5HA 3SAZA 3H2AA 1DVJA 3VDHA 1OADA 3IJDA 3S9ZA 2Y7FA 1K8CA 1IF2A 4C6NA 2YYUA 5HWNA 1UH3A 4ZENA 2VQTA 2JKPA 4LVDA 4DJDC 3ELFA 1UUMA 2CZ5A 4Q33A 4I3GA 1HZYA 1TELA 2LLEA 3N3TA 1E0XA 3AALA 3BGAA 5FF4A 2VHLA 3G0XA 3AROA 3GR4A 3E2RA 4K8EA 4FI4A 3VDBA 1RP8A 1GVYA 4WKAA 1H49A 3GVVA 2HS6A 4NHVA 4DJEA 1JNDA 5CAKA 1LLQA 4HMCA 1PO9A 2V5CA 3BQ6A 3MBDA 4C7GA 3DHUA 1I2OA 4LS1A 1XLHA 1YBQB 3YPIA 4MUPA 3UA4A 2DUAA 3W72A 3SCUA 3OPSA 3N12A 1J0KA 2QKFA 4I5XA 2VEMA 5IDIA 1HGWA 3OZOA 1GUVA 2QJNA 4FO4A 1R7AA 4HBKA 2CWXA 4B16A 3PN8A 2Z27A 3PTDA 4O14A 5DRCA 4NZ3A 5DBUA 2SFPA 1AK5A 2OU4A 3H2OA 1UJPA 3TU9A 2DORA 1XBYA 3R43A 5FKYA 3F4VA 4DJFD 3ANYA 3LTPA 5E93A 4IIFA 4YMZA 3NSXA 3AIUA 1S3TC 3V35A 1RCXB 3P0XA 5D4YA 5CPNA 3DHFA 3K5XA 4YTSA 1H09A 3UESA 3S5ZA 4UZUA 3TWAA 4Q4MA 1LWIA 3E0VA 2W5FA 2EXOA 3DZ1A 1JCLA 4CD6A 3NUKA 3C61A 3N13A 1LG1A 2DZWA 3QOKA 3UETA 3C2OA 2B4GA 1X1HA 1YDYA 4R7WA 3HBLA 1E73M 3LPPA 1XH2A 3DFPA 4AAJA 1QNSA 2J62A 1IT0A 1HMUA 4HSNA 4R7OA 2NZLA 4UTJA 3GQYA 5C0QA 1Y0EA 1FTXA 3PAOA 1EUNA 4Q8MA 4C6FA 2WXDM 1MZHA 1VFSA 4JQ4A 2BRPA 1FDJA 3NCOA 4ONVA 1Q7QA 1H61A 3GFYA 5IXEA 3H12A 3ANUA 2BX7A 4AW7A 2CYGA 1QU4A 4GYKA 3EWXA 1VR6A 1SFJA 5MF5A 4HSHA 3GH7A 4J9JA 1E51A 1W1IE 4R33A 5M03A 1UMYA 5F2GA 1MYRA 1EFZA 2X7WA 3WLTA 1L6FA 3VNMA 3WLIA 2OYKA 1UKQA 3NQDA 4PTXA 3PZ9A 4GUJA 1F3EA 2NLIA 1NWTA 3ZR4A 1UA3A 4O54A 5K9XA 3A4AA 2GWGA 1LG2A 1KXVA 1T8XA 1OJXA 1RV8A 3B97A 4JTDA 4X63A 1EL3A 4WSKA 4IPLA 1E4LA 4DRSA 1EEXA 3VI2A 1VEMA 1XIJA 2Z1VA 2OXNA 1BXCA 1BWVA 1JUKA 1JL8A 3QFWA 3MCMA 3NIYA 4XKYB 2Q09A 1ZLPA 1Q6RA 3HG4A 1VC4A 4S1FA 4MUZA 4INFA 3N34A 3M46A 1UD4A 2HMCA 1TSIA 1W3LA 3TQVA 5HMEA 2J8GA 4W7UA 3C2VA 4LV4A 2TRSA 1YDVA 3SQSA 1HQTA 4ZE5A 3UG8A 4P8VA 5CGTA 3RO6A 3VILA 5LZLA 1GVRA 1UC4A 1EP2A 2QT3A 2QNEA 2P5NA 3W38A 3MVTA 3VIIA 3DHDA 2DZUA 4IIDA 2R6OA 2V3GA 1S5TA 2NWRA 2XJ7A 5JH2A 2XVKA 2ZUMA 2WNNA 5EU9A 3W81A 5A6SA 1OD0A 4WZHA 1C92A 4GIAA 4A3QA 3IT4B 3TAOA 1FXQA 2HROA 3THDA 2E5BA 5AHLA 3IRDA 4PODA 4EKJA 3ABQA 1WB0A 2YCJA 5KZDA 3PPHA 3W7HA 1GT8A 1XDLA 4OGZA 1S2VA 2Q8LA 2QAFA 4ZB0A 3VOCA 1H1NA 3I3DA 2PZ0A 2GJXA 4ZOBA 3ZT7A 4IOTA 3RM9A 1G1YA 1I0DA 2H90A 1LBFA 4GX8A 2WKJA 3S1WA 3UERA 4WX2A 3ZSTA 4TX9A 1F3WA 3KRZA 3SGUA 2WBGA 1ISYA 1JAEA 2V3DA 3QSRA 4GUHA 4OIFA 4TO8A 2PDNA 1P43A 4ORIA 2HNHA 3R13A 2CHNA 2GSJA 3GH5A 1AQFA 1KR1A 1Z3NA 3GXPA 4PSRA 1P7TA 2OT1A 1P1XA 1XLEA 3K4DA 1ADOA 3MUZ1 3NFUA 1KD0A 4Z1AA 4D1IA 1B4KA 3W83A 2JALA 1JCNA 1SJAA 4NAEA 1W3JA 1RALA 1EH9A 1ITQA 3MKVA 2WOQA 2R1MA 3VNKA 1GQJA 1TPWA 4ZQMA 4J3XA 1RD6A 1UIOA 2ON3A 4HYWA 4H9YA 3TDFA 4LNYA 1TREA 4A8LA 1G0CA 3BL3A 3PG8A 1KBJA 1JPDX 4DX3A 3S2JA 4WGHA 4L6HA 3AUJA 2GQ3A 3LK6A 4TU1A 5CBBA 1J01A 4KEZA 1OK6A 5C5YA 1J79A 5CBIA 1KBKA 4ADTA 4Y9OA 2QLYA 3V5CA 1RLDA 1D3CA 3F4WA 4ADSA 4GKTA 5D2XA 2ZRWA 2XYLA 3EOSA 4DUXA 3WDPP 4MB3A 3QVQA 1K4GA 4YWSA 4X2PA 2OX4A 2H8XA 2Q3OA 3IWPA 4PUMA 3SCQA 3WK3A 4XG1A 5FEZA 4AD1A 2ZTKA 3CAQA 3NQ2A 4B3ZA 1FVPA 4KWOA 4UTWA 4ZCWA 4C6KA 2D0HA 3EDDA 3WLQA 4PTWA 3H53A 3LN3A 1OHLA 4MKNA 4NJJA 4B90A 5H91A 1V6WA 3E74A 4W9TA 3GTNA 1TJRA 2E1WA 2GJLA 8TIMA 3W7EA 4C6QA 1UMLA 3EB2A 1Q3NA 6ALDA 3GAYA 1ZHAA 2PDGA 3TYCA 3P2VA 7CGTA 1AL7A 3SUVA 3VD3A 4PGLA 3OBKA 1G5AA 3VO0A 2QUNA 1EDGA 1TPFA 4GH3A 2D1ZA 4NI3A 2R91A 3UZYA 1L0PA 4DJEC 1XYCA 1CWYA 1ZZMA 1CZ1A 2W4XA 3P81A 2OELA 4O52A 1OFQA 3PAJA 1WQ5A 3G1RA 4CQ9A 2WC3A 1JRBA 4IMEA 3MDUA 3LV5A 5LKYA 1FHVA 4NJIA 2C7FA 4J40A 1AH0A 3TC7A 2VGBA 3VUSA 4L6OA 1CGYA 2GK1A 1J0HA 1GG1A 1RP9A 2HXUA 3P80A 1D7KA 4BQ3A 5FF7A 1NEYA 4IL2A 3WKZA 2XN1A 1E1FA 3BJTA 3K4WA 2Z28A 2VDGA 4KGJA 3IPWA 1XKJA 4Y9MA 3AC0A 4GQQA 4J3VA 3LGEA 4AZCA 3OGSA 3LSCA 1FWBC 4W8BA 2PD9A 4B91A 4E2OA 4XO7A 3QQWA 4QFUA 3AIBA 1BRLB 3LHTA 1DXFA 3QQ1A 3ZR6A 4CN6A 3ARVA 3PF3A 1H50A 3B9EA 1NARA 3QYQA 2G37A 5E9AA 1V08A 2DIEA 3GB6A 7TAAA 2HRWA 4HNNA 5LNVA 3KW3A 3PC0A 2G4JA 2X09A 2QCNA 4GUIA 3EX4A 3M1ZA 1L6YA 2J66A 1K1DA 1SZEA 3SB0A 1IGSA 4HT3A 3RPTA 3PUDA 1EZWA 2A7PA 2QCCA 4JXCA 4O1AA 4B92A 4C6LA 3DERA 2NX1A 5CC7A 1FCUA 1KBBA 3NQ7A 4NYYA 4KFOA 1TPB1 3G77A 5EMUA 1C8QA 4NNAA 5GJNA 1K9FA 2ZBTA 1R0MA 3BSGA 1XLFA 1N8FA 1EGMA 4ES4A 1CXEA 2QCEA 5E5CA 3ZR5A 1E3XA 1AZ2A 3PZUA 4V1XA 1Q6QA 4ZXLA 1D3GA 3NPXA 4LBRA 4FNPA 4GI6A 3BJSA 3TA6A 4E3TA 3KDOA 1I9CB 1ZAIA 5H8UA 5I5RA 3T2OA 1FHDA 1OIFA 1CLVA 1JDDA 3LHUA 4HPHA 4AVFA 3CNYA 3M07A 3GNPA 5BRQA 4Z1DA 2CZDA 3MUY1 2WC4A 2NX9A 2Z29A 1Z48A 1VLWA 3KLLA 1LF1A 3CGTA 2FH6A 3P8IA 4O1DA 5DLCA 4A35A 3L0KA 3T2QA 1P5BA 4YJ5A 1KCKA 4UIOA 4Q8OA 3W71A 1IYXA 3SDOA 2EPLX 2XINA 2CLOA 3BLEA 1DIDA 3ZXWA 2FZDA 3QV8A 1RQHA 4QIUA 5K9DA 3NQCA 3LPOA 2I9UA 3G1HA 5LA0A 1LUCA 4U10A 3UT0A 4CD5A 2Q1FA 1FHLA 3VGGA 1MRAA 3WK1A 1UP3A 4XUYA 4UQAA 4M19A 4WDWA 3UJEA 1DJIA 2XSAA 4QBXA 5AZ1A 3CV1A 4HZ6A 4FLQA 1WKYA 4QSHA 3EKGA 1W9UA