2WMFA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in its native form.
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
555
structure length
555
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIENYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLSGHTGHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 206
structure length 555
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmfA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmfA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmfA02
4ML4A 2ZXBA 3VDAA 5GNZA 4W7UA 1DWJM 1C93A 1W2VA 4Z2JA 1OJPA 3AS3A 5HDRA 1GOOA 3VGGA 7TAAA 3AHTA 1UYQA 1JZ4A 1KB3A 3MMUA 5BXTA 4D1IA 4HP5A 4MNLA 3WF3A 1UUQA 1J11A 4M8UA 3RMEA 1W3LA 1CGXA 3UR7A 3N11A 4CN6A 2WCAA 2PWFA 2W66A 2V38A 2ZIDA 1HIZA 1M03A 3LPOA 1L8NA 4KH2A 4OJYA 1BYAA 4B15A 1KQYA 1VF8A 5BXRA 1QVBA 5DT7A 1JZ8A 2WKLA 4W84A 3VMNA 2UY4A 2QPUA 1V6VA 2J7GA 4DM1A 4GZJA 5CXPA 1AVAA 5AY7A 2AMGA 2VCAA 4WIWA 2OWCA 1ZJBA 1HL9A 2J7FA 1UA3A 1UHVA 2BVTA 4WKAA 2QMKA 3AISA 1W9PA 4Y7EA 4DWSD 3CIVA 1UR9A 3DYOA 4PTXA 3PBGA 1PPIA 4QAWA 2GUYA 1LL6A 1OGSA 1Q6CA 3PZUA 1GUVA 2CKSA 4JCMA 2OSYA 4JKLA 3WQ4A 4J3VA 2XSAA 3TTYA 4DUXA 3CHCA 1KXHA 1R85A 1G0CA 3EDJA 3WDQA 4J3UA 1OSEA 1DWFM 3VMOA 1G01A 1GNXA 3N18A 1OJNA 2W5FA 2MANA 2UWFA 3SCOA 1M53A 2CHOA 4KMQA 2IUZA 2BV9A 1H0IA 3N15A 4M56A 1KBBA 3MMWA 1J9YA 4PCTA 2WKGA 3W82A 1PX3A 3VIHA 2J7HA 4HTYA 3AHZA 4Z2LA 2J47A 4NSBA 1JZ5A 1CGUA 2EPMX 4JFVA 3W25A 4TTUA 3B9DA 2D0GA 4DM2A 1TUXA 1WZKA 2D1ZA 1GONA 1K6AA 2X09A 4H8UA 3A4AA 2WVSA 4W85A 3AXHA 1GQKA 4MAZA 2F8QA 1S46A 1UQZA 5HPCA 4PBGA 3WNKA 2WMJA 4UQBA 3A4XA 1LL7A 2CKRA 1WDPA 2QMJA 4H2CA 1I1WA 2VR4A 2WC7A 2J7CA 1TFVA 4Z2IA 2PWDA 2WCGA 2HVMA 3L4TA 1HJVA 2XVKA 5IXEA 1E5JA 3VDCA 2WDAA 4AZCA 1FP9A 5ABFB 1QHPA 3W6MA 2VZSA 4AZ6A 4UFJA 2XVPA 3SIMA 5C8BB 2BS9A 2DSUA 5CG0A 2WC3A 2BRVX 2XVNA 3A3HA 4KWUA 3ARVA 3EYPA 3RM4A 3MO4A 3U7VA 2YIHA 3WQWA 1XC6A 3VM5A 5IHSA 3THDA 1F9GA 3BAJA 3BC9A 1F1SA 1C8YA 2WXDM 1VFMA 4PMNA 3PZNA 5DT5A 2XFYA 4MADA 2XVLA 3MSDA 4MB3A 3WELA 3VIFA 1HJXA 1UR0A 3I3EA 5D4YA 1KR1A 1WO2A 1XYZA 1TCMA 2CXGA 2VX6A 2DT0A 1A3HA 3LPFA 1OM0A 1BF2A 1CLVA 1UD8A 3VGHA 5LYRA 1TR1A 1O6IA 1CGWA 4JIEA 1E5NA 3K8MA 2WBKA 4CKQA 2W63A 1EO7A 1Q6EA 1J0KA 3VIMA 1C3FA 4FLOA 4QCFA 4D1JA 5I24A 1JAEA 5JIWA 4EANA 2ZUVA 1FHDA 1JYXA 1BTCA 4UNIA 3VGEA 1U30A 3W53A 1K9TA 2Y4SA 1CBGA 2XPKA 4HOZA 4AD0A 1KR0A 1CLXA 4UQCA 1OJOA 3GYCA 3WY1A 4GIAA 2QLYA 2XFRA 3AHXA 3RIKA 4F9DA 1V0MA 2DDXA 5E0FA 2CBJA 3MUAA 4LYRA 1ECEA 1MQQA 1RWFA 3ZR6A 3EMQA 5BXSA 5EFFA 3CHEA 3BAWA 4TOQA 4Q22A 4IPNB 1PAMA 1HKMA 4U3AA 2GSJA 2ZX7A 3AZTA 5CPQA 1HF6A 4X0VA 1M04A 4CU6A 1RWAA 1ISWA 4NRSA 1W9DM 4FF5A 2X8RA 2VI0A 1GOMA 2GJXA 2OWWA 1HKKA 1NP0A 4YHGA 3WDRA 4PMRA 3VD7A 5CSUA 5E6ZA 4OOUA 1E40A 5FCZA 3IAQA 4CGTA 4PYSA 1W3YA 2XGIA 2BXZA 4OBSA 3W24A 2F61A 1LQ0A 4LX4A 2YLLA 3W37A 2OYLA 5CSYA 1KXQA 3O6AA 4AIEA 2BNJA 3AMCA 1NH6A 4AZIA 1CGVA 3PHAA 4A4AA 1C90A 1WB0A 3L4YA 5DEZA 3K4DA 1P6WA 1JFHA 1B9ZA 5DF0A 2VX5A 3RJXA 5BRPA 2PB1A 1E15A 3ZQ9A 2EO7A 5D8ZA 3E1F1 1JXKA 3UERA 5A8OA 3WQ6A 1BAGA 1UKSA 2X0YA 4NRRA 3ZSSA 9CGTA 3FW6A 1JD9A 5M17A 1UWRA 3W38A 3CUFA 1E43A 4PMXA 5EB8A 1HJQA 3RDKA 3IAPA 3PZIA 3RM9A 4MTVA 1ZBVA 1JF6A 2DPEA 4BQ2A 1D7FA 3ZIZA 2DT3A 2EPKX 3ZSTA 2YDQA 4TX8A 4H8VA 4QDMA 4BZYA 1BYBA 3PZTA 3APGA 3TONA 3AICA 1EDTA 2WMIB 1W1PA 3IJ7A 2A3EA 4MJ4A 2PBGA 3BGAA 4EAMA 1G5AA 3GNPA 3WH6A 3CLWA 3ZJ6A 5HBFA 1KCLA 4PRWA 4RE2A 2E22A 1XSIA 2XVGA 1E1EA 4AW7A 3L4VA 3O2LA 3MS8A 3PTQA 1LOHA 1NARA 4PTVA 5JUVA 1QOXA 2E0PA 3U5UA 4J7RA 4XX6A 3CH9A 4CU8A 5AC4A 1UR1A 4WKFA 1CZ1A 3WFLA 5A2CA 3T2QA 4UFKA 3N17A 3UCQA 4C7GA 3EDEA 2FH6A 4D6CA 1XRVA 3KZSA 3AIVA 2FHBA 4UZSA 4P7QA 5CQ1A 5M5DA 1BVZA 2JIEA 3CMJA 4UCFA 4QLLA 1E1FA 1WKYA 2DEPA 1E56A 4GKLA 3VIOA 4LQ1A 1QPKA 3T0AA 2W62A 3AHVA 4WSKA 4E8CA 5I79A 4WSJA 2GDUA 1UD6A 3WF2A 1WZMA 1HJUA 3SCPA 2IXUA 3PTKA 4W8LA 5I6SA 1XSJA 5LA2A 1UD5A 1UKQA 2W61A 3GH7A 3ARZA 3T09A 5GNYA 3OB8A 3S6TA 3GBDA 2XTKA 1V3JA 1ISYA 1W91A 1RPKA 3MV11 1UD4A 1FFRA 2E40A 1E4LA 3N12A 5I5RA 3WKZA 4MB1A 5C70A 1ISXA 1LLOA 2V5DA 4F8XA 1QHZA 1ITCA 4UFHA 4MPKA 1OIFA 4RE4A 1QI3A 2VOTA 1CTNA 3WN6A 1LL4A 4F66A 1GOKA 1E6PA 1FA2A 1VFUA 3WH9A 2WPGA 1QI2A 2YBUA 1GORA 3DC0A 2JEPA 3VOCA 3GDBA 2ZUWA 1OT2A 3CBWA 2WZIA 4D72A 1JFXA 1RWHA 2PI6A 1GOWA 2CETA 4R27A 3SUTA 1WP6A 3WEOA 4JZ5A 2FDMA 3N1AA 2G4FA 4JKKA 3W28A 3PZMA 1SR0A 3II1A 1VJZA 2A3AA 2YLAA 2G3MA 2CPUA 4QP0A 2E9BA 4HOXA 1TVNA 5DMYA 1MYRA 1ZBCA 2WHKA 2X03A 2VTFA 3MUZ1 5CLTA 1HL8A 1HJWA 3NSXA 2CHNA 3F4VA 2ZXDA 1E3XA 4HMEA 4U3CA 5A2BA 2GJPA 4GINA 3WH7A 1W3KA 3OZPA 1HVQA 4DWSB 1EH9A 2NT0A 3OBAA 4YN5A 2G41A 4ATDA 2VQTA 3NSMA 1HT6A 3VIKA 4BF7A 5A69A 3FHAA 2QV4A 3VD3A 3PZQA 4MNKA 5A1AA 2JE8A 3WQVA 1MW0A 5ECUA 1A47A 1LJYA 3WDIA 2WLYA 1NOUA 1KGXA 1J0IA 3BAXA 2B31A 2WC4A 4PUEA 5FKYA 4LYQA 2X05A 5EFDA 1SMAA 3AI0A 1GOIA 1UQYA 1J0YA 1QW9A 4GZIA 1HJSA 1E4NA 4D6JA 1JYWA 3CZJA 4EKJA 2X0HA 3NDZA 3OZOA 2XJ7A 1W1YA 4AYSA 3VINA 1BG4A 2VZUA 2Y5EA 1LG2A 4R5EA 4CCEA 5CGMA 4AXNA 4P8XA 3VGBA 3AS0A 3KE0A 3ARWA 4BQ3A 5A6JA 3VNYA 1W2PA 1JDDA 1I1XA 4AIUA 2V5CA 2D0FA 3SCRA 1OINA 2O9PA 1VEMA 2CITA 4ZE5A 1HM2A 4ZE4A 1B1YA 4RE3A 1QNSA 1XH0A 3VDHA 1GPFA 4IPLA 4YHEA 1JD7A 1KBKA 3EMCA 2E24A 3K8LA 1KGUA 1DHKA 4AZHA 1GQIA 2VVNA 4WLCA 2VZTA 4XZBA 1Q4NX 4P8WA 3U5YA 4D6EA 4P7RA 3L4XA 1N7NA 2JEQA 2ESCA 1R7AA 3SCNA 1E3ZA 3NJ3A 3W29A 3L2LA 2ZUTA 1UR2A 2VQUA 2V3DA 2EPOA 1G9HA 1I8QA 4WF7A 2WCOA 2GK1B 1OD0A 1NP2A 2ZX9A 3L4UA 4P8VA 1VENA 4J3XA 3AMKA 1E73M 4TXEA 1W3JA 4AY1A 1B3WA 3SCSA 1HX0A 2O92A 5E9AA 1CGYA 1B3ZA 3IANA 3FN9A 1J0JA 4HU8A 3QHOA 2BHZA 4UOJA 2VT0A 3DHPA 2J25A 1V6XA 1C92A 2ZWZA 1XH2A 4AEEA 3F5LA 2YL6A 1HMWA 5ABFA 3QHMA 1UWQA 1CEOA 4PMDA 4QCEA 2X1IA 1HKIA 5I3DA 1IV8A 1UWUA 3DECA 5A6KA 3GH5A 1JXJA 4TVDA 4BQ5A 5E0CA 3ZMRA 2GJRA 4JFTA 1JNEA 5A6SA 4B9YA 4U33A 1YQ2A 2W4XA 4BA0A 3BAYA 4B9ZA 4B16A 1ODUA 4PCSA 4UOZA 1VJSA 3CMGA 2IXVA 5I2UA 2BXYA 3PN8A 2YDSA 1JF5A 1E72M 2ZX5A 2WAGA 1KGWA 1RWCA 1C8XA 4OKDA 2NW0A 1HN1A 4HZ8A 1V08A 3VMPA 4ZEPA 4HA4A 1TVPA 2WB5A 3AZRA 3BMVA 3TP4A 3QHNA 3RM8A 5A3HA 2WMHA 1X1IA 5ABGA 1H49A 2YA1A 3T0DA 1YHTA 1JL8A 4ZENA 2XIBA 3ARUA 3VIPA 2PWGA 1V3IA 3AJ7A 3EDFA 2WVVB 1W9BM 1MQRA 3OIHA 1VEPA 5A6BA 1E6QM 2ZWYA 5AYBA 1ESWA 4AMCA 3T0BA 2CCRA 3LMYA 1OT1A 3LPGA 1G94A 1UWTA 4LGXA 2NT1A 3VD5A 1EGUA 1EHNA 4ATWA 3PZOA 4A3YA 1XCWA 1WNOA 1QBAA 1RW9A 4HMDA 2J75A 1W1VA 3ZT7A 5A8QA 1VRXA 3VU2A 5A6LA 3AYRA 5IDIA 2J77A 5EBAA 1J12A 3AFBA 3WL1A 3K4AA 1ZB5A 3OLIA 3K46A 3DYMA 2Z1SA 3WUBA 2WCSA 3CTTA 3BH4A 2BFGA 1CPUA 5BROA 1AMYA 1NQ6A 1QNPA 4W5UA 2EQDA 3AIWA 3VIGA 4PTMA 3GXDA 4CD4A 4JFWA 3TOPA 2WVUA 4CD7A 2E9MA 1V02E 2YJQA 2DSWA 4H04A 4MDOA 1IZJA 2C0HA 3GM8A 1E6RA 3AIEA 1N7RA 3POCA 4D6FA 4M81A 3KL3A 2J7EA 3RPMA 3D5HA 4AIOA 1OWQA 5A6MA 2Y2WA 1RD6A 1UR4A 3N13A 2OSWA 4GI9A 4AZ7A 3WDHA 2VJXA 1H4PA 2W92A 1BGAA 3EBVA 4JHOA 1BVNP 4JKMA 4PMYA 4MB4A 3SUVA 3AS2A 1JYVA 2GDVA 3MUIA 1CNVA 4UQDA 2EXOA 3GH4A 1DWIM 3TTQA 5C71A 2E8YA 1TMQA 1Q6DA 5ABHA 4W7WA 4CD6A 3OLEA 1W32A 2XM2A 5IFTA 4U5IA 2VRQA 1KCKA 1GHRA 3SCQA 5I0DA 3SEPA 1JDCA 4AZBA 3HJEA 4CVWA 2RGLA 4U2YA 2E9LA 1XSKA 4MB5A 3NYDA 3MKKA 1E6NA 2F2HA 5A2AA 4ATLA 4TX6A 1CXFA 5CGTA 1G1YA 3AXIA 1ZBKA 1BFNA 3EDKA 2WSKA 2VRJA 4CD8A 1B3XA 1JZ6A 1FP8A 2VX4A 2WMFA 1WE5A 2WMIA 3WNLA 1X6NA 2YBTA 1NWUA 3W0KA 2PWHA 2YDRA 1N82A 2VR5A 4HOWA 1FH8A 4P7LA 1LXMA 3SCTA 2VCCA 2WW5A 5AC5A 5A8PA 3WMCA 1V02A 2XYLA 3OA5A 3ZO9A 4X9YA 3VGDA 3FNDA 3VD9A 1E0VA 5A8NA 1JG9A 1V0LA 3W26A 1GJWA 4CN4A 3UESA 2G3JA 1BG9A 3UG4A 3ZR5A 5JIPA 5JBDA 1UWIA 3CUGA 4J3TA 2EJ1A 1B90A 1E6SM 3GBEA 2PC8A 1BGGA 1CWYA 1MFVA 4KGJA 1JI1A 7A3HA 1DWGM 3HU7A 3T2PA 4F9JA 1V0NA 2VCBA 5GPRA 5TD4A 4UZUA 3SCVA 5I77A 1KFWA 1V3HA 1ZS2A 4DUWA 3DHUA 3WUGA 4W93A 4TTGA 3CUJA 3QGVA 3ZJKA 4GO9A 4W8BA 1HXJA 3O9NA 2XWDA 1X1JA 2J74A 1XGZA 2ZXAA 4JAWA 3CPUA 2YOCA 2VL4A 3WUEA 4EK7A 3WNOA 2WBGA 4HA1A 3VIJA 1X1HA 2RGMA 3BAIA 2ZE0A 4CD5A 3ZJ8A 1US2A 4MJ2A 3KL5A 1H0GA 5E70A 2WZEA 1HM3A 1J0HA 1SYTA 1CXLA 5D9NA 1GVYA 3ECQA 1I75A 2O9RA 1CXKA 3AMDA 2VNCA 4W87A 2QF8A 1TE1A 3AIUA 3MU7A 3WMSA 1VBRA 1XH1A 4L4OA 1RH9A 1JYNA 2BVYA 3M6DA 5JBEA 3AOFA 2WMKA 1NWTA 1KXTA 1V03A 1XD0A 3MSGA 3N9KA 4D71A 4H7VA 4PSRA 3WDJA 1GJUA 3WD2A 1XV8A 2WANA 4ZFMA 3UG5A 1Y7VA 3AIRA 1ZU8A 2CYGA 1OD8A 3GNOA 2W91A 4ACZB 1NWRA 4AD5A 3IJ8A 3RCNA 4W5ZA 1VFOA 1CDGA 2VUYA 3U57A 3CHDA 1V6YA 3ARQA 1WZLA 5M3WA 4IUGA 4FLRA 3WD4A 4DWSA 3BSGA 1BLIA 5BRQA 2DSZA 2G3IA 3AQUA 4WJXA 5I23A 2FHCA 3ARXA 3OGSA 1MW2A 3A6OA 3CGTA 3SCUA 1UG6A 1QBBA 1WPCA 3WH8A 1GVIA 3SURA 3UEQA 2DIEA 4E2OA 5E6YA 2BRPA 2G3NA 1JDAA 1AQHA 3PZ9A 4PSPA 2XUCA 4K68A 2WNWA 2J78A 3KWXA 3SCWA 1XCXA 2WHLA 2X2YA 2ZUSA 2A3HA 4PMZA 3AIQA 4P7NA 2VVSA 4OOZA 1OGGA 4EE9A 1MVYA 4PMOA 4Z2KA 3TTOA 3UETA 1E0XA 2J62A 3AMGA 2WK2A 2VC9A 2CIPA 3WEZA 5HNNA 2UY3A 4RL3A 4QLJA 4C7DA 1EGZA 3T08A 1DTUA 4GI8A 1MW1A 5M03A 1V6WA 1AQ0A 3QOKA 1H3GA 4HZ7A 3BCDA 1MFUA 2AAAA 4AISA 4UFMA 1US3A 1X6LA 4QLKA 4HPGA 4Z2HA 3CZEA 6A3HA 3AS1A 3SUSA 4OUEA 3ARSA 2DH3A 3VILA 1UKTA 1DWAM 3WD1A 1E9LA 1GW1A 2JIWA 3KEHA 1OB0A 2WYSA 4XB3A 3OGVA 4NI3A 1HMUA 1XYFA 2JF7A 3B9AA 1J0NA 1OJMA 2WWCA 3WF1A 3GTNA 1QI0A 2ZXQA 1V3LA 4N42A 3AXXA 3VO0A 2XWEA 1EO5A 3POHA 2GK1A 2OSXA 2JALA 1UD2A 3NDYA 4JHZA 3VDBA 3WMBA 5CPTA 1NWSA 1BPLB 1UD3A 2D3LA 1CXIA 4PN2A 2VURA 4GQRA 2CBUA 2WMGA 3QOMA 1H11A 1XD1A 1H2JA 3K8KA 5AYIA 1U2YA 2Y8KA 4DUVA 5A8MA 3NUKA 1B3VA 3WF4A 1ISZA 4MNMA 1JGIA 4D6HA 2J8GA 4M80A 1XHGA 2WM0A 5FIPA 3WQ8A 4E4PA 1B3YA 1W9XA 2DSVA 4LXFA 1K9DA 1R86A 2D0HA 4JL2A 5GQBA 3OLDA 2JFEX 2FHFA 1HVXA 3AMLA 4B3LA 2CBVA 3VIIA 3OG2A 4D6DA 2VMFA 4A3HA 2O9TA 1V3KA 1LF1A 1UOKA 2C7FA 3WD3A 1ISVA 1DP0A 2QPSA 4FK9A 1VIWA 2WZHA 1V3MA 4OBRA 1WZAA 3CZLA 1KXVA 4HA3A 2D3NA 2V3GA 3WSUA 2PF0A 3VD4A 1R7OA 4J28A 3UR8A 4XZWA 1FOBA 1N7QA 6CGTA 4FLSA 1PX4A 1X1NA 4X0NA 4IISA 2A3CA 3NCOA 1V6UA 2ZICA 3A4WA 5KEZA 3GZAA 1OCQA 3QR3A 1QW8A 1DWHM 4Z2GA 4J3SA 2CEQA 1KQZA 1E70M 3CZKA 2V3EA 1E6XM 1L0PA 3WL0A 1SMDA 3CHFA 4KRTA 2CESA 4QFUA 1E4MM 1E55A 3A47A 1UZ1A 2WVVA 5LA1A 3L4ZA 4NZCA 5BXPA 1SFSA 2WWDA 4UOQA 3AHYA 1BYDA 1NOWA 5ABEA 1H5VA 1OIMA 3WIJA 2VO5A 3VTRA 1QI5A 3ARRA 1VB9A 4AZGA 5BWFA 1MW3A 4ZXOA 5EMYA 4GZEA 2XFFA 4PMQA 1CB8A 4AD3A 3UG3A 4PUDA 4JCLA 4CN1A 4ZXLA 3GXFA 1FHLA 3DYPA 4GQQA 3MANA 5IHRA 1H1NA 3LPPA 4LYPA 4JFUA 3CUHA 2UY5A 4HPHA 2CERA 1UWSA 2BHUA 1LXKA 3VVGA 4CUCA 1UR8A 3GXIA 1AQMA 2O9OA 4BQ4A 3K1DA 3WNMA 2OYMA 1B2YA 5DO8A 1K9EA 4GPNA 3FAXA 4H8HA 2W67A 1VEOA 1MXDA 1MWOA 4AZCB 2EBNA 4TVUA 1CENA 2NSXA 3VGFA 5D8WA 4L4PA 3WEMA 2BY0A 1FFQA 3L4WA 1EQCA 5HXMA 1RWGA 4PMVA 1C7TA 5E09A 3ZM8A 1UKPA 4DWSC 4HU0A 2VRKA 1PX8A 1H09A 2YKKA 1LWHA 3MMDA 3FHQA 3W81A 1GOQA 2YL8A 2Q8XA 1ZL1A 1J18A 1W1TA 2VZOA 4F79A 3PZVA 1LG1A 1M7XA 1UZ4A 1K9FA 3VKKA 1WAWA 2BHYA 2J7DA 2ZUNA 1Z32X 1C8QA 3VNZA 3WDPP 5HPOA 1B30A 4MNJA 2HISA 1W9VA 4UFIA 3BSHA 1ODZA 3ARPA 1E6ZA 1FH9A 3AZSA 5KZ6A 1RP8A 2XGBA 1CXHA 4FLQA 2WLZA 2AOSA 3BLKA 4D6IA 2PBOA 4P7OA 3WNPA 4B3KA 4W8AA 4J27A 3B9EA 5D9PA 3WUFA 3VUPA 3MUY1 4YPJA 4CCDA 3WQ5A 4LPCA 4V28A 4ACYA 1VBUA 4E8DA 1EDQA 4Q7NA 2EEXA 2J7BA 2DSKA 3N04A 3ZT6A 3W6LA 7CGTA 3BAKA 5FL1A 5D9OA 4AWEA 2D20A 3ARTA 3M7SA 3S2CA 3T2OA 5BCAA 4CCCA 1E71M 4U2ZA 6TAAA 2BY3A 3NSNA 3AYSA 3BMWA 3OLGA 3D3AA 5FD0A 2Y24A 3FAWA 3SUWA 2A3BA 5FL0A 3HMCA 1EOKA 4U5KA 1JIBA 3GXMA 4S3JA 4J3WA 5F7UA 3VX0A 1J10A 1PIFA 3FXYA 1KWGA 1MXGA 5IFPA 1J0ZA 2Q1FA 3BCFA 2FH8A 2GFTA 1R87A 4W88A 2YA0A 4M29A 4IM4A 5A6BD 5CLWA 3EDDA 2DT1A 4PMUA 1QNOA 4XV0A 5BYWA 1D3CA 2ZX8A 3VX1A 2GJXB 3PZGA 2DT2A 1PZ2A 1WCGA 4CVUA 4KRUA 1CGTA 1N7OA 2CBIA 3CZGA 3G6MA 1R8LA 1J0MA 4GI6A 2FGLA 4OZOA 1J01A 3ZJ7A 1BQCA 2OWXA 2XIIA 1EIBA 3M46A 3GNRA 2ZX6A 2JF6A 3WFZA 1W3HA 1CIUA 1B31A 1OGBA 4M24A 2ZUUA 1RP9A 1C91A 2YL9A 3ZT5A 4TUFA 3ARYA 1HN0A 2D24A 1JZ7A 5D9MA 3VM7A 4M82A 1IT0A 2TAAA 2E4TA 1Q6GA 3W27A 1TG7A 5GNXA 4N0RA 3IJ9A 3JUGA 2BY1A 1M01A 4AD1A 1WDQA 2WSPA 4UQEA 8CGTA 1VFFA 3CUIA 3THCA 2XG9A 4URIA 2YA2A 1TA3A 1UH3A 1PJ9A 2BVDA 4WKHA 1GZJA 2EPLX 2WHJA 4S3KA 2J8FA 3HN3A 4H41A 3I3DA 1BHGA 3IK2A 3RILA 4W89A 4AEFA 1N7PA 3U7BA 5A6AA 2YL5A 1V0KA 4V2XA 5LA0A 3TA9A 1UH4A 5CZKA 3CO4A 1EDGA 4W7VA 3BXWA 2OYKA 5I78A 2XM1A 1UH2A 4WK9A 1JI2A 1JNDA 1WDSA 1GQLA 1MQPA 1LWJA 2D2OA 2DH2A 5CJ5A 1VAHA 2PWEA 4TVCA 2XHYA 1HKJA 3VPLA 3ALGA 4UR9A 3WH5A 4KGLA 1TA3B 1QNRA 1CECA 3G6LA 2Z1KA 3AIBA 2XSBA 3MV01 3FY1A 4ACZA 1B0IA 2DIJA 1C7SA 1EA9C 1PEZA 4AZ5A 4P8UA 1E0WA 3WENA 2FGZA 4GXPA 4UFLA 3AROA 1WDRA 4MAVA 1UKOA 3J7HA 4GO8A 1GCYA 1W9UA 4UQ9A 4AC1X 1JAKA 3M07A 1TZ7A 1GHSA 3EMZA 4OIFA 2D23A 2WHMA 2Y8VA 4XUYA 1UA7A 1F4AA 1O7AA 4FMVA 5CPSA 1ITXA 3CZ8A 4NF7A 1JZ3A 2E3ZA 1IZKA 2ZOXA 3ZOAA 4JFSA 4C7FA 2J79A 4AD2A 3RJYA 4BS0A 3L2MA 5FOOA 1OBAA 3WD0A 3W4RA 3SUUA 1PZ3A 2DGAA 1DEDA 1EOMA 3PTMA 1BSIA 1HP4A 1Q6FA 2G8ZA 4UTFA 1C82A 4HMCA 1JZ2A 4D6GA 1FH7A 3I3BA 3TTSA 2WVTA 1HP5A 3KL0A 3WF0A 4BCEA 5A95A 3B8SA 4PEEA 2QHAA 1EXPA 1QNQA 1U33A 4CU7A 2CNCA 3RO8A 1EHAA 5DFAA 4AD4A 4V27A 1ZJAA 2OLHA 4HZ6A 5HOSA 3F5JA 4PTWA 1PIGA 2DQXA 3WBAA 4M1RA 2D22A 2BY2A 1D2KA 1QHOA 2C8NA 3WNNA 3F5KA 4MDPA 2UY2A 2V3FA 3NIYA 1ZBWA 1EQPA 1GQJA 8A3HA 1HNYA 2VX7A 3OGRA 1CXEA 2BRWA 1BYCA 2E8ZA 2EPNA 1KWKA 1NOFA 3BLPX 4W86A 4JL1A 1H41A 5A94A 5JBFA 2ZUMA 1CYGA 4UQAA 3ALFA 1PBGA 1QI4A 2GVYA 1NM9A 3WBEA 2J4GA 1E4IA 4U31A 1F4HA 2VZVA
chains in the Genus database with same CATH superfamily
1FWNA 4ML4A 3GX9A 4JX4A 5GNZA 3FJ4A 1TELA 3VZYA 3VKCA 1W8SA 4QSFA 1OJPA 1GOOA 3VGGA 3KBVA 3AHTA 1R3WA 1JZ4A 5BXTA 1TPEA 3FK4A 2Q8LA 4LV9A 1W3LA 1CGXA 3A4JA 2FYMA 1LRNA 2WCAA 3I10A 3W2KA 2PWFA 1ALDA 2ZIDA 3LPOA 1L8NA 4JDYA 1BYAA 6ALDA 4NU7A 3W76A 4B15A 3OVPA 3SZ8A 5M1TA 5DT7A 1XR2A 4ICCX 4IX0A 5HNRA 1QDSA 3QTPA 3W7QA 4HZMA 4DM1A 1EB3A 5CXPA 4I5XA 1AVAA 1RALA 2J7FA 3SM0A 4WD0A 1UHVA 4WKAA 3AISA 4OE7A 3B0VC 3FV9A 5FEWA 4DWSD 5AHNA 4YIWA 1UJQA 3UW6A 3DYOA 2CWXA 3G1SA 4JTUA 4QAWA 4XAFA 3PAOA 1YPFA 1LL6A 1I8JA 1Q6CA 4ML9A 2HNHA 1GUVA 4QSHA 2DU2A 3WQ4A 1TMLA 2XSAA 4YL2A 4DUXA 4PB4A 4BWLA 5DMMA 1KXHA 4GY0A 1WXYA 4DX3A 1DWFM 1HUVA 5EL1A 1OJNA 3A3XA 3CAWA 4C6KA 1EKOA 5I06A 3CL6A 2HPMA 3LCLA 4KMQA 3QPYA 3ZVHB 2BV9A 4LBSA 4LBRA 1ME8A 2KXRA 1H0IA 3N15A 1KBBA 2PD9A 3MMWA 4PEKA 3IV3A 2V2CA 4HTYA 1HKVA 2J47A 3UPWA 2EPMX 4DM2A 1WZKA 3EA2A 1JDFA 4H8UA 3A4AA 4ZQCA 2PD5A 3AXHA 1ICPA 1JVNA 2F8QA 2NX1A 2YX0A 3NXLA 2OLAA 4GVFA 1TFVA 3G24A 4NVTA 2PDPA 2OKTA 1E5JA 3VDCA 4JIQA 5CZTA 3LHVA 4AZ6A 5C9RA 2BS9A 4A3QA 1O0SA 2IPWA 2XVNA 4DF0A 3V36A 2FVKA 4KWUA 3ZLHA 1IIGA 1TQXA 3KLKA 3RM4A 3UXLA 4LAZA 3WQWA 1XYAA 1XC6A 3VM5A 2X1SA 1GEHA 2R1MA 3THDA 1KRMA 4N9BA 1J5TA 1REQA 3MHGA 1VFMA 3ZVIA 3BW2A 2O7SA 1GQNA 4MUPA 3TYEA 3ITGA 2YEPB 4HHPA 1KR1A 3HQPA 3SGZA 4P61A 3WBXA 4L61A 1SJDA 3R8HA 4Y9OA 1BF2A 4PODA 1UD8A 2IS7A 3TOYA 3VGHA 1E5NA 3K8MA 1L6FA 4E3VA 4CKQA 3TDFA 4FA3A 1EO7A 4QCFA 4EANA 2ZUVA 1JYXA 4FX6M 4DLOA 3HG5A 4UNIA 1YTKA 1SO6A 3UP8A 3UZZA 4B5WA 4GFSA 1MSSA 4MF4A 1CBGA 3L0KA 1PYMA 2YXGA 4UQCA 1X38A 4C5YA 3LNMA 3WLIA 2QLYA 2XFRA 3AHXA 3RIKA 3GFYA 4DQWA 4FZIA 4LYRA 3ZR6A 1OEPA 1XIDA 4QDWA 3CHEA 3BAWA 4LC6A 4TOQA 2I16A 3IUDA 1PAMA 1GVEA 4GFIA 5AVHA 2ZX7A 3CYVA 3AXKA 2JBMA 5CPQA 3VKDA 4X0VA 4CU6A 5LXXA 2A4AA 1ISWA 4FF5A 2X8RA 5ABTA 1GOMA 4LCRA 2ACRA 4QG8A 2GJXA 1L2UA 2ZBTA 4XQ6A 1NP0A 2DQWA 4DY1A 3PPCA 5C0QA 4TV6A 5E6ZA 1E40A 4LJ3A 5DCBA 2YXOA 2XGIA 2YLLA 1QATA 2PDGA 5CSYA 3PQIA 4DXXA 4JX5A 2Z1XA 5TIMA 1NH6A 4O1BA 2NXGA 5FJPA 3PHAA 2NXHA 1C90A 5DEZA 4CEUC 1RBAA 5D03A 1RXOB 1XIEA 3L2IA 1Z42A 5C54A 4ZTYA 3ZQ9A 2EO7A 5D8ZA 1JXKA 2DVUA 1BAGA 1UKSA 1RCOB 1TYGA 1E9IA 4NRRA 2F6UA 1UWRA 4PMXA 4IIDA 2Y62A 1THFD 5HULA 2DPEA 3O06A 2BLEA 2P0OA 4GQGA 3F7JA 3WQDA 4G2DA 4O53A 4RUBA 1DE5A 3APGA 1ZCCA 3UWEA 2QIWA 3GIYA 3AICA 3LLDA 3LLFA 3IJ7A 1LROA 1A3XA 1IGSA 2GSEA 1RQHA 2NQ9A 4FHAA 3H26A 3ES7A 3GR8A 1ZZMA 3MS8A 3PTQA 1BEUA 1IEVA 3ITYA 3FKKA 1OCJA 5JXQA 4PTVA 1QOXA 3NQEA 2V2DA 2DZAA 5AC4A 3Q45A 4YNGA 3A9BA 1HFBA 5A2CA 4JNMA 1S3HA 5U4NA 2QS8A 4FXRA 2FH6A 3EDEA 3WBYA 3KZSA 5FSDC 4P7QA 5M5DA 3B40A 1BVZA 4UCFA 4QLLA 1RPXA 5CJMA 1Q6LA 2AL1A 2VEKA 3DH7A 1QPKA 3FXGA 4QRNA 2P3EA 3FOKA 4E8CA 2UZ9A 3WF2A 3MP5A 3SCPA 4XIMA 4W8LA 1V8EA 3LQGA 1XW8A 4C6PA 3ARZA 3NQCA 3T09A 5GNYA 4PA8A 3GBDA 1W91A 3MV11 4Y9PA 4FNSA 2E40A 1DIEA 3QR1A 1F3XA 5C70A 1ISXA 1KA9F 4BI7A 1Y0EA 3R13A 3RITA 3LHYA 4FNRA 2QUTA 4S2BA 1DJIA 2WQPA 1CTNA 3WN6A 1DQXA 5C9WA 3RPDA 1E6PA 3DI1A 1VFUA 3EPOA 3WH9A 2POZA 2YBUA 3DC0A 3B9NA 4US5D 3GDBA 5MKGA 2ZUWA 2WZIA 1JFXA 3QLDA 2PI6A 1GOWA 4R27A 4YMZA 1XYLA 3SUTA 1KLZA 1TJ1A 2FDMA 4UMBA 5HANA 3SJ3A 4JTEA 1P0NA 1NAL1 2G4FA 3LSCA 3H23A 4V1XA 2Z28A 2PP1A 2Z2UA 4IFKA 1TVNA 2YW3A 3VKBA 2WHKA 2VTFA 3MUZ1 2X1TA 3KDNA 4DJED 4RDVA 4QNEA 3S0CA 2NQ5A 2CHNA 2ZXDA 1A5UA 1LTDA 3OZPA 3OBAA 1XIIA 4YN5A 1RVGA 1W8GA 3NSMA 3PC0A 5G4EA 2B7PA 3EX2A 1MW0A 3RU6A 4KCUA 4O10A 2WLYA 3PPFA 2P8BA 1KGXA 3K30A 3UWUA 2PUZA 5FKYA 4HHHA 5EFDA 3AI0A 4G8TA 4FAMA 1UP0A 1YX1A 1HJSA 3L5MA 4TU1A 4NJJA 1QWKA 1YRRA 3CZJA 4EKJA 2F9RA 3OZOA 1W1YA 3VINA 1BG4A 1LRTA 3T1GA 1LG2A 3N2CA 4P8XA 4LCSA 1OYBA 3DHFA 4GUHA 2V81A 4IICA 4JQ2A 1MI3A 1XI3A 4UXDA 2PDYA 3QKEA 1XH0A 3Q4DA 2ZC8A 4YHEA 2GWGA 1KBKA 2GUBA 1DHKA 4AZHA 4QR6A 2VVNA 4WLCA 4KF1A 2VWTA 2YYTA 2EG7A 3PVFA 4F0HA 4P7RA 1N7NA 4RK8A 3PBVA 3GHRA 3G3MA 1E3ZA 3W29A 4PB3A 2HPIA 2I5GA 2VQUA 2EPOA 1ITUA 5E9XA 2G95A 1I8QA 4FSAA 2WCOA 4DXVA 5FSEC 2ZX9A 4MWAD 4J3XA 3AMKA 1U1JA 4TXEA 2NV9A 4C1NB 1B3WA 2WM1A 5E9AA 4NYUA 1EP1A 3VOFA 1AUSL 3M0MA 4HU8A 3GHTA 3PNZA 3DHPA 2J25A 4DJDA 1V6XA 2ZWZA 1IWAA 3F5LA 3TR2A 5IBXA 1HMWA 4JTLA 4MFEA 3QHMA 3L5AA 1JCXA 1IV8A 3DECA 1R38A 4FXJA 2I5QA 3ANVA 1D8WA 3ZMRA 3QMTA 4E3TA 3T6CA 4Y2WA 4KEVA 1NJJA 3L65A 4BA0A 2HS6A 1OF8A 4B16A 1ODUA 4PCSA 5K7JA 1VJSA 1AW1A 2IXVA 1J2WA 4NXSA 4KW2A 1YXCA 4KWWA 1GVSA 2WAGA 4NZJA 3BG9A 4HA4A 3P6LA 1TVPA 4S3EA 3TP4A 3OOQA 3TVAA 2WMHA 1K8CA 1AJ2A 3S42A 4GYFA 2YA1A 1YHTA 1JL8A 4ZENA 2XIBA 1HO1A 1NF0A 3EDFA 4ZSTA 2WVVB 3WJXA 1W9BM 3ITXA 1EXBA 4YTSA 1K8ZA 4U10A 4GI4A 1Q6OA 3SRDA 2P3ZA 2PF8A 4HK5A 4LGXA 1AG1O 3LZ3A 4YLWA 4R3UA 1KM2A 2C16A 4CNOA 1WNOA 2GVGA 4HMDA 3EWYA 1KTNA 3WJSA 3ZT7A 2NUYA 1H1ZA 5A6LA 1MMFA 1EJWC 1TV8A 4XZMX 3PUDA 5IDIA 2Q71A 3AWOA 1LCOA 3IUHA 1UBSA 3ABQA 1QK0A 3DN5A 3C2FA 1KFLA 3LGDA 3SDOA 2X2GA 3SQSA 2Z2BA 3BE7A 3CTTA 4GX8A 1AMYA 3YPIA 3BLIA 4JTJA 3W7PA 2VFHA 1ME9A 2WVUA 1F6YA 4I8DA 4IP5A 2DSWA 1CCWB 5TBOA 2C0HA 1N55A 4KEZA 3TX9A 3GHUA 3AIEA 4QJ3B 5HAOA 1G7UA 3M16A 2J7EA 1SPQA 5D02A 3OU8A 3THUA 1SSDA 3NZRA 4Q33A 5A6MA 5J5DA 2Y2WA 2BWGA 1UR4A 3N13A 3IWPA 3UPBA 4AZ7A 3WDHA 1RLDA 3N4FA 8TIMA 3GFZA 4JHOA 2VGFA 3KS5A 4JKMA 4MB4A 4Q4QA 3H8AA 3AS2A 1RQEA 4UQDA 3LOTA 1Y8BA 3MI2A 3TTQA 2E8YA 4FNPA 1TMQA 1LM1A 1LRQA 2QR6A 2E6AA 4E2VA 3GXPA 2OGJA 3OLEA 3HV8A 1RUSA 4LAKA 1W32A 2XM2A 5IFTA 2ZTJA 4HT3A 3W85A 4KEMA 4HYWA 3I7QA 4WDUA 4GISA 4UTIA 4QNWA 4DHGA 4JYFA 3A9IA 1S5VA 3EPNA 3RRAA 4XBSA 1RCXB 1XSKA 2HBVA 3NYDA 5CBIA 4DAIA 3W7IA 1Q8JA 1KCZA 2YZ5A 3LCWA 5CGTA 1G1YA 1RVKA 2GYIA 1JZ6A 3WNLA 1X6NA 3LHWA 2D2GA 4A35A 5HUPA 2YDRA 2EG6A 3HPSA 4FP1A 4GBUA 2VCCA 5AC5A 3Q67A 5FJRA 3W83A 4PFMA 3PS7A 1IHIA 2J66A 4C6OA 3DENA 3CUXA 5AB3A 3OEXA 1OFAA 3NG3A 1GJWA 2IPGA 4ROPA 4GJIA 1F2JA 1DXIA 3JR2A 4J3ZA 1BG9A 2FDSA 1UWIA 2VWSA 1JDEA 3CUGA 1B90A 3VNKA 2PGEA 3SGUA 4LC8A 4Q8TA 2R91A 2ZZ2A 1BGGA 4UTWC 4FOKA 1KC7A 1CWYA 1MFVA 1JI1A 7A3HA 4JTAA 2VCBA 5GPRA 4UZUA 3SCVA 1V3HA 1KFEA 4DUWA 4OUIA 3DHUA 3WUGA 4GK8A 2PTZA 2V68A 3LCGA 3S5OA 3ZJKA 1F7BA 4DJFD 3O9NA 3WQGA 1R0MA 4LUSB 3TYZA 1JPMA 3M1ZA 3EB4A 4GIEA 4K7YA 1XGZA 3ITVA 3AAMA 3WLSA 4MUZA 2YOCA 3H24A 3E3HA 3WUEA 4HPJA 3BPWA 1X1HA 1YDYA 4CD5A 4ZOBA 3KL5A 1Z44A 2HE5A 1J0HA 4NG3A 1CXLA 1GVYA 1TUFA 1I75A 5U7SA 4DO6A 4LVBA 3T81A 2C1HA 2CXEA 1TE1A 1X7IA 4IL2A 3WMSA 1PXGA 4QROA 3N25A 1GG1A 3E0FA 4XD6A 2YYUA 2A7PA 4DPQA 3AOFA 1PYFA 1FRBA 1V03A 4H7VA 2GQAA 4KQNA 1LOQA 3UWWA 2NVCA 5HWMA 1AA1B 3T0CA 3MZNA 3UXAA 1AW5A 1FWGC 1CDGA 3U57A 1V6YA 3WLRA 1XLKA 4DWSA 3MYPA 1BLIA 4GVGA 2G3IA 3AQUA 5I23A 3QFEA 2BMBA 3Q2DA 1XGDA 2W0UA 3A6OA 3CGTA 3NZPA 1B4KA 3GG0A 5D30A 5IDZA 1SGJA 2PRLA 3UEQA 1H50A 5C7HA 4E2OA 5E6YA 3W02A 1F9CA 1KKOA 2QPXA 1AQHA 1FXPA 2XUCA 3A5VA 2VFEA 4IIHA 3GUWA 1KNWA 4D8LA 3OW1A 2ZUSA 4X2RA 3TJXA 4ZQOA 4P7NA 1OGGA 5CZJA 3W73A 3LRLA 4L6HA 1ZAIA 3BOXA 3STCA 1WUEA 2VC9A 5HNNA 3NPUA 3W3OA 4C7DA 5M03A 5A5WA 3VZXA 2CLIA 3QMSA 4JIHA 3W75A 1MFUA 4AISA 4UFMA 1US3A 2ZADA 3MA8A 4HPGA 3CZEA 6A3HA 1IT8A 3I6RA 3AS1A 3SUSA 4QGCA 3ARSA 3VILA 2E5BA 3GE7A 4L64A 4GC3A 1XGEA 3B06A 1GW1A 2GVEA 2JIWA 3KEHA 4NI3A 1RA5A 1LORA 1XYFA 1OJMA 3URQA 1QI0A 3S1WA 3CQHA 2RDTA 4N42A 4DN1A 3VO0A 3BVJA 3PG8A 1XXXA 3NDYA 1GVRA 4R33A 4DUOA 3WMBA 1NWSA 1BPLB 4L9ZA 3BK0A 1CXIA 4IMCA 4GXMA 4LV4A 1MEHA 2CBUA 4X3ZA 1XD1A 2Y8KA 3LCHA 1F05A 4M80A 4R7WA 1X97A 3E5PA 1XHGA 3SR7A 3LEPA 3IK4A 3GNDA 4KWOA 3OZMA 5F4SA 4RW5A 2DSVA 4KCWA 1EPVA 1FVPA 3DBPA 5GQBA 3OLDA 2JFEX 5DANA 3AMLA 1F74A 2CC0A 1XPGA 3KM8A 1V3KA 1JJKA 1UOKA 3PWGA 4O1CA 1XFCA 3LV6A 3W1UA 1WZAA 4AWUA 2J9YA 3OVRA 2PF0A 4AY8A 4XZWA 3JRKA 3RF9A 1X1NA 2VXNA 4IISA 3A4WA 1CB2A 1OABA 2HBXA 3ONCA 3WJZA 3S46A 1DWHM 3FYOA 3FCPA 1Y65A 5AC8A 2XIMA 2V3EA 3TAKA 3WL0A 4K1GA 1S39A 4KRTA 2CESA 4QFUA 1UZ1A 4PRTA 5LA1A 1Q85A 1GGOA 5BXPA 3L0NA 5HINA 1SFSA 3AHYA 1EX1A 1BYDA 4GGBA 5ABEA 4DPPA 1IR1A 3WIJA 5I00A 1JUBA 1DYSA 3MKCA 4AZGA 5BU9A 3VE9A 4GXWA 2PE4A 1TTIA 2HK0A 2PTDA 5BOOA 3DG6A 4PMQA 4XAYA 4QXIA 4MY9A 3W1AA 3LXAA 4AD3A 4C6NA 4CQDA 1BKSA 1FKXA 3ABZA 3KOZA 1WA3A 3D3FA 2D2HA 1FHLA 1FHVA 5E1QA 3LPPA 2PTYA 1FXQA 4JFUA 4RLIA 3KBUC 2G50A 4WOZA 3SFWA 1UWSA 3WQPA 4N2YA 4CUCA 5SWUA 4C60A 2A7RA 3KCJA 2O9OA 4BQ4A 1TREA 3ZZ1A 1VCGA 4RV3A 1TX2A 3P80A 1CENA 2NSXA 3T4WA 4C1KA 2HWGA 1MNZA 2GGGA 3DBNA 4G56A 1RWGA 4Q6XA 2I1OA 5CSRA 2GJLA 1C7TA 5FF0A 1UKPA 1H09A 2GVJA 1GOQA 1VLWA 2YL8A 1XDLA 4X63A 1JRCA 3PZVA 1LG1A 4PUJA 1M7XA 1H7NA 1UZ4A 1K9FA 4O1AA 1RA0A 3TN6A 1C8QA 1OFPA 1MUWA 3ATZA 5HPOA 4LUTA 2R82A 5I02A 1XYBA 1OK6A 1TPFA 1U5JA 4FX8A 2HISA 2INZA 1W9VA 4M5PA 4H9MA 1ODZA 4L4MA 4IFOA 1R3TA 3AZSA 3BCJA 2XGBA 3P67A 1S5WA 3EWDA 4P7OA 3B9EA 3MUY1 4JIIX 4CCDA 3WQ5A 1SU5A 1KM1A 3RMJA 4ACYA 2QDGA 1VBUA 4E8DA 4Q7NA 3ABRA 3TKFA 3N04A 3ZT6A 3H22A 3W6LA 3G1YA 4ZR8A 1QJWA 5FL1A 3EWXA 2OQLA 3CWHA 1K7XA 3B03A 3OLGA 4IZGA 5I09A 3GUGA 4N02A 2RAGA 3VKAA 3FAWA 1JR1A 2OQHA 2RDWA 4BF9A 3EWCA 2FVMA 4J3WA 4LSBA 3QSTA 4XTIA 5F7UA 4H9ZA 3EB2A 2PEVA 3RAOA 3NGFA 1EWDA 1DJQA 3QBUA 4O4VA 4F0RA 3C52A 1RJRA 3U2ZA 4IM4A 5A6BD 2REQA 3VFCA 4Q6JA 2Y61A 3N3MA 1D3CA 2ZX8A 2OJPA 3W84A 2AAMA 3GR7A 2GJXB 3N19B 3PZGA 4JTIA 1JCNA 2HCVA 4NYYA 5LGZA 4US5A 1I2NA 4KRUA 2CBIA 3CZGA 4NL1A 1R3RA 1AD4A 3DGRA 3G6MA 5T9BG 5I3IA 4H9XA 3W7NA 1J01A 3ZJ7A 1BQCA 4WGHA 4FR1A 4FX7A 3CIXA 3M44A 1EJTC 1Q6QA 3GNRA 3SQLA 3RNDA 1W3HA 4HNLA 2VFFA 1XLAA 2MNRA 4DEFA 3ARYA 1ONWA 2PDNA 1EIXA 1N8FA 1YBQA 5AKQA 3NQ6A 3WLTA 5HNTA 3W88A 5H8UA 2E67A 4DJEA 1VCFA 4OQVA 1FUYA 4N0RA 3L9CA 2YBVA 3H2FA 2BY1A 4YVPA 1WX0A 2WSPA 3W7DA 4XZLX 4UQEA 3E9AA 3CMFA 2GWNA 1DXEA 5MHBA 1UH3A 2V69A 4YXGA 4DBWA 1DJXA 1GZJA 4XWUA 2WHJA 1IEQA 4XK2A 3RILA 4W89A 3U7BA 5A6AA 4AC7C 3GD6A 3AU6A 5LA0A 1TZ9A 3CO4A 4D8AA 2OEKA 3LYEA 1WDSA 1GQLA 1OYAA 3TN5A 1UP3A 4HU4A 4QEEA 5D05A 4MJZA 2PWEA 4TVCA 3CC1A 1DOSA 3ALGA 3W1LA 4J4KA 1TA3B 2CFFA 2Z1KA 2XSBA 4DRSA 3MV01 1LBLA 3MSRA 4WRHA 3SSJA 3FY1A 3KBJA 4QJ1A 3HF3A 4NX0A 4HK7A 1A5SA 1OK4A 3SIZA 4P8UA 4Q4MA 3UR5A 3URAA 1E9ZB 3S2JA 1UKOA 4R7JA 1GCYA 4UQ9A 3ONBA 1TZ7A 5IOBA 3M0YA 3UU0A 2QUMA 4XUYA 3W7EA 4FMVA 5CPSA 3DU0A 1JZ3A 1FX6A 2C6QA 2E3ZA 1IZKA 2PLKA 2RFGA 2VM8A 3RJYA 2I5IA 4ALDA 4JTKA 3TQPA 4XAPA 1AFSA 1O4UA 1JCTA 1Q63A 3C4UA 4L9YA 1DXFA 1VJIA 4XSLA 3SUUA 1PZ3A 1PWLA 3S5YA 1DEDA 1Q6FA 4JS3A 1A50A 2NQLA 3WLHA 2J13A 1DJGA 1C82A 1I2PA 4HMCA 3BO9A 1FH7A 4I7WA 3KL0A 4TMBA 4MWAA 1U33A 1I2QA 3BV7A 4HPNA 5DFAA 3U9IA 2PLJA 3TXZA 3I6EA 3TZNA 2PWVA 5HOSA 2IPFA 1PIGA 4C5ZA 5MKGB 2B7OA 1M7JA 3TN3A 2I56A 3TJIA 4K38A 3W1XA 4HTBA 4IP7A 3F5KA 5K2ZA 1VR6A 3INPA 2E6FA 4LY4A 5D2XA 3SJNA 2GJNA 2QDDA 2HROA 4PBFA 1I60A 3UJ2A 3R11A 1PCWA 1L8PA 2EPNA 4QIUA 5CAKA 2P5NA 4MZYA 4IFKB 1IQ8A 1CYGA 2QJIA 2XH4A 2ZRYA 2GVYA 1A80A 2RJGA 4HBKA 1EYWA 4IQJA 2ZXBA 3FEMA 4MZ1A 4H7CA 5T91A 2HJPA 1C93A 1XLFA 1IF2A 4K8HA 1S5MA 1ONEA 2YCJA 1M3UA 3GC2A 5HR6A 2JKAA 3WF3A 1UUQA 4M8UA 3RMEA 3U2EA 1H63A 1TV4A 3UR7A 3EKGA 1NDVA 3N11A 3GG8A 3GTIA 1JGMA 2W66A 2V5JA 4KH2A 3H6OA 1OZMA 1KM3A 2WSQA 2PGFA 4W84A 3VMNA 3NZGA 2J7GA 2JK2A 2QCHA 2NVDA 2INEA 1K4GA 4HJFA 3RX2A 4V33A 4CQ8A 1MNSA 4K8EA 2VCAA 4KIRA 3GDKA 2I57A 1HL9A 2P50A 4Y7EA 2P0IA 1S2UA 9XIAA 1QO5A 1UR9A 1OZQA 2YFOA 4LB4A 4PTXA 3PBGA 2OCZA 1UBPC 4GOAA 2CKSA 4Z0SA 4CEXC 3KHJA 3TTYA 5AHEA 3CHCA 1W5QA 4FNUA 1S38A 3HZ3A 1OSEA 1G01A 3DFHA 1PS9A 3OVGA 4DWDA 4O0QA 1XBXA 1Q5MA 4A22A 4JQ3A 5DRIA 1S5TA 1J9YA 3KBNA 2WKGA 1AODA 1SQ7A 3S1XA 1KV5A 3RO6A 4NSBA 1JZ5A 1XLDA 3S6OA 3B9DA 2D0GA 1TUXA 2DIKA 1GONA 1XIFA 1PIIA 2X09A 5DQPA 1A0CA 3AWNA 2WVSA 2RDXA 4DO5A 4GVHA 4W85A 1GQKA 4MAZA 2WNZA 4RCXA 1VRAB 3NQGA 4PBGA 1Y5XA 3A4XA 1LL7A 4JQ1A 4H2CA 3TN4A 2PWDA 2HEJA 1XLJA 1HJVA 2XN1A 2WDAA 4AZCA 5LIUX 1FP9A 5KMYA 2VZSA 3N6QA 2DZUA 3CEPA 4UFJA 2XVPA 3SIMA 3B8TA 4F2BA 2BRVX 2JGYA 2A79A 3MCMA 1QPOA 3EYPA 4A8RA 5JMUA 1F9GA 3BAJA 2DJLA 4EOUA 2FB2A 3BC9A 1C8YA 4FIRA 4HHMA 3FFSA 1XBVA 1JPKA 1JUKA 4XO6A 2XVLA 3C56A 5HWJA 1Q45A 1WO2A 3FIGA 2DT0A 3MO7A 1A3HA 1OM0A 1CLVA 2PODA 4DIAA 5LYRA 1DJHA 3WLMA 1O6IA 3GZ3A 5HATA 1W37A 2TRSA 4XKYA 4F2TA 4FLOA 1JAEA 5JIWA 2QCMA 3GXTA 2C18A 4I9JA 3K5XA 3CV7A 3RHGA 5RUBA 3EXTA 3L67A 4O0KA 5I3HA 2Q01A 2CLOA 2CLHA 2QQ6A 3URNA 1VFLA 3PFRA 1G4PA 1TKKA 1BTMA 1O5KA 3MT1A 3SRKA 4F9DA 2DDXA 3W7MA 3UVAA 1QPRA 4A21A 2CBJA 1MQQA 1EJVC 3KS6A 4FEZA 2NUXA 4GNKB 3EMQA 2NX3A 4ZB2A 3XISA 4YYCA 4Q22A 5C7VA 5B7ZA 5LIKX 3AC0A 4DJFA 1HKMA 4DLFA 2BODX 4U3AA 3FA5A 5AC7A 3H7VA 1M04A 1RWAA 1XINA 3PFMA 2VI0A 3I6TA 4DZHA 1IIHA 4KFNA 5D09A 1RZMA 3E02A 1Q3NA 2V8ZA 4OOUA 2P88A 4GGHA 1ML1A 5FCZA 5LNUA 4PYSA 1W3YA 1YW1A 1K70A 2TPSA 2CLEA 2VKZG 2HDJA 1KXQA 3DKJA 4JICA 2R8WA 3WLKX 4EXAA 4A3RA 3JZEA 1CGVA 1SFTA 5CBBA 4H6RA 3HBLA 4EPDC 3EOLA 1K03A 1O1HA 2VX5A 5DF0A 3P14A 5BRPA 2PB1A 3V5CA 3E1F1 5ENLA 5CPMA 2X0SA 3T42A 2X0YA 3BW3A 3TSMA 2VENA 3ZSSA 1POKA 4O13A 4TO8A 1O1ZA 2WJEA 3NEHA 4GYPA 5HA7A 3RDKA 3QH2A 4MTVA 1FCVA 4LEFA 1RBLA 3UXKA 3ZIZA 2DT3A 3O63A 4PBEA 4TX8A 4QDMA 1XPYA 5D32A 2OMAA 1BYBA 3PZTA 1IXQA 3V0UA 2TYSA 4M6PA 3VE7A 5DMLA 3URBA 2NWRA 4EAMA 4BWLC 3GNPA 3WH6A 3ZJ6A 2YR1A 3P61A 3GU1A 4RE2A 4CCZA 3OBEA 3QC3A 3L4VA 3O2LA 4L1XA 1F5ZA 1OFDA 1DE6A 3CQ0A 5JUVA 2OZTA 2E0PA 3U5UA 2C3ZA 4DO7A 1JUEA 1P0KA 3CH9A 4CU8A 2FPTA 3BJSA 4WKFA 3W2UA 4IJRA 3T2QA 2BVWA 3FLUA 4L1GA 3UCQA 3HG2A 4C7GA 2G37A 4D6CA 3MYOA 1XRVA 2VEGA 4MJMA 5AECA 1QFEA 3SW6A 1S5NA 1E1FA 4Q8UA 3M0JA 3SY1A 1WKYA 2DEPA 1E56A 1VYPX 2Z0IA 4GKLA 3T0TA 4LQ1A 1WKFA 4XZIA 1H5YA 4UTLA 3T0AA 2W62A 3AHVA 2GDUA 1I2OA 1WZMA 2VFIA 1HJUA 3PTKA 1XLCA 3TSDA 3IPWA 5LA2A 2ZZ5A 4Q8OA 3ZWSA 1QASA 4ZVJA 3S6TA 1G69A 3NPXA 2DVXA 1FFRA 4FIQA 5L9FA 3TU9A 1E4LA 3N12A 2A6LA 3VFLA 4JEJA 4MB1A 2Y5JA 1FY6A 3V0TA 4LALA 4F8XA 4CNNA 6XIAA 1GZ1A 2OZ8A 4RE4A 1QI3A 4GQ0A 5KZDA 1WKDA 1GOKA 4HU3A 3EOSA 3LZ5A 3OJGA 3PSVA 2R1KA 1GORA 1FWWA 2JEPA 3VOCA 3CU2A 1OCNA 1NIUA 2DZBA 1DIDA 3CBWA 3NQ7A 4D72A 2W6RA 3HGOA 3K13A 4B2DD 4NI8A 2XFWA 1AK5A 3TV8A 1ZUAX 1P0EA 4O1FA 4NNCA 2C15A 1H7PA 1QUMA 3KOFA 4JKKA 3IIZA 3W28A 3PZMA 4HN8A 5DCEA 5E0KA 2A3AA 2YLAA 2G3MA 3KUMA 2E9BA 3MBFA 8XIAA 4HNCA 1RBOB 2X03A 5JQ9A 5CLTA 3TYBA 1MO0A 3LD5A 1HJWA 3F4VA 1PHQA 4E38A 2RDUA 4ADSA 1R2SA 4U28A 3UG8A 1QMLA 3SBFA 1W3KA 1HVQA 4DWSB 3BANA 2NT0A 4IQDA 4ATDA 3UD6A 1HT6A 1RV8A 3E74A 3VIKA 3VD3A 3C6CA 3DESA 2RUSA 3F4DA 3HA1A 4GE8A 2JE8A 1VP5A 2QV5A 5CSSA 4LYKA 4ZB5A 1LJYA 3WDIA 3MDUA 3WK1A 1IWPA 1XLBA 3M41A 3THAA 3JW7A 4PMJA 2WC4A 4PUEA 4I6KA 3TMLA 3RLGA 1ZQ5A 1GOIA 5H6HA 1J0YA 2G96A 4GCAA 1WBHA 4GZIA 4YVXA 4H83A 4NASA 3S2MA 2XH2A 1KRBC 1E4NA 4D6JA 2EF9A 3PULA 1JYWA 2GZXA 1HW6A 2XSXA 4RW3A 2XJ7A 4AYSA 2VZUA 3WQCA 1XP3A 3QF0A 5F1VA 1VZWA 4CCEA 3VUSA 1WQ5A 4BQ3A 3VNYA 5D04C 2VDGA 1B4EA 1XG3A 2V5CA 1YDOA 3W00A 3SCRA 2O9PA 2QZRA 3HG3A 2CITA 2Z4GA 4EF8A 1B1YA 1P7TA 2B7NA 4TR9A 1KFJA 1QNSA 5CJNA 2H3DA 4WGXA 7ENLA 1MZHA 1JD7A 3EMCA 1VKFA 1X8CA 3K8LA 3RXZA 2V4IB 1XUZA 4UTTA 3EKLA 2Z24A 4OBTA 3NPWA 3QEZA 1H7XA 4CLMA 1XIMA 2VZTA 4XZBA 4NJHA 4P8WA 3U5YA 4YU1A 4D6EA 1T8XA 3STPA 3L4XA 2JEQA 2ESCA 1R7AA 3C0QA 4JNZA 3L2LA 1KTBA 2DZPA 3AO0A 1KM5A 4FOUA 2V3DA 1L9WA 2R9RA 3V75A 2QVNA 4A29A 4MKNA 1EP3A 1TPDA 2ZA1A 1NP2A 1VENA 4Q7IA 3RUBL 4RDYA 3MWAA 5AYXA 1HX0A 1QNVA 1CGYA 1VHNA 4A3UA 1K7FA 2QCLA 3FN9A 1J0JA 4UOJA 3S9ZA 2VT0A 5EMJA 1SW3A 4H9YA 2DFAA 3UGVA 1XH2A 4AEEA 4N7QA 5KZEA 3CWOX 3TQ0A 2R94A 5ABFA 3TW7A 4QX4A 4AEOA 2X1IA 1UWUA 3WLOA 3GH5A 4DF2A 1JXJA 3N2MA 4TVDA 4PUKA 5E0CA 1V79A 2DUXA 3PAJA 2BGQA 4B9YA 2PRMA 4U33A 1PSCA 4O28A 3E2QA 1W0MA 4HPXA 4G7FA 1IE7C 4UOZA 3CMGA 3B8WA 4J40A 1D7KA 2YDSA 1JF5A 1BVWA 4I8YA 3REQA 4OKDA 1MEWA 3KBSA 1V08A 4Z0JA 3F2BA 2WB5A 3EB3A 3RM8A 1X1IA 4BF5A 3M5XA 3T0DA 1S2AA 3ARUA 3VIPA 2WV8A 3TYDA 2ZRZA 3LXCA 4AHPA 1UIOA 2WNNA 5A6BA 1RR2A 5AYBA 2ZWYA 4LVAA 5CPOA 3ID7A 3G0XA 1EFZA 1JPIA 3KFTA 2PA6A 3LMYA 3VD5A 3TSBA 4AAJA 1W1VA 2AL2A 4LVDA 2O55A 5H91A 1VRXA 1MRAA 3E2SA 1PHWA 3H7RA 4MYXA 3AYRA 2DZTA 3AFBA 4GIRA 3GNNA 2BX7A 2C79A 4J1OA 3K46A 3DYMA 2Z1SA 2PDFA 4XZ9A 3S9YA 3KCOA 3SN4A 1XIBA 5BROA 2J6XA 1NQ6A 1QNPA 2EQDA 3AIWA 3VIGA 4RXFA 1JRBA 3MHUA 2FGBA 4TMCA 4B3ZA 1E6RA 3GC4A 4IMFA 1PKNA 4F40A 3TUUA 4C6FA 3UWQA 2FQIA 4HMNA 1XQKA 3WLLA 2QULA 3C8FA 5KETA 1SZEA 4AIOA 1DV7A 2MUCA 2OSWA 1H4PA 3F1QA 2W92A 1MDLA 3UZJA 3GVQA 4M51A 4PMYA 2BOEX 2W3ZA 1CNVA 2EXOA 3UBPC 5LSMA 4LUTB 3A24A 1A5CA 1I9CB 2HVNA 4U5IA 1KCKA 1GHRA 4UMCA 4IX2A 3SCQA 5I0DA 4HA0A 3SEPA 2E6DA 4C6IA 2VFGA 4W4QA 1E9YB 3BURA 3UJFA 4U2YA 1YTEA 2E9LA 4L5ZA 4KFOA 1ONRA 5LNRA 4BKNA 4TX6A 4MMWA 2V6AA 1DORA 1TMHA 3OQ8A 2WSKA 2VRJA 1FP8A 1E1CA 2WMIA 3W0KA 2Z7GA 3QQ0A 3O6DA 3R43A 2VR5A 4HOWA 2CLMA 4P7LA 5AFDA 5HMFA 4I5RA 1IYXA 1UCWA 3WMCA 1V02A 4LRTA 4YVVA 4MPQA 1SZFA 2VGIA 3VD9A 1T6MA 3KW3A 4PUNA 1KRCC 2CLPA 2V5BA 1E0VA 2VOMA 3RG6A 1JG9A 4KCTA 1R47A 3W26A 4CN4A 1SJCA 4DNHA 4MHBA 1OX4B 2UBPC 1EEPA 5JIPA 1UZDA 1NFPA 1SM9A 1X1ZA 3EOUA 1WDWA 4HCHA 3DC8A 2XH0A 1TPC1 3LU2A 4KGJA 5DCDA 3CO8A 3DFNA 4L1WA 2Z1WA 1DJYA 1BF6A 1D3GA 1TWIA 5FEPA 5TD4A 2ZC1A 5I77A 3T8LA 3WZ0E 4S2CA 4EIVA 1KFWA 1TPB1 4AU0A 1ZS2A 2H6RA 4W93A 1LZOA 4TTGA 3CUJA 5IBXC 4FO4A 3BLDA 1XX1A 2CHRA 3M9YA 3BJFA 4GO9A 1SW7A 4W8BA 4BY3A 2XWDA 3A5FA 3W22A 1YBQB 3B9OA 3CPRA 1X1JA 1EYEA 1QU4A 2ZTKA 2J74A 5B80A 3FVDA 1VFHA 1T5AA 2O0TA 2ZZ4A 2HK1A 3WNOA 4AF0B 2G3FA 1NFBA 4DZAA 4ZO9A 3U0HA 1X7FA 4L9XA 2WZEA 5FF4A 1TJ0A 4IJBA 3G1AA 5K9XA 4GA8A 1X96A 1TPVA 4EWND 3T7VA 1EBHA 1QO2A 3BWWA 3AIUA 1HQTA 3G1HA 3DUGA 4QEHA 3QXBA 2ZZ6A 1XH1A 2CZEA 1A0DA 1PVNA 3RX4A 2YXXA 3GTFA 1NWTA 3FJLA 1XD0A 1ADSA 2ICSA 3N9KA 3IGUA 3WDJA 1W1A1 5G2HA 4FALA 3UG5A 1KO0A 1Y7VA 4N4QA 1OD8A 3MW7A 2PDJA 1NWRA 4AD5A 2E6YA 3WBWA 4W5ZA 3TFCA 3LSBA 5IRPA 3O0FA 4E2DA 3ARQA 3NQ8A 1WZLA 4IUGA 4FLRA 1W1B1 1LOSA 1F3TA 4AMAA 4MZ8A 4ZOAA 3HPFA 2VD9A 3MUCA 4LNCA 4MOZA 3G1RA 3OGSA 2GDQA 1VPQA 4Y9MA 3ELFA 3LUTA 1O95A 3M0LA 3H54A 4WY0F 5HK4A 3SN1A 2GSHA 2G3NA 3C5QA 4S23A 4PSPA 4JTQA 2ON3A 4K68A 2WNWA 3KAOA 2J78A 3KWXA 3SCWA 1TWWA 1XCXA 2A3HA 1FQ0A 2QGYA 2HVOA 2GL5A 2VVSA 3F4CA 3W74A 3KRUA 3LENA 3L12A 4CQAA 4PUWA 3FVMA 1SVDA 4MWAB 5AN7A 4GBDA 4Q4OA 2PCEA 1YE4A 1EGZA 3T08A 1MW1A 4PGLA 4HZ7A 3QGAC 3S1GA 5C9UA 3MI3A 1SO5A 4RNJA 5FJIA 3UQNA 5AOUA 1DWAM 6REQA 3WD1A 1E9LA 3W7LA 2WZTA 1YXDA 2WYSA 4XB3A 3OGVA 1NFGA 3NAVA 3B9AA 4HIBA 2WWCA 3WF1A 3GTNA 4UTHA 1V3LA 5G2IA 2XWEA 1GZGA 3T8QA 1DHPA 3G2GA 3POHA 4WX2A 4RZ5A 1IR2A 3P60A 1G4SA 3VDBA 5CPTA 5FESA 4JY9A 4PN2A 2Y63A 3O15A 2VURA 1S3TC 4S3BA 4B90A 4GQRA 3QOMA 2WMGA 2QCNA 3K8KA 1U2YA 3UPMA 1YPXA 1S2TA 3HQ1A 3LERA 1B3VA 1OC7A 4MNMA 3K4WA 4D6HA 4XISA 1GYNA 4IT1A 4J2PA 3KX6A 1J6PA 2VEIA 3C2OA 3QQWA 4ICNA 5ECVA 4S3GA 3KVMA 4E4PA 3TC3A 1MZRA 1K9DA 1R86A 1YKWA 4IMGA 2BTMA 4B3LA 2O9TA 3V5FA 3OYZA 1LF1A 2C7FA 2Y8UA 3WD3A 1DP0A 3W70A 3RR1A 4Q7BA 1VIWA 1R9YA 1V3MA 3PP7A 1HZYA 1KXVA 4PR4A 2D3NA 2V3GA 1R7OA 1PTDA 3T9PA 3R8GA 4AIBA 4DNMA 3NCOA 3GZAA 1A5NC 1W1IE 3VCRA 1F6KA 4NAFA 4BR1A 3GVGA 2YCEA 3R12A 2H8ZA 1L0PA 3CHFA 1T7LA 2Y7DA 3GKAA 3VNJA 1NOWA 3UWYA 1H5VA 3L5LA 3TA6A 2VO5A 3VTRA 1QI5A 2ZDRA 3ARRA 1VB9A 3LM7A 1HG3A 5EMYA 2EPHA 4DAFA 3ZYZA 4GUJA 5F4WA 1M6JA 3P82A 3UG3A 4HNUA 1SFLA 1W31A 1LQ2A 1UPMB 4CN1A 4O1EA 5AYYA 3DYPA 3MANA 3M5VA 4LYPA 1K77A 4Q8QA 3U48A 4WOQA 3QSRA 1LXKA 3VVGA 1XRFA 3QPEA 3PBWA 1PWMA 5DLCA 1AQMA 1SFJA 1JPDX 3WNMA 2OYMA 4XZNX 2RHGA 2OU4A 3TW9A 1JQVA 1MXDA 1MWOA 4AZCB 5EMKA 3MCOA 2EBNA 4TVUA 3VGFA 3WEMA 4HKPA 3M5YA 3M64A 4IMEA 4GD0A 3GS6A 5HXMA 4PMVA 3ZM8A 4DWSC 1EZ2A 4HU0A 4ZZ9A 3H7UA 1U83A 2YKKA 3MMDA 3FHQA 3W81A 3RN6A 2Q8XA 1ZL1A 4F79A 2PWUA 2ZFAA 5CC5A 2JQXA 1U22A 1E0UA 1QPNA 1WAWA 3CNYA 2ZUNA 4TIMA 3UF9A 5C9ZA 3VNZA 3NGJA 4GYJA 4B4FA 4FI4A 1FH9A 3QQ1A 3DFSA 5KZ6A 4JIPA 1N8IA 1RP8A 1CXHA 2FB3A 2ZZ3A 4FLQA 2WLZA 2AOSA 3BL3A 4IOTA 4D6IA 4W8AA 4J27A 4WSHA 4YPJA 1FWIC 3MQTA 1P0DA 3VZZA 4XKYB 2EEXA 2J7BA 2ZRVA 3C2VA 1SJBA 1T41A 2E5CA 4HB7A 3OQEA 7CGTA 3UZ5A 3BAKA 3G3DA 4AWEA 2D20A 4ZSUA 5HNUA 3ARTA 3M7SA 4CCCA 1RD5A 1AZ2A 1E71M 3RGTA 2BY3A 2FTPA 3KVLA 5DXXA 4XBKA 2EG8A 4JDBA 3QFWA 3AYSA 1RQBA 5XINA 2P1FA 2Y88A 2A3BA 3HPZA 4XZHA 2ZVRA 1U1UA 1XRTA 5PTDA 1TJPA 1ICSA 1JIBA 4S3JA 3IT4B 3EEGA 2Q3OA 1J10A 4B4HA 1LLQA 1XISA 2EAWA 4J35A 1XIHA 3S47A 2FH8A 3GB6A 3NEVA 1R87A 2X1UA 4M29A 5CLWA 2GGJA 3CH0A 2OOGA 2DT1A 5BYWA 1KM4A 1CW2A 6XIMA 3VX1A 4O19A 4HK6A 1ONXA 1N7KA 4AHQA 2Y1HA 1WDDA 4CVUA 1N7OA 4C6LA 3IVUA 1OFRA 1NSJA 4I3GA 2FGLA 4B2DA 4AX7A 2ACUA 4I5UA 4LVFA 4IIEA 1EIBA 2QAFA 4CQCA 1VBHA 2JF6A 2NLIA 1OGBA 1Q66A 2ZUUA 1EP2A 3CQJA 1PKLA 3ZT5A 3W7CA 3TLLA 1HN0A 2D24A 3VM7A 3TWBA 4XUGA 1LBMA 4M82A 2E4TA 1Q6GA 3NZQA 3RRXA 5GNXA 3W27A 1SR9A 3IJ9A 4AD1A 4FF7A 2CZFA 2OOFA 3P3BA 8CGTA 3UT0A 2XG9A 2YA2A 1TA3A 1XFBA 2A1YA 2EPLX 3R6IA 4B5UA 1UC4A 4S3KA 4NAEA 2Z25A 3HN3A 3IK2A 1N7PA 3LHUA 4HSHA 3VK5A 2HMCA 4V2XA 4CNTA 3TA9A 4DBEA 1UH4A 3F4NA 1EDGA 4W7VA 4GNJA 1UH2A 2Y6ZA 4WK9A 1JI2A 3LCIA 1JNDA 1LWIA 2R6OA 3WJYA 1MQPA 4LY8A 1IXPA 1XLMA 3MZ2A 1P6CA 5FAJA 5CJ5A 3BLOA 1A5LC 5E5CA 4GMEA 3NR0A 3MMTA 1CECA 3G6LA 2QJGA 1EC7A 3EOOA 4ACZA 1KD0A 2DIJA 2PP0A 1EA9C 3IVSA 2OGYA 2ZKMX 2OZ0A 2NQZA 3GRIA 5EKYA 4AYGA 1QCWA 2Z1VA 4Z1DA 4G1NA 4UFLA 4N9CA 1NTHA 4XBJA 5CKSA 4DZ5A 1W9UA 1JAKA 3A22A 1GHSA 3WYZA 3EMZA 4OIFA 2WHMA 2Y8VA 5H2ZA 1O7AA 4I9MA 3CZ8A 4NF7A 2Q02A 4JFSA 3QY8A 4AD2A 1I2RA 3L2MA 3PWAA 5F1UA 1OBAA 3P2VA 1OX6A 3W4RA 3FGCA 4KBXA 3LY0A 3MVTA 1HP4A 3Q94A 3IRDA 4CNPA 4UTFA 1YTDA 4D6GA 3TTSA 2WVTA 4PC8A 3WF0A 2EHHA 4BCEA 4PEEA 1T40A 1YADA 1EHAA 5CPLA 1B5TA 1V6TA 1ZJHA 4V27A 4X22A 5CH9A 1GJPA 2OLHA 4H9VA 4PTWA 2DQXA 3EX3A 3WBAA 3TAOA 1XLIA 2G4JA 1A5MC 1F76A 2D22A 4WQ6A 3T40A 2PPGA 5FF3A 3T05A 4Q32A 1V5XA 1OFEA 4G7EA 3B4UA 5DMNA 3WNNA 2UY2A 3NIYA 3LRKA 1EUAA 4YTQA 1GQJA 5FJJA 1Q7ZA 1X8FA 2E5DA 4I9AA 2QF7A 1CXEA 4RPPA 3FA4A 3S9IA 3BLPX 4X9SA 3UCCA 5A94A 3CQKA 3WK0A 5EMUA 4UQAA 3ALFA 3WQFA 1ZRQA 4PL2A 3NQDA 2OTDA 2J4GA 2HS8A 1VD6A 4U31A 4M6VA 1PL9A 4DF1A 3R79A 2IMRA 3VDAA 3I65A 4W7UA 4Y9AA 4M6UA 1DWJM 1U1HA 4Z2JA 3AS3A 2I7GA 5HDRA 3MI6A 3LNPA 1KB3A 2VC7A 3MMUA 1BXNA 1LYXA 4MNLA 3WQOA 3ENLA 2XN2A 3GIPA 1DQWA 1FCUA 1LQAA 3GC5A 3KOWA 4HN4A 4YCOA 4FNQA 4L56A 1T96A 1GKRA 4F0KA 4O8RA 1HIZA 5AYZA 4H1ZA 1GK8A 2BSLA 3LBCA 4XTDA 4IWWA 2FIQA 1IT7A 3U4AA 1KQYA 3CAKA 3DDMA 4YWSA 5BXRA 1A5KC 1QVBA 3KTCA 1JZ8A 4UTKA 2QT3A 2UY4A 2QPUA 3CS2A 2DZVA 5DN1A 4GZJA 3QW3A 4AFYA 4WIWA 5I7GA 2WJDA 1K4HA 3C0SA 4JPGA 1UA3A 2BVTA 4DBUA 1W9PA 3WK2A 1PPIA 2ZQ0A 4AWTA 1OGSA 1DVJA 3PZUA 4JCMA 5E93A 2OSYA 2QIIA 2WJFA 4JKLA 3UJEA 1ENUA 3LS9A 1P7TB 2ONEA 1R85A 3FDGA 1LDCA 3WDQA 2ACSA 3VMOA 4ORIA 3ABXA 1UC5A 4JIRA 3EWBX 4C6QA 1RHCA 2UWFA 1HL2A 1XLGA 2CHOA 3IIOA 3QPZA 2IUZA 1EL3A 3VC6A 1Q13A 4IUOA 4M56A 4PCTA 1PX3A 2C71A 3MP4A 3D47A 2J7HA 4UIOA 4V1YA 3AHZA 4DJEC 4PH6A 1ZAJA 1CGUA 4JFVA 2OPJA 1P4CA 4L4LA 2A85A 1K6AA 2ISWA 1EGVA 2A2IA 1XBZA 3TIMA 4DB7A 1V7YA 5A6TC 1VH7A 2PSNA 1XJBA 3P84A 1S46A 3IRSA 5HPCA 4UTMA 1B57A 1P0BA 3B05A 3WNKA 2WMJA 4LBUA 5BRBA 5FJTA 2J7CA 5FACA 3AYTA 3L4TA 2E7FA 1ELSA 3NVDA 5IXEA 1UUMA 5ABFB 1QHPA 1EC8A 4R88A 5C55A 1F3EA 4D8ZA 4IPJA 5C8BB 4GRSA 4LOCA 2DSUA 5CG0A 4ILSA 2WC3A 3N2OA 3PUEA 5TNVA 3A3HA 3W1RA 3HIJA 2YFNA 3E12A 2WKJA 4FPSA 4B5NA 3MO4A 5I3GA 4O0ZA 3H70A 5IHSA 4IJCA 4JNYA 1P1XA 3REQB 4QE4A 2WXDM 3G8RA 3WCZA 5DT5A 3MSDA 4MB3A 5KZMA 1GVQA 3VIFA 2NXIA 2VEFA 2VZKD 1XYZA 1TCMA 2CXGA 2DUAA 2DVTA 4PULA 4QTGA 5LHFA 3LPFA 3H2EA 1TR1A 4JIEA 4R9XA 3VNMA 4UC5A 3ITCA 2W63A 1OYCA 2EGZA 1Q6EA 4BEUA 3VIMA 1C3FA 5I24A 1PKYA 1XS2A 3KRBA 4GLEA 5BMXA 4O17A 3PUOA 3B8UA 1D9EA 3W2JA 3W53A 1FCQA 2DORA 1EEXA 3NQ2A 5LIXX 4YWIA 2XPKA 4HOZA 4AD0A 1KR0A 4GUGA 3GK0A 1MDRA 1CLXA 1OJOA 1RAKA 2AL2B 2E1DA 4GIAA 1RY0A 4TX9A 1P1MA 1V0MA 3V5OA 4QQ3A 1G7VA 2EKGA 3Q65A 1RWFA 1DL3A 4JBRA 2CWNA 2XU2A 3MPGA 5FEXA 5BXSA 5EFFA 1FWCC 1DIKA 1WOAA 4WZHA 1CLKA 3V4BA 4FS9A 5LXEA 3AZTA 2YCKX 1XG4A 4Z1CA 4NRSA 1W9DM 1EGMA 1XDMA 1B9BA 2OWWA 3ANYA 3CAQA 3VD7A 3F4WA 1TV7A 3W07A 1ZP4A 3IEBA 3O05A 4LX4A 4NIRA 3W37A 2XN0A 3TH6A 4AIEA 2BNJA 3AMCA 4IPPA 3MDWA 1H61A 4H6QA 4A4AA 5F2GA 1Z6KA 1P6WA 1JFHA 3TZFA 3OVQA 1E15A 3UERA 3BARA 4UB9A 3RLHA 4O16A 4I7UA 2A5HA 3USZA 9CGTA 5H8PA 2X1RA 3Q37A 5EB8A 3IAPA 3MBDA 3TNBA 3S4TA 1G4EA 4AQLA 1W3IA 1JCMP 2ZDSA 3RCYA 4BQ2A 1D7FA 2KX9A 4IG2B 3ZSTA 3G1FA 4RZ4A 4B92A 2SFPA 5CAHA 2PLCA 1XWYA 3TONA 2V30A 1E1CB 2QNEA 2WMIB 2A3EA 1XUUA 2PBGA 3LXBA 3BGAA 1QXLA 3CLWA 5HBFA 3OTRA 3M47A 1KCLA 3OZYA 3B0XA 4LB3A 4EXBA 2QUNA 3ORWA 1XSIA 4ZFCA 2XVGA 1E1EA 1JULA 3W7JA 1C9WA 2VC5A 3DZ1A 2AMXA 3G0UA 1LOHA 4K39A 4DBSA 3HGSA 4EPBC 5EMMA 4J7RA 4Q4PA 1ZALA 4I7VA 2FFCA 3C86A 1TZZA 1VFTA 1UR1A 4LS2A 3MY9A 3THQA 3WFLA 4OVXA 2VP8A 1RK5A 1ZJIA 1EJSC 4UFKA 2J6VA 3TCSA 1AW2A 3S83A 1YLVA 4ONVA 2PU1A 3WX7A 3AIVA 2FHBA 5CQ1A 3CMJA 1XLHA 2R24A 1IEIA 3VAVA 2DUZA 3VIOA 3VCNA 3EGJA 1KKRA 2YB4A 5I79A 4WSJA 3PSWA 1IXOA 1UD6A 4JYDA 5I6SA 2B7QA 3UXDA 1XSJA 2PLMA 3PNUA 1UD5A 1O5QA 4LH8A 4HHLA 5FF2A 2W61A 3GH7A 4QBXA 3E49A 2XTKA 1V3JA 1ISYA 1RPKA 4I9TA 4ERAA 1V77A 2IQ0A 2V5DA 3IJ6A 1ITCA 2YPIA 5AVNA 5HMSA 2VOTA 3N34A 1L2QA 3PUGA 4F66A 3S1VA 3MHFA 1FA2A 5LIWX 2WPGA 1QI2A 1EF3A 4HNVA 1OT2A 2YEPF 5L6UA 2CETA 3S5ZA 1WP6A 3JU2A 4EACA 3MTWA 5HJLA 1J5SA 1L6SA 1ZCOA 4JZ5A 2BZNA 3HPXA 3N1AA 1PO9A 3WLPA 2CU0A 1C9DA 3E0WA 1SR0A 3II1A 3BJTA 4WR3A 4JTGA 5DMYA 3IARA 1V51A 1HKWA 3N29A 1H1YA 2Y7GA 3KHDA 1HTIA 3NSXA 3LCFA 4HMEA 4GY7A 1OHLA 1Z9AA 1EF2A 3HURA 2QJNA 3H21A 1P43A 3B4YA 4A8LA 1EH9A 4G5DA 4BF7A 2C0AA 3ZXWA 2QV4A 3EX4A 5DELA 4DELA 5FEZA 1OADA 1OJXA 1RJPA 3H4WA 5A1AA 1F8MA 3WQVA 2JKPA 5ECUA 3UD1A 2XISA 4KIEA 1NOUA 4QHRA 4MY1A 1QOQA 3LG3A 2CW6A 3BAXA 3CLMA 2HE8A 2B31A 3TROA 2X05A 1SMAA 5KINA 3L21A 1EUNA 1V4YA 1QW9A 3LK6A 2OVLA 4DJFC 3H4XA 3SO7A 2HXUA 2X0HA 3NDZA 3OP2A 2Y5EA 4LT9A 4LWWA 4R5EA 3P5YA 4AXNA 3VGBA 4G1KA 3KE0A 1L6GA 1A3WA 1W2PA 1JDDA 1I1XA 3L0GA 4HD5A 4AIUA 4XO7A 1ZAHA 2D0FA 4Z1YA 1OINA 1VEMA 4ZE5A 1TV5A 1HM2A 4RE3A 4KEUA 3VDHA 1GPFA 2IW0A 2Z27A 2E24A 4WCJA 2HTMA 1KGUA 3PWIA 3XINA 3B97A 1TJRA 3EOEA 3QTGA 6REQB 3KBMA 1AH0A 2OODA 5CGQA 2D2JA 3E96A 3N9SA 3SCNA 3E2VA 3GHSA 2PGRA 3NJ3A 4OT7A 3ZR4A 2ZUTA 1UR2A 1YNPA 3GU9A 4F4RA 3LQLA 1NDZA 3IV8A 1G9HA 3ZFHA 3N2XA 4GNVA 2OT0A 4QS5A 1JEZA 4GYPC 3L4UA 3JZUA 2KXSA 4P8VA 3M0ZA 1W3JA 1WYIA 3TYCA 1TTQA 3SCSA 2O92A 3EZ4A 1BSLA 4ERGA 1B3ZA 5G1YA 3QHOA 2BHZA 5CZ0A 3STFA 4L6DA 5EBUA 1JQXA 3ITLA 1UWAA 3KRSA 1EJXC 1HGYA 5F4XA 1CEOA 3BLFA 4PMDA 3ABSA 1HKIA 5I3DA 4HYVA 2OO6A 4BQ5A 1M1BA 4JFTA 4WVXA 1JNEA 5A6SA 4KKXA 2Y0FA 4IMDA 2W4XA 3ISIX 3BAYA 1WKEA 4B9ZA 3C3UA 3PB2A 3ZS4A 4MKVA 2BXYA 3COTA 2HV5A 1E72M 3G8EA 2WO5A 3M43A 1C8XA 4QE1A 1R9XA 1BXCA 3KWSA 1HN1A 4HZ8A 2FZ9A 1TRIA 3VMPA 1QT1A 2WQDA 5A3HA 1SJAA 4NAFB 3KVKA 4FOJA 4GKTA 4JQAA 5ABGA 3WLNA 4OWGA 3STGA 4S1FA 4NZ1A 1LUCB 3EXSA 4US6A 3IIPA 1UP2A 2PWGA 3KRZA 3OIHA 1VEPA 1ECQA 1E6QM 3MJMA 4RDWA 4JD4A 3O3RA 1ESWA 4AMCA 1WXZA 3P8IA 1OT1A 3LPGA 4F0MA 2INFA 2NT1A 3UY7A 1EGUA 3LHTA 4ATWA 1SSGA 5LNSA 3I68A 1XCWA 1QBAA 1RW9A 1GWJA 7TIMA 2J75A 2BBFA 4AB4A 5A8QA 2FLIA 2GOUA 3ZWTA 2J77A 5EBAA 1UR3M 1TVLA 3WL1A 1XYCA 3K4AA 4V15A 2GUUA 3U3HA 3OLIA 6ENLA 3NTYA 3W1NA 3M0IA 4NQ1A 1CPUA 1YPIA 4W5UA 2CZDA 3GXDA 1AL7A 2OEJA 5FF7A 4QS6A 4CD7A 1T99A 1V02E 3PR2A 3RLVA 1NDYA 2XINA 1J96A 2J9XA 1IZJA 4Q3MA 4YS1A 4YYFA 4H8NA 2ASHA 3D6NA 3GM8A 1N7RA 4D6FA 4M81A 3KL3A 1F61A 3R2GA 3R94A 4F0LA 3P7YA 3AUOA 4JTTA 3FKRA 1HGWA 4HCLA 4OV9A 2VJXA 1H7RA 4LAOA 3T4CA 1BGAA