2WMFA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in its native form.
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
555
structure length
555
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIENYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLSGHTGHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 206
structure length 555
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmfA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmfA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmfA02
1MFUA 2CBJA 2ZWZA 3MMWA 1I8QA 3CMJA 1UH3A 1J0HA 1M01A 2TAAA 1HL9A 3E1F1 1QNQA 3OGVA 1G1YA 1GHRA 3MU7A 3WEOA 2YL8A 3I3DA 4RL3A 3T2OA 2XVNA 1ESWA 1ZL1A 2E8ZA 1QPKA 3CUHA 1UKQA 4H7VA 4TXEA 3WIJA 1UH2A 2CXGA 3EMQA 1QW8A 1JYVA 1GQLA 3VIFA 2WMKA 3CHFA 1UHVA 1KGXA 3ZSSA 1V3KA 4X0VA 3CH9A 4U33A 2BNJA 1ISZA 4PUDA 1BG9A 4W7UA 7TAAA 3VNYA 3T2PA 2WZHA 3VPLA 1SYTA 2X0YA 1NOFA 3K4AA 1E73M 2VQTA 1JAKA 3SCRA 3N15A 1LG2A 4OZOA 1RWFA 2CBVA 3SCPA 5BXSA 3VM5A 3OLIA 1JG9A 2WHKA 2G3IA 1R87A 3BCFA 4UQCA 3EYPA 5CSYA 3MS8A 5A6KA 1IT0A 2J62A 3AIBA 1U30A 1WCGA 2DH3A 3MUZ1 3UG5A 2QHAA 3RM8A 4AISA 3W82A 1W3YA 2ZE0A 4MJ2A 4MNMA 1WO2A 5FL1A 4TOQA 1CXLA 3BLPX 5FKYA 2F61A 1ITCA 2GDUA 3AXIA 2AAAA 4AC1X 1DP0A 1UR2A 1PBGA 1ISYA 3GXIA 5DFAA 4W8AA 5A6AA 4DWSD 1JYNA 2WCAA 1CNVA 4LGXA 2CKRA 5GNXA 3T0DA 3L4UA 1J0NA 4AIUA 2YA2A 2E40A 2GVYA 4UQAA 2JF7A 1GOMA 4NRRA 4BQ2A 3NDYA 2X1IA 4GQQA 3ALFA 4HOWA 3VVGA 2EPKX 2V5CA 4H8UA 4MDPA 4JKMA 1K9TA 1UD8A 1B1YA 3RIKA 3BMVA 4CU6A 3BMWA 1X1NA 5HPCA 1CGUA 5M5DA 1NP2A 1LLOA 2CEQA 3CZKA 4M29A 1ZS2A 2BHYA 2DIJA 4IISA 4WJXA 1V03A 3BAWA 3CHEA 4D6FA 1CLXA 1BGGA 1OWQA 5CGMA 2ZUNA 4UZSA 3CZ8A 1ODUA 1E3ZA 2WMIA 3FW6A 4PMXA 3EBVA 1B30A 3PZIA 2XFYA 3BAYA 2HVMA 4CD5A 3VDHA 1X1JA 5FOOA 3WDIA 4MADA 2DT0A 3EDKA 3VDAA 3WH5A 1W1TA 1MQPA 2YDSA 2A3HA 2PBGA 4J3XA 1GOWA 1BF2A 2Y8VA 4FLQA 3WMBA 1IZJA 1E70M 2OSXA 1KXTA 1W1PA 3VILA 2GK1B 4RE3A 4BF7A 4WF7A 4UQ9A 1UWTA 2WZIA 4CVWA 2VC9A 2FH6A 1CLVA 1B3VA 2WMFA 2NT0A 2W62A 1WAWA 3ZIZA 4U5IA 3VTRA 5CZKA 2BRWA 1CECA 1XH2A 4XZWA 2PWGA 1VIWA 1UQYA 3SUWA 1KCKA 2RGMA 3VGFA 4Z2HA 3FHQA 2VO5A 3OG2A 1UKOA 1UD2A 2O9TA 3W6MA 1KQYA 4PMZA 2VX6A 4KRUA 4AZGA 1E9LA 2J75A 1FH8A 3WQVA 1EHNA 2QMJA 3OLGA 2WC3A 2VT0A 1F9GA 3ZJ6A 5AYBA 1QI4A 1GOKA 4W85A 3ZT7A 4KWUA 2VUYA 1BLIA 1Q6FA 1E4LA 2IXVA 5HNNA 3FXYA 5GNYA 1XD1A 4DWSB 5A8OA 6A3HA 2VCAA 3UG3A 1WP6A 4D72A 3UR8A 2EXOA 1CGXA 3CO4A 1HVQA 2Y4SA 2YA0A 3VGGA 4DUWA 4LXFA 2XTKA 1J9YA 4ACZB 3WSUA 1TCMA 1US3A 1F4HA 1M7XA 2Z1KA 3WH8A 4PTXA 1US2A 1QHZA 1DWJM 1W9PA 1KXVA 3EDDA 1E6NA 3BSHA 3F4VA 5GPRA 1KXQA 3SUUA 1E6ZA 1E6XM 1E6RA 1QNOA 2DQXA 3NDZA 1AVAA 1ECEA 1B3WA 5LYRA 4V27A 2A3AA 3D5HA 2WVSA 1P6WA 1HM2A 1HM3A 5BROA 3WUEA 2EPOA 3ZT5A 2GJXB 5JIPA 5FL0A 1LL6A 3N04A 3AXHA 2NT1A 3N17A 1OINA 3ARTA 2YKKA 4AZ6A 2G41A 5BRQA 3WF2A 3PZVA 1BTCA 1OIMA 4OBSA 2VR4A 5IFTA 2E9MA 1OJOA 1M53A 1LQ0A 1TMQA 4OUEA 3WD0A 4JFWA 4W87A 3S2CA 1ZJBA 1JZ6A 1C90A 3U7BA 2D2OA 3U57A 2FGZA 3KZSA 4P7NA 4X9YA 1PIFA 1EOKA 3OGRA 1OJNA 2VX7A 3UR7A 3L4YA 1JDCA 5JBDA 3A3HA 5ECUA 1E15A 1RW9A 1OGBA 5A6LA 1E72M 2OWCA 2YOCA 4XB3A 1EQPA 4W7WA 1HJWA 1OT2A 3N1AA 5F7UA 3DYOA 1W91A 1K9FA 2V3FA 2X03A 4UOZA 3AS1A 1OBAA 1MQRA 2E4TA 2VRJA 3OBAA 1OB0A 3SCSA 3HMCA 3KWXA 3PTQA 1GZJA 4DWSC 5A6SA 5A2AA 4KGJA 4KMQA 5E0FA 5I78A 2WVVA 2XG9A 3WD3A 4NZCA 2W66A 5BXTA 2WZEA 4K68A 1BYCA 4GIAA 3EDFA 1H49A 1Q6DA 4GKLA 3U7VA 3AIQA 4Z2JA 2XGIA 3GH4A 3UEQA 2D3LA 2VQUA 1D2KA 4OOUA 4J27A 1NP0A 2GJPA 2BV9A 3K8LA 4QLLA 2CHOA 1OSEA 1W9BM 3N9KA 4C7DA 1H5VA 1DWFM 2WKLA 1K9DA 5EBAA 3RJYA 2VVNA 4GO9A 4J3UA 4HP5A 3WF3A 2UY2A 3BGAA 2OYMA 1MWOA 5ABGA 2Y8KA 3CGTA 5D9OA 1OT1A 2XWDA 4JAWA 3CHCA 5A95A 4JIEA 1UQZA 4AD4A 3AIWA 4P7LA 3GXFA 3FAWA 1E0VA 2D3NA 2RGLA 2GK1A 4AZ5A 3WNNA 3DYMA 2W61A 3WN6A 3O9NA 1R86A 4H41A 2C0HA 1U33A 1C93A 2WWCA 1X1HA 5CGTA 1JGIA 4AD2A 3T0AA 2X8RA 4TTUA 3VX1A 1RP8A 2FHBA 3SCTA 2EPNA 2QLYA 3F5KA 1LXKA 3W27A 1A47A 3GZAA 3MO4A 1UR1A 3WFZA 1MW2A 1MW3A 2ZICA 1RWCA 3OIHA 4KH2A 4W7VA 1J0KA 2YL6A 3WMCA 1E1EA 3ARWA 2DH2A 3ARRA 1ITXA 1NWUA 1XH0A 4TX8A 2VR5A 2E8YA 2VCBA 4AD1A 1QVBA 1G9HA 5HDRA 1E6PA 1PIGA 4JHZA 1HXJA 1UA3A 4PTVA 4UFJA 3PZOA 4ATWA 3OGSA 2J8FA 3OZOA 1QNRA 1E5NA 1PX3A 3VMPA 1JF6A 1WZLA 2FGLA 4AWEA 2WMIB 2C7FA 1EQCA 3CLWA 3T0BA 1WPCA 3T08A 1GJUA 4ZEPA 3MUIA 2V3EA 1SMDA 3A6OA 3WELA 5E6YA 1ZBKA 1RWHA 1WB0A 4ZENA 2XWEA 3S6TA 1V6UA 1W3LA 3KEHA 1V6VA 3UG4A 5EMYA 4Z2KA 1J0YA 1Q4NX 3ZJ8A 4AD3A 4M80A 3WDJA 1VFFA 2ZUSA 4B3LA 2WK2A 1V3MA 4C7GA 4X0NA 3NSXA 4CD8A 3OLEA 4PYSA 4AYSA 1D7FA 4OBRA 3AS0A 1W32A 2CHNA 1ISWA 3CUGA 3MUY1 2XVPA 4XUYA 2YL9A 1BFNA 3AHYA 4ZE4A 4F79A 4PUEA 1QI2A 3UETA 1V3IA 1NM9A 4B16A 3PBGA 3ZOAA 4CN6A 2XSBA 1N7RA 5I6SA 5M3WA 2YIHA 2YDQA 1V6YA 3CUIA 2DSVA 3IAPA 1ZBCA 3PZQA 3AMLA 2GJXA 3O2LA 1GQJA 5FIPA 4WKFA 5EB8A 8A3HA 3WL1A 4E8CA 4HZ6A 1UD5A 2WC7A 3BAKA 4F9DA 4UCFA 2BY3A 2W63A 1Q6CA 1ZJAA 2G8ZA 4ML4A 4M82A 5EFFA 4UQEA 1AQHA 2A3EA 5CLTA 3GM8A 5A6BD 2VNCA 2WC4A 1VB9A 2VOTA 4CVUA 2YLLA 4S3JA 1J12A 2PWDA 1IV8A 2QF8A 1FA2A 5A2BA 2WWDA 4FMVA 3WH6A 1EGUA 2BY2A 3VMOA 1QW9A 3NYDA 4TUFA 1H0GA 1BYBA 1HJQA 3GNOA 3AICA 3RDKA 5C70A 1QBAA 2ZXDA 4GI6A 4FF5A 1E6QM 2DDXA 3L2LA 1VF8A 3ARSA 3GYCA 1KGWA 1XV8A 1XC6A 4IPLA 3WNLA 1ZBWA 4W89A 2OSYA 5A8MA 3WDRA 2D23A 3ALGA 1W9XA 2J7EA 2VMFA 4L4OA 5ABFA 3L2MA 3NCOA 2HISA 4M24A 4WSKA 2PF0A 5KEZA 1V02A 1V0LA 2DPEA 1H41A 2ZOXA 2D20A 3ZJ7A 1WDPA 3AJ7A 3A4WA 2WSKA 4JHOA 3ZO9A 3WD1A 1CPUA 2Q8XA 2BS9A 3NIYA 3AQUA 4H2CA 3U5YA 4F8XA 1HF6A 1LF1A 4JFTA 3W26A 1J0IA 3RM4A 3G6LA 2DIEA 5IXEA 4W86A 3ZQ9A 2J7GA 3VD4A 2NW0A 3VIIA 4N42A 3SUVA 1VRXA 1Q6EA 4YHEA 3RILA 3WDQA 4R5EA 3SURA 3NJ3A 2FH8A 1UOKA 4HZ8A 4HTYA 1W9UA 4UTFA 1OM0A 5A94A 4B15A 3II1A 4HA1A 1LJYA 5C8BB 3AMGA 4OOZA 3AHTA 3CPUA 2W67A 5CSUA 2WVVB 1TG7A 2WBGA 3W0KA 3CTTA 4Y7EA 1TFVA 5A8QA 1HKIA 4MDOA 3RMEA 1JAEA 3SCWA 2D24A 3VU2A 1ODZA 1W1YA 3AXXA 4FLRA 1OJMA 1XSKA 3PZMA 1X6LA 3B9AA 1QHPA 3AMKA 2VI0A 3CIVA 5A69A 4D6EA 3MKKA 5D8WA 4CD4A 1HJXA 2Q1FA 3MUAA 2J4GA 3WENA 1V08A 2UY4A 2V3DA 1G01A 3FY1A 4PSPA 4MB1A 1CEOA 5KZ6A 3AIVA 2WVTA 1EHAA 5I5RA 4ZE5A 3SIMA 1E40A 2DEPA 2XPKA 1KCLA 3AROA 5A6JA 2EJ1A 4TVDA 1CB8A 3SCUA 2UWFA 4QCEA 2VZTA 1U2YA 1VJSA 1CGVA 4EANA 5DEZA 4NSBA 3AOFA 4YHGA 1DHKA 3MV11 1LWHA 2VL4A 4URIA 1HKMA 1AQ0A 3PZGA 1VEOA 3SCVA 1A3HA 5M17A 1UZ4A 1V02E 2WHJA 3RM9A 1KWGA 1CYGA 2V5DA 1GORA 1R7OA 4S3KA 3WQ8A 3CMGA 1ZU8A 5I0DA 4JL2A 2WCGA 4MB3A 3VX0A 1TVNA 3VDBA 5BWFA 1GONA 2ZUVA 1DWIM 1JNEA 1PEZA 3VIKA 2Y24A 4NRSA 1EDQA 5IHSA 3RCNA 2D0FA 3ARZA 4GINA 1EDGA 1WE5A 2WCSA 1UD4A 1FHLA 1SR0A 3ZSTA 2D0GA 4AZHA 3DHPA 4P7QA 3EMZA 4UQDA 5IFPA 3TOPA 3EMCA 2ZUWA 1N7QA 1FH9A 2B31A 1CBGA 4P8UA 1GOOA 1EOMA 2Z1SA 4MAVA 2VZUA 3L4TA 1RWGA 4LYRA 1KWKA 2XYLA 4CD6A 4CCDA 4D6CA 3APGA 2WMJA 1H1NA 2ZXQA 3QR3A 4WKHA 1GVIA 3TONA 1JD7A 1NWTA 2XGBA 4D1JA 2O9PA 2J7BA 2ZX7A 3CZGA 5BRPA 3WNKA 1E55A 4MB5A 3G6MA 2J47A 1LL7A 3OA5A 4QFUA 3ARYA 2QPSA 4GZJA 3AZTA 4GPNA 4PMUA 2VX4A 5TD4A 3MSDA 4A4AA 4FLOA 4TX6A 4CU8A 4GZEA 1BYAA 2PWHA 1RD6A 5AY7A 4AY1A 3WDHA 1HP4A 1HX0A 1J11A 2WPGA 1XSIA 3SEPA 3AFBA 2E0PA 4MJ4A 4E4PA 2BY1A 4Z2LA 3RO8A 1GVYA 4AZ7A 4XV0A 3WKZA 4GO8A 2BRPA 2ZUTA 4E2OA 1E4MM 5I24A 1EA9C 4M8UA 1NOUA 1I1XA 3IJ8A 1G94A 4L4PA 1UWQA 2A3CA 1W3HA 5GQBA 3LPGA 4AMCA 1JZ7A 1V0NA 4J7RA 2G3JA 3GH5A 4AZCA 1TA3B 1DTUA 2IUZA 1UD6A 4M81A 2E9LA 1KR1A 2ZX8A 5D9PA 3AHVA 3IANA 2CBIA 4EAMA 2J7FA 4DUXA 3WQ5A 1F4AA 1VFUA 3KL3A 2WVUA 2QMKA 5A3HA 4KRTA 4UFLA 2EO7A 5BXRA 2G3MA 1WZMA 4OJYA 7A3HA 2BFGA 4UOJA 2F8QA 5FCZA 4A3YA 3PZ9A 4U5KA 5JIWA 2G4FA 5E9AA 2D1ZA 4U3CA 4YPJA 5LA1A 4Z2GA 1TE1A 1HN0A 5A6BA 2E24A 1BYDA 1JXKA 4PN2A 3ARQA 2OYKA 2J8GA 3W28A 4BZYA 4W84A 1FP8A 3KL0A 5GNZA 5ABFB 1UKTA 4WLCA 2C8NA 1HT6A 1E0XA 4PEEA 5DMYA 1J0JA 1HIZA 1UH4A 2GSJA 3AMCA 3QGVA 2AMGA 2W4XA 2BXYA 2WBKA 1NWRA 1C3FA 2W92A 4HA4A 2D0HA 4J3VA 3SCOA 1HMWA 1B3XA 1FHDA 3OLDA 2X05A 3WH9A 3QOMA 2BVYA 2JIEA 3LPOA 2CPUA 1JZ3A 4W93A 2VVSA 1W1VA 1JI1A 4F66A 3AZRA 3L4ZA 4HPGA 3WD4A 1DWAM 4UFHA 4PSRA 4U2ZA 1E6SM 4F9JA 1BPLB 3TP4A 1K6AA 3BAJA 3PZTA 2ZX6A 2BVDA 1B3YA 2AOSA 4D6GA 3M46A 1E43A 5IHRA 4EKJA 1UWRA 7CGTA 1NARA 4BA0A 2WMGA 5A2CA 2VX5A 2O92A 3L4XA 1HKKA 1EGZA 1L8NA 5CPTA 3EDJA 1GQIA 4CN1A 1H09A 1GJWA 2OYLA 2DSUA 4B9YA 5I79A 4PRWA 3VO0A 1BVNP 3PZUA 1JD9A 4BCEA 1OCQA 2XSAA 1CXIA 2WHLA 5ABEA 4IPNB 1JI2A 3GBEA 4D6IA 3VD3A 1JIBA 4W5UA 4W5ZA 2CKSA 3ARPA 5D9MA 1HJSA 2JFEX 2CBUA 2ZUMA 1WKYA 1HJUA 1GNXA 4FK9A 2F2HA 1JFHA 2BHZA 2WM0A 3T2QA 3WEZA 4HMEA 5HBFA 1XHGA 4QLKA 3IAQA 3BXWA 2WHMA 3TA9A 1QHOA 5A8NA 6TAAA 4PBGA 1LOHA 2J25A 3WF4A 1MW1A 3JUGA 2OSWA 4WKAA 3ARVA 3POHA 3NSMA 4IUGA 5BXPA 3VGBA 1CGWA 2EBNA 3VDCA 3QHNA 4HU8A 4ZFMA 1RPKA 2VTFA 5I3DA 1D3CA 1OIFA 1UUQA 3ARUA 4AZIA 1JFXA 1V6XA 2PWEA 1UR8A 3N12A 3NUKA 3VGDA 1AMYA 3ZM8A 2WDAA 1O7AA 3AS3A 3MSGA 1E5JA 3QHMA 3THCA 1H2JA 4CD7A 4NI3A 5CLWA 2J7DA 5BCAA 1UKSA 1SFSA 1QI5A 4D1IA 2ZWYA 3IJ9A 4W88A 3K4DA 1WDRA 3HJEA 2XIIA 3GDBA 1TR1A 2UY3A 3THDA 1NQ6A 2ESCA 2WANA 2YA1A 3CZEA 4P7OA 1WNOA 2OWXA 1UA7A 4P8VA 1TA3A 1BVZA 3HU7A 3L4WA 1C8YA 1PJ9A 4J3SA 1XGZA 1EO5A 1JXJA 2WYSA 3AIEA 4PMOA 3HN3A 4LYQA 1ZBVA 3FHAA 3U5UA 4MNLA 1RP9A 4ZXLA 5CPSA 2CNCA 3W24A 5I23A 1PX8A 4JKKA 6CGTA 5HXMA 3B8SA 2EEXA 5DT5A 1VBRA 1LG1A 2MANA 1PPIA 2YL5A 5JBFA 3AS2A 3K46A 2YDRA 3WUGA 2DSKA 4PMVA 2FHCA 4MPKA 4TVCA 1J18A 1VAHA 3GH7A 5E6ZA 5AC5A 3ZMRA 4AIEA 4PCSA 8CGTA 1TZ7A 2XM2A 2JIWA 1BHGA 3BSGA 1EXPA 1UG6A 4GI9A 4OIFA 1C8XA 4CCCA 4XZBA 3WBEA 4JKLA 4JCMA 1YHTA 2OWWA 3PTKA 5LA2A 1KBKA 1PZ3A 3IJ7A 1BGAA 4BQ5A 2VJXA 4WK9A 4CUCA 4H8HA 2J7HA 4R27A 4AZCB 1VFOA 2DGAA 1W2PA 4AIOA 2ZX5A 5CPQA 4JL1A 3WFLA 4UFKA 3BAXA 1XRVA 1MQQA 2O9OA 1E71M 1EH9A 2CERA 1JYWA 1MW0A 2CESA 1J0ZA 1H11A 2X2YA 5EFDA 3WUFA 4P7RA 5DT7A 5E09A 3SCQA 5D4YA 3W29A 3I3BA 5CQ1A 3WF1A 4M56A 2XUCA 4U3AA 1QOXA 1CDGA 2WB5A 2JEQA 1B0IA 1MFVA 3M6DA 3GXDA 1HP5A 2X09A 2EPMX 1PX4A 4UNIA 1B3ZA 1PZ2A 2GJRA 3VD7A 2WW5A 3ECQA 3W6LA 4ACYA 4CKQA 1GCYA 1M03A 3AYSA 4N0RA 5DO8A 1XYZA 3I3EA 3VGEA 1C91A 3RJXA 2BHUA 5C71A 1J01A 1I1WA 2CIPA 3AMDA 2CYGA 1CZ1A 3BAIA 1HVXA 3VUPA 5CJ5A 1EO7A 4OKDA 3WDPP 1TUXA 3WNPA 2VZOA 2WCOA 3AYRA 1QI0A 1CXFA 1OD8A 2DT3A 2YBTA 1E1FA 2WAGA 3VIGA 2FDMA 3ARXA 4Z2IA 2D22A 2YBUA 5E70A 3BLKA 1VENA 1KGUA 4BQ4A 3VIPA 1UD3A 2QV4A 1W2VA 3WD2A 5AC4A 4GXPA 3VIJA 4UQBA 1GW1A 5E0CA 3VIHA 1XCXA 2W91A 4HMDA 5D8ZA 2E9BA 3F5LA 4TTGA 1GUVA 1JNDA 5FD0A 3BH4A 3K8KA 4IM4A 1G0CA 4UFIA 3VNZA 3ZT6A 4UFMA 1F1SA 2EPLX 1FOBA 4J3WA 1X1IA 1E4IA 1KXHA 5I2UA 3FN9A 4XX6A 1Q6GA 4H8VA 3LMYA 4HPHA 1C8QA 2CCRA 2WNWA 5IDIA 1JDDA 3FNDA 4LPCA 2VCCA 3WQ4A 5LA0A 3RPMA 4CCEA 1OD0A 2VZSA 1VBUA 1R85A 2XVLA 4HMCA 3ZR5A 4AW7A 3TTSA 3MANA 4UZUA 1N7NA 5AYIA 4WSJA 2XM1A 1JZ4A 1PAMA 3UCQA 4U2YA 3J7HA 2E3ZA 3W25A 2PBOA 4J28A 1BAGA 1LXMA 3CHDA 2CITA 2UY5A 4CN4A 4HZ7A 2VRKA 1M04A 3DC0A 3SUSA 1LL4A 1VFMA 4UOQA 2O9RA 3TTOA 1E3XA 1CXEA 3KL5A 3N11A 3VD5A 1DEDA 3KE0A 1OGSA 1C7SA 5BYWA 2DT1A 4B3KA 4A3HA 2ZXAA 3AIRA 1XD0A 1JZ2A 4MNKA 3PTMA 3VMNA 4HOXA 4AD5A 2WLYA 1V0MA 4H04A 1JDAA 2YJQA 4PCTA 5DF0A 1XCWA 1J10A 1QNSA 3W38A 2GFTA 1V0KA 4RE4A 3GTNA 1CGTA 3WUBA 3DYPA 1JL8A 1UKPA 3MMUA 1JYXA 1H3GA 4QDMA 2J7CA 2JEPA 1V3HA 2EQDA 3CZJA 1B2YA 1XYFA 3MV01 2VURA 1MXDA 2WMHA 4D6JA 3AZSA 2X0HA 1KB3A 3CUFA 2J74A 1C82A 3AI0A 3SCNA 3PN8A 1DWHM 3PZNA 4V28A 3B9DA 3T09A 3VGHA 1OJPA 1VEMA 4V2XA 2BRVX 4P8WA 3WNOA 1OGGA 1GPFA 2DT2A 3O6AA 1KBBA 2CETA 1W9VA 4D6DA 2FHFA 1R8LA 1H4PA 1KFWA 1HNYA 2ZIDA 4DUVA 3WEMA 2XHYA 1EIBA 4NF7A 1MYRA 4DM2A 1BSIA 2XVKA 9CGTA 4W8BA 1CTNA 2JF6A 3ZR6A 1WDQA 3AHZA 1WZAA 2WXDM 4PMQA 5CXPA 4BQ3A 3WQWA 2VRQA 1FP9A 2DSZA 2OLHA 1DWGM 1UWIA 4E8DA 5ABHA 3VOCA 2XFFA 4AEEA 4P8XA 1K9EA 4HU0A 1CGYA 3TTYA 3VKKA 1FH7A 1KQZA 2WSPA 1HKJA 4WIWA 2A3BA 3VIOA 4HA3A 1JF5A 4AEFA 1Y7VA 4PTWA 3OB8A 3A47A 3W37A 4RE2A 1TVPA 2PC8A 4C7FA 5A1AA 1JZ5A 4Q22A 3N18A 3CZLA 1GOQA 3OZPA 1CXHA 1FFQA 2WLZA 2WKGA 3NSNA 3W81A 1J0MA 3A4XA 1Z32X 3PHAA 4JCLA 4QP0A 2JE8A 1SMAA 1GHSA 3B9EA 2J77A 1B9ZA 3FAXA 1UR0A 1L0PA 2VZVA 3BC9A 4AZBA 1HL8A 1X6NA 1UR4A 2GUYA 3CUJA 3WH7A 4ATDA 1WDSA 3MMDA 1C7TA 3A4AA 4W8LA 1MXGA 3EDEA 3F5JA 2JALA 4BS0A 1E56A 2ZXBA 3M07A 4MTVA 2PB1A 2V38A 4TVUA 3D3AA 2PWFA 3AIUA 1GQKA 3VD9A 1IZKA 5HPOA 1W3KA 4Q7NA 1ISVA 3TTQA 3GNRA 1H0IA 2YLAA 1CIUA 4PMDA 1BG4A 1JZ8A 4PMYA 3CBWA 4PTMA 1B31A 3SUTA 3GBDA 1LWJA 3VM7A 3UERA 3M7SA 1G5AA 1NWSA 2J78A 3POCA 4JFVA 3LPPA 4QCFA 4LYPA 1ZB5A 3VINA 1GOIA 1HMUA 2G3NA 2ZX9A 2BY0A 2E22A 2ZUUA 3N13A 1AQMA 4U31A 2GDVA 1XSJA 3AISA 4MAZA 3ZJKA 4AXNA 1V3LA 3K1DA 4CU7A 1V3JA 1W9DM 1CWYA 3WY1A 1V6WA 4CGTA 1WZKA 3BCDA 1ISXA 1BQCA 3GNPA 1W3JA 4FLSA 2XFRA 1I75A 4QLJA 1HN1A 1CXKA 1VEPA 4M1RA 1R7AA 4ZXOA 1QI3A 1UWUA 4AD0A 4DM1A 1NH6A 1E4NA 4JZ5A 1NOWA 5CG0A 4LX4A 4QAWA 4HOZA 2QPUA 3QHOA 5M03A 2XVGA 3WF0A 1UZ1A 4DWSA 1EDTA 1VJZA 2XJ7A 4GQRA 3VIMA 1N7OA 3WQ6A 1UWSA 2BVTA 1UR9A 4KGLA 5A8PA 2IXUA 4D71A 3IK2A 1YQ2A 4ATLA 4EE9A 1XH1A 5D9NA 3LPFA 4B9ZA 3DHUA 1KR0A 4YN5A 4ACZA 2PI6A 1QBBA 1C92A 3DECA 3WBAA 4D6HA 4UR9A 1RWAA 4JFUA 3GXMA 1B90A 5JUVA 3WMSA 3K8MA 4GI8A 5HOSA 2Y2WA 4MNJA 3W53A 3L4VA 1CENA 2XIBA 2NSXA 1S46A 2Y5EA 4EK7A 1QNPA 3AHXA 3WL0A 2J79A 4LQ1A 3W4RA 1MVYA 2BXZA 1O6IA 3UESA 5JBEA 1FFRA 1E0WA 4GZIA 5I77A 4J3TA 4MB4A 1HJVA 4PMRA 2W5FA 1UYQA 4JFSA 1N7PA 1N82A 5A6MA 2V3GA 2DSWA 1RH9A 3QOKA 4PMNA 3WNMA
chains in the Genus database with same CATH superfamily
3HFTA 4HNCA 2MNRA 7XIMA 5HAOA 2ZWZA 3CMJA 2VEIA 4PBEA 2YL8A 1J8VA 4RL3A 2F84A 2GGHA 5M2FX 4GGBA 1TQXA 1WUEA 1UH2A 4JXCA 2CXGA 3EMQA 3LCFA 1QW8A 1UWAA 1JYVA 5LNRA 3URAA 5FSEC 1F3WA 3WJZA 1C9WA 2WMKA 5D2YA 1V3KA 4U33A 4W7UA 1H5YA 2ACSA 4PCNA 1OADA 5AC7A 3WBWA 3T42A 3T2PA 2YX0A 2X0YA 4WSHA 4FNRA 3MHGA 4O1CA 1E73M 1TMLA 1JAKA 5MHBA 1UIPA 4JY8A 1U5HA 2EAWA 1Q45A 3KBNA 5BXSA 4O53A 4Q4QA 2G3IA 4DPPA 2GOKA 4QJ5B 4H9ZA 3DGBA 5BOOA 4UQCA 3RPTA 1FCUA 5D38A 1IT0A 2J62A 1Q6QA 3MI2A 4XVEA 3KBJA 3MUZ1 3UG5A 2QHAA 1LOSA 3B97A 1C29A 4ONVA 3DERA 3IIVA 1KTBA 2R1PA 2ZYFA 1ZP3A 4LCRA 4MJ2A 4MNMA 4C5ZA 2NQZA 1QUMA 4G7FA 1CXLA 2GDUA 3IIPA 2R9RA 2AAAA 1YRRA 1ISYA 1EZWA 2B7QA 3EX1A 2OQLA 5LNUA 4DWSD 1JYNA 3AALA 2GVJA 2WCAA 4LGXA 2CKRA 3Q2DA 4NAFA 1J0NA 4LY4A 3BW3A 1XBZA 2E40A 1I2RA 2JF7A 1EPVA 3P3BA 3H7VA 2ZA2A 3GR4A 4H3DA 1JPIA 3ALFA 2KX9A 4H8UA 4MDPA 1AA1B 4CU6A 1ZTVA 4LVAA 4GZ7A 1O0SA 4LF2A 1SJBA 1NP2A 3QPEA 4WDTA 4M29A 3W01A 2CLKA 1V03A 3EWDA 3HFYA 3HMJG 3CHEA 4D6FA 2F2KA 3ES8A 4W9TA 3RCMA 3EBVA 3S2LA 3PZIA 4ZO6A 2R1LA 2REQB 4NILA 5FOOA 2P88A 2V8ZA 1PKMA 2DT0A 1W1TA 1MQPA 4J3XA 2PBGA 1BF2A 4FLQA 3WYZA 3DUGA 4L1GA 1KXTA 2CLMA 2DVTA 2PDFA 3L5MA 1Z69A 4BF7A 3SSJA 4UQ9A 4DZIA 1UWTA 1RV8A 3M5ZA 4MSSA 2Z6IA 5I03A 3REQA 2FGBA 1F2JA 2QF7A 3TYEA 3A3WA 3L9CA 3NQ7A 3KVJA 2V6AA 1KCKA 2Q3OA 1MMFA 3BCJA 1R3VA 1ZP4A 1KQYA 4RX0A 3RO6A 2VX6A 4KRUA 5LIUX 2A21A 4NZ1A 3O15A 5E1QA 5AN7A 3GSMA 3OLGA 2J6XA 2VT0A 2R14A 5AYBA 1QI4A 1GOKA 3DESA 2DU2A 4DLOA 1YX1A 2OTDA 4E6MA 3ABXA 1XD1A 3N6QA 1FWDC 2VCAA 4H01A 2YZ5A 2EXOA 1ECQA 3TLLA 4XZIA 4IG2B 5AHNA 4L4MA 4K3ZA 6TIMA 2Z25A 3VGGA 2F9RA 4LXFA 3L66A 1TKKA 2XTKA 3B8WA 1US3A 3B4YA 3WQDA 1PXGA 2Z1KA 3FJLA 1XLMA 2BLEA 1US2A 1QHZA 1DWJM 4WY0A 4FXJA 4M19A 1E6NA 3H53A 1QATA 1ICPA 2BB0A 3ITTA 2YEPB 1E6XM 1K8XA 2XIMA 2BOEX 3NL3A 3QSTA 1H7PA 1B3WA 4V27A 4AF0B 2A3AA 1AODA 2HS8A 2WVSA 1HM3A 2EPOA 2GJXB 4QNWA 5FL0A 4KS0A 3AXHA 3TYAA 3EPNA 2RUSA 3ARTA 5CZSA 2YKKA 4AZ6A 2G41A 3WF2A 1OIMA 3W1PA 4XISA 4L1WA 2VR4A 3T8LA 1Q13A 4Q4SA 1M53A 4KPLA 2WO5A 4JFWA 2IPWA 3S2CA 1ZJBA 4XD3A 1GTEA 4HT3A 2D2OA 4PBFA 2P3EA 2J9XA 4X9YA 4YL2A 2CZVA 2QV5A 4PMJA 3OGRA 3UR7A 4ORMA 3DHDA 3A3HA 1E15A 5DY3A 5I3IA 3NR0A 1EQPA 1HJWA 1OT2A 3W1RA 5F7UA 4Q4PA 2A2IA 1YKWA 3VOIA 5ENLA 5LSMA 1OBAA 3GDRA 1MQRA 3OTRA 4B4HA 2FYMA 3N3MA 5REQA 2PODA 3HMCA 3PTQA 1GZJA 4Y2WA 5A2AA 3TJXA 2WVVA 2YZRA 3LI0A 3SQMA 1ZNNA 3EDFA 5GJPA 3KM8A 1Q6DA 1FY6A 1U22A 1LCOA 3HM7A 1I9CB 2D3LA 1GWJA 1D2KA 4L6HA 2BV9A 3K8LA 1ENUA 2CHOA 3ITXA 1P0EA 4IP4A 3F1QA 1H63A 1PHQA 2G96A 1I45A 2V2HA 5FF2A 4A2RA 2VVNA 4UMCA 3LM7A 4HP5A 1J6OA 2UY2A 3ERPA 2OYMA 4IMEA 4DYEA 3DFSA 3M0KA 3BURA 4X63A 2PD9A 2XWDA 3JVAA 3LNMA 5A95A 4JIEA 2Z4GA 4HN4A 3C86A 2W6RA 6ALDA 4HCHA 4QM1A 2H9AA 1OF6A 1XISA 4HK5A 2J8TA 4A8LA 3WLHA 2JKPA 1A5SA 3W7PA 5G4WA 4LUTA 1C93A 5KSWA 5CGTA 2VP8A 4AD2A 1WOBA 5PTDA 4TTUA 1W5OA 5DCEA 3G0SA 3WFZA 1MW2A 3OIHA 2YL6A 5K9DA 1YPXA 1NWUA 1F3XA 1G9HA 3CMFA 3QFWA 4RK8A 3UXDA 2HBVA 4C6JA 4U28A 3PFRA 3AWOA 3B0XA 2TODA 2FGLA 4B90A 1ZY9A 4MVAA 2C7FA 5IBXA 1LLZA 1GJUA 3ANVA 3KOFA 3MUIA 1SJAA 1KCXA 4K2SA 1KV8A 1WB0A 1IF2A 3IUIA 3LM3A 4A21A 1R3QA 2XWEA 3S6TA 3GFZA 3UFYA 3KEHA 1V6VA 1M41A 4Z2KA 3STFA 4M80A 2WK2A 1V3MA 3P0XA 4JTKA 4PYSA 1XIEA 4AYSA 1D7FA 1O5RA 5TQLA 1EFZA 1W32A 2CHNA 3CUGA 3MUY1 2ZRZA 4XUYA 1IIGA 1BFNA 4F79A 1SJDA 5C9RA 1QI2A 2DZUA 1NM9A 4ZTYA 1ZJHA 1ME7A 4CN6A 2XSBA 2PDBA 4KERA 2YDQA 1V6YA 2J9ZA 2PGRA 4FO4A 2Q09A 3VC5A 1O66A 1ZBCA 5F2MA 4NNBA 4EAYA 3MJMA 1Q8JA 3O2LA 4PE8A 4MUZA 1BF6A 4KEMA 2WC7A 4D8LA 3OVRA 5J8LA 1SR9A 2BY3A 2HPIA 4QSFA 2EKCA 2H90A 1NDWA 5DCBA 2NWRA 5CLTA 3GM8A 3B03A 5A6BD 4V1XA 1KRBC 3AO0A 4MZ1A 4UTMA 3UD6A 1GKPA 1F8IA 5A8GA 3LCLA 1FA2A 2WWDA 1XJBA 4LJ3A 2VYOA 4XQ6A 3DKLA 1F6YA 4TUFA 5DANA 1BYBA 1Y65A 2GSHA 4MGGA 3S6DA 2DZBA 5C70A 4FF5A 1NAL1 3EKZA 2HK1A 2RFGA 3L2LA 2A4AA 1MUWA 3GYCA 3IS4A 4NJJA 1KCZA 3EWXA 3IJQA 2OSYA 3LCGA 5A8MA 1EF3A 2ZA3A 3TQKA 2NQ5A 2D23A 1W9XA 1A5NC 4HGXA 4ZQNA 4L4OA 3NCOA 4PEKA 3EXTA 2OVLA 1V02A 1V0LA 1EJXC 2ZOXA 6ENLA 2D20A 3IVSA 3MT1A 1JUBA 4Q7BA 3KVLA 3GNNA 4LCSA 3A5FA 3A4WA 2XZ9A 2BS9A 1KRMA 1H62A 5H8PA 2WNQA 1DIOA 3ZQ9A 2J7GA 4XKMA 3RRAA 4DIAA 2Q02A 3L0NA 1VRXA 1HTIA 3UWYA 2QCDB 4R5EA 3SURA 3GDTA 4PUMA 2HVOA 3BO9A 1W9UA 4UTFA 4QJ1A 4B15A 3V36A 1FXPA 4JIHA 2GYIA 4HU4A 1SFTA 3MVTA 3AHTA 5CSUA 2W67A 4IIBA 4Q6JA 5GJNA 3LYEA 1K4GA 1TFVA 1WKEA 5A8QA 3RMEA 1UASA 1U1UA 1ME8A 3SCWA 3VU2A 5XINA 3OHIA 4FLRA 4R9OA 1OJMA 2HXUA 5TBOA 3PZMA 1X6LA 4QG6A 4MY1A 3A24A 1Z7AA 2Q1FA 3OOQA 3BV4A 2EPHA 2QJIA 3S0CA 3UU0A 2V3DA 4XO7A 4JQ1A 3R25A 4XSLA 2WVTA 1OZMA 5G2HA 5CAKA 3CTLA 2NSOA 1QR7A 3BLIA 3BQ6A 2Y7DA 3N2OA 1ZHAA 4TVDA 2VZTA 4EPDC 1U2YA 4ZR8A 5K3VA 2E77A 2VZKD 4NSBA 5FJIA 3UVAA 4NVTA 2OEJA 5EMJA 1AQ0A 3PZGA 3S42A 3BZGA 5M17A 2WHJA 5D2WA 3LLXA 4ZQPA 1GORA 1L6WA 2A1YA 4PUUA 5C2XA 1PSCA 2X2GA 4GXMA 1J79A 3BL3A 1F9CA 1R9ZA 1WKFA 4DRSA 4MB3A 1NY1A 5BWFA 3VCCA 2EF9A 2DJXA 1P6CA 4YXGA 3I7RA 1VQTA 2Y24A 4YVXA 3FLUA 3IARA 1QXLA 2HNEA 3HG5A 3ARZA 4GINA 1EDGA 2WCSA 4XZMX 3PSWA 2D0GA 2ZRVA 4LY8A 2BBFA 3IIOA 3HBLA 3EMCA 2FZMA 3E0WA 1N7QA 3W7NA 3CO8A 1DORA 2ZRYA 1SO3A 3FXGA 4R7OA 1EOMA 4K7YA 4PL1A 3A23A 4ZTXA 3MHFA 1QRQA 2ZXQA 3E9AA 3NEHA 3TONA 2I56A 4I8YA 4D1JA 2ZX7A 1CI1A 4MB5A 2NZLA 2J47A 3BVJA 2UV8G 1LL7A 3CWHA 3HTWA 1AD4A 3LB0A 3VDGA 4QS6A 3PUOA 1OYCA 1DJZA 2QPSA 1BWLA 4HPJA 4XZLX 2VX4A 1J2WA 4TX6A 3UJFA 3NA8A 2XDFA 2OB3A 2WPGA 1XSIA 4O10A 4G6CA 1KFBA 2GJLA 1DJNA 3RO8A 1GVYA 4AZ7A 4XV0A 2ZUTA 3WLNA 3NQDA 5I24A 1NOUA 1I1XA 2FVMA 4S3FA 1OCJA 3ZLGA 1EBGA 4NU7A 4L4PA 3S1XA 2A3CA 1W3HA 1XS2A 5GQBA 1YMYA 1V0NA 2ABAA 3CEPA 3LA4A 2BG5A 2FMOA 3GW3A 2WV8A 1UD6A 3H2FA 4M81A 1KR1A 4DXXA 2ZCGA 5EMLA 1IT7A 3OP2A 3EWWA 3VOFA 3WQ5A 1F4AA 3NPWA 5A3HA 3ZFHA 3CV7A 4GKTA 2G3MA 1WZMA 2BFGA 4UOJA 3PZ9A 1GQNA 3LXBA 3LHVA 5JIWA 3FYOA 4Z2GA 2J13A 2VDIA 1HN0A 4A8IA 2E24A 3PB2A 4MMWA 1GG1A 3G1DA 1R46A 4X22A 2A0NA 4W84A 2QUVA 5GNZA 5ABFB 3CB8A 4ZFCA 2CHRA 1NQKA 2H6RA 3GG8A 4Q4MA 1LROA 1XYMA 2QGYA 4MY9A 2Y5JA 3CWOX 2GSJA 5LNVA 2JGQA 2AMGA 4YLWA 2BXYA 2VC7A 2WBKA 4ZO8A 2BOFX 3SB0A 4Z0JA 3OLDA 2X05A 2F38A 4JTFA 2FZNA 2BVYA 2CPUA 2VKZG 1TO3A 5EKYA 2V81A 4F66A 3D0CA 3AZRA 1DWAM 4UFHA 2GGJA 3W7CA 5I3GA 1GVEA 1TVLA 3F4CA 1BPLB 2GPTA 1S2WA 3TP4A 1K6AA 4A35A 4AEOA 1V4YA 3PZTA 1B3YA 2ATMA 4GCAA 1PDYA 1FWCC 4EXAA 4EKJA 1UWRA 2VEKA 5D09A 4Y96A 2BMBA 4LS0A 3F4NA 2VX5A 3VABA 3L4XA 4EXBA 1XBYA 4QHRA 3STCA 3N14A 2NQLA 3XIMA 4S1FA 1G7VA 3Q65A 2ZA1A 4IMFA 4CN1A 4HYRA 1H09A 3PQIA 4G1NA 3W83A 2DSUA 4I9MA 2IW0A 1YNPA 1JD9A 3PZUA 4BCEA 1B9BA 3TW6A 2XSAA 4CNSA 1TWIA 2OKOA 3EOLA 4IZGA 2HBXA 3B8VA 3RHGA 1JI2A 3W87A 4D6IA 5D9MA 1FBAA 3QMRA 1HJSA 2CBUA 4AWTA 1WKYA 1XR2A 2BHZA 3WEZA 3HURA 4JNYA 1DTNA 1XHGA 1OEPA 3LK6A 3IAQA 3WLIA 1TPB1 3TA9A 1FTXA 4GJ1A 2AL2A 2WJFA 4PBGA 1KM5A 2CLEA 3HQNA 1EJWC 1UROA 3TA6A 3LX9A 1ZZMA 1CGWA 3CAVA 3QF0A 1YXYA 2AMXA 3BE7A 4Y9NA 1Y8BA 1G7UA 3R5EA 1V6XA 3SQSA 3ZM8A 2WDAA 4CEXC 2E5DA 2ISWA 3PWAA 4FX7A 4L64A 1UZDA 4IL0A 4CD7A 4NI3A 2J7DA 3WQGA 3SADA 1SFSA 1QI5A 5FJTA 3V0UA 2ZWYA 1RHCA 1WDRA 4S3GA 3THDA 1ZPTA 2ESCA 3PBWA 3CZEA 5HANA 4FR6A 3RFAA 4P8VA 1TA3A 3HU7A 1UP3A 1X96A 1C8YA 1PJ9A 2Z7GA 1M7PA 3G77A 4XAFA 3ES7A 2WYSA 3AIEA 3OODA 3HN3A 1A4MA 1AK5A 1ZBVA 4XBSA 3U5UA 1TX0A 3NAVA 4N7QA 4Z1CA 3WJWA 4FIRA 5HATA 3ELFA 4ZODA 3U4AA 6CGTA 4JEQA 3SJNA 5HXMA 3VZZA 1J5TA 4QE1A 5DT5A 1LG1A 1PPIA 4RDWA 3K46A 1D9EA 3W2LA 1HZYA 4GCXA 1J18A 1VCFA 1VAHA 4XIAA 3ZMRA 3BOFA 2Y7FA 4GY0A 4PCSA 3Q45A 3TC7A 5CCZA 2FQIA 4A2SA 1RQEA 2A7NA 2I14A 1DOSA 4MUPA 4OECA 1F3TA 1C8XA 4CCCA 4FF7A 3WBEA 1S2AA 1YXDA 4GVGA 5XIAA 2CW6A 3LU2A 3PTKA 3RF9A 5AB3A 3DOPA 1KBKA 3IJ7A 1BGAA 3HGJA 2WKJA 5LZLA 4CUCA 4DJEA 3QMTA 5EGRA 4R27A 1MZHA 3R1ZA 1VFOA 1FDYA 2ZX5A 3NPUA 2L5HA 1ZALA 1UW9A 3W75A 1EXBA 2XH0A 4L61A 4LV9A 5C5YA 1MW0A 3KOZA 2ZVRA 2VGIA 3C56A 3SCQA 1PKYA 3BLOA 4K1GA 4N6EA 3DFPA 2IKGA 2XUCA 2HDJA 4U3AA 2I57A 1QOXA 4I6KA 3SN1A 3PANA 4UNLA 3ONCA 1YBQA 4H9MA 4H9VA 1KBJA 4UNIA 3SGUA 3VD7A 4HSNA 2Z2UA 3ECQA 1IR2A 4ACYA 5H8MA 4CKQA 2P0IA 4IQJA 4UMBA 3MDUA 2GQ8A 3C5QA 3BG5A 2EG8A 1OFEA 2BHUA 3O16A 1HKVA 1I2QA 2CYGA 1Q85A 3QPYA 3BAIA 1HVXA 3IRSA 4B5XA 4HA0A 1UJPA 2QS8A 2QUNA 1JCXA 1XGDA 3WDPP 4DBSA 1TUXA 2DZSA 2OQYA 2BGQA 3AYRA 1QI0A 2DT3A 2ONEA 2WAGA 3VIGA 2G95A 4Z2IA 5DN1A 1X1ZA 2YBUA 2CWXA 4GVHA 4F0LA 2I9EA 1KGUA 1PCWA 3VIPA 4GXPA 3RR1A 5FF4A 4UQBA 1GW1A 4WDXA 5E0CA 4N4PA 1X7IA 1BEUA 3F5LA 4MKSA 2ZZ5A 4Q8PA 1OX4B 3BH4A 4YVPA 3PPFA 3PBYA 3K8KA 3ID7A 4HD5A 4UFIA 3VNZA 4Z42C 3TW9A 2BOGX 1R5YA 4L56A 3XISA 1F61A 3EEGA 3FN9A 1VP5A 1P0KA 1AZ1A 3NWRA 4H8VA 3LMYA 1C8QA 5IDIA 3GE7A 3FNDA 2PEVA 2FZ9A 4NI8A 3STPA 5DRCA 1VBUA 1R85A 3ZR5A 3TTSA 5FEWA 2VGFA 4DAIA 1CLKA 5AYIA 3EA2A 4WSJA 1OC5A 1U5JA 2PGEA 1DV7A 4KCVA 4U2YA 3J7HA 4F0SA 3W25A 4BK9A 2PGFA 4GY1A 1EJUC 1LXMA 1IZCA 2QGHA 3SR7A 4QJ3B 1B57A 1YDVA 1QK0A 1LBMA 6REQA 1BKSA 3DC0A 6PTDA 1VFMA 3C52A 2O9RA 4KKXA 3QQ0A 3QV9A 1V93A 1OGSA 2PC4A 2QIWA 4IMDA 5BYWA 3MZ2A 2DT1A 3W1LA 2ZXAA 3AIRA 4AD5A 4CQBA 2WLYA 4J3ZA 3FFSA 4MYXA 3VZYA 2NXIA 3CT2A 1XCWA 2DW7A 1KFLA 1WXJA 5HA7A 3EOSA 3W38A 1V0KA 3GTNA 3H54A 1AH3A 3DYPA 2Q8ZA 2QCMA 3W7EA 1H3GA 1D3HA 3S5NA 2FZDA 3PULA 4FHAA 4K8HA 1DL3A 3B40A 2EQDA 4GC3A 1B2YA 1MXDA 1OG0A 3PBMA 1T8QA 3HA1A 1KB3A 4LNYA 1MRQA 2J74A 4KCTA 4YNGA 3AI0A 3SCNA 1KW1A 1DWHM 3WK0A 2QCHA 3AAMA 4QQUA 3MI6A 2DZXA 4IFRA 3WNOA 2QYGA 2DT2A 3IGHX 4D6DA 2FHFA 1H4PA 1HNYA 2ZIDA 3TC6A 4O0KA 3SRHA 5M1TA 1EIBA 4XAYA 4NF7A 1NFPA 2XVKA 4FOKA 3AJXA 4W8BA 1CTNA 2DVXA 3QMSA 4HNLA 1WDQA 4PMQA 5HWNA 4UTUA 2GSEA 3MP5A 4W4QA 3TAKA 5LIKX 4NY2A 1JVNA 1K9EA 4LEFA 4K37A 2WSPA 4WIWA 2A3BA 3UPBA 4HA3A 3OIXA 1TZ9A 3C3NA 4PTWA 3BANA 4JTUA 4GY7A 4RE2A 2PC8A 4C7FA 1W17A 4R88A 4L9ZA 3OBKA 3N18A 3JR2A 4HK7A 4RV8A 2D73A 2WKGA 1VGAA 1XCFA 1J0MA 1GOXA 5CH9A 2JE8A 3R79A 1JEZA 2HSAA 3TV8A 3FAXA 1UR0A 1L0PA 3PUEA 4ICMA 3A9BA 1RUSA 3CUJA 4PGLA 1WDSA 3V1PA 4MFDA 3EDEA 5HINA 2JALA 4DZAA 5KETA 1E56A 3M07A 4DBDA 2PB1A 3SQLA 2V38A 4XBKA 3G8EA 2PWFA 1YPIA 3STGA 1W3KA 4Q7NA 3RK8A 2E1WA 1ISVA 3VKCA 5L9FA 3KBUC 4UCGA 2ZE3A 1NF7A 5CPOA 4PB3A 2Y7EA 4PMYA 3SUTA 3GBDA 4ERAA 3M7SA 1G5AA 1JDEA 2AKMA 3TJLA 3ANYA 4LYPA 2PDLA 1RLCL 2ZX9A 2ZUUA 1JR1A 1NFGA 3SFKA 5K9XA 3EB4A 4O8RA 5LIYX 1NELA 2W9MA 1UOZA 4WHBA 4ILSA 3AISA 3ZJKA 5HJXA 1UP2A 1UC4A 1A0CA 2YBVA 4CGTA 3QFEA 1VPYA 4U10A 3W9ZA 3C0LA 4MWAD 3BUVA 1DPMA 3UGVA 5AZ1A 1TCDA 1WDWA 4H2HA 2Y6ZA 4DM1A 1TPVA 2OEMA 2GGGA 2PLMA 2VEGA 4LX4A 4QAWA 4HOZA 3QHOA 1S5MA 4GYFA 4INFA 3HPXA 4YCPA 3HPSA 5BMXA 1EDTA 2GL5A 2WQDA 4HCDA 1FWBC 4OGZA 3V4BA 2CXEA 3IWPA 4CLMA 2INEA 3TAOA 4IG2A 1AL8A 3W7JA 3D6NA 1NVMA 2Z1VA 4JTAA 5D9NA 1VS1A 3LPFA 3DHUA 3L65A 5KINA 3UCCA 4PB5A 4YN5A 3GTHA 3GAKA 4S2BA 2FFIA 3GXMA 1GYLA 5FF0A 5JUVA 3WMSA 4GI8A 5E0KA 3IPWA 2WNNA 4KBXA 4Y90A 1CENA 3TCEA 4WZHA 3E0FA 2NSXA 3BMXA 4JTLA 1YE4A 3TYBA 1QNPA 4DO7A 1W5QA 1K1DA 5LIXX 1GEHA 3UJEA 4AF0A 4DWDA 3UZJA 3M7WA 1E0WA 4GZIA 4J3TA 4PMRA 3KCOA 2FJKA 1Q66A 1N7PA 3UJ2A 2V3GA 4RNJA 3FDGA 4PMNA 2PDQA 3H4XA 3CL8A 3IV3A 2QVNA 3V3WA 2TMDA 1RBLA 1I8QA 1PV8A 2TAAA 1HL9A 3OEXA 3OGVA 5IDZA 3GHUA 1G1YA 3MU7A 2V69A 1PVNA 3W71A 1ESWA 1R9XA 2V9DA 1QPKA 5LNSA 3S2MA 4H7VA 3WIJA 2OEKA 3QJAA 4MZ8A 3CQ0A 1U83A 1V6TA 1GQLA 3RXZA 4FXFA 3CHFA 3QR0A 2ZRUA 3DH7A 3ZSSA 3W2NA 1T41A 2BNJA 1FKWA 1ISZA 4PUDA 7TAAA 1WQ5A 4HIBA 1LBLA 3MSRA 3VNYA 4IPPA 4ZQOA 3A64A 2WZHA 1N2VA 3TQPA 1NOFA 1SW7A 3UCDA 3SCRA 3N15A 4NASA 1XG4A 3QKEA 2CBVA 3SCPA 5FESA 3OLIA 4NT0A 3W02A 4E3VA 2WHKA 1R87A 5KZMA 3BCFA 3L0GA 3L0KA 4H9TA 1EB3A 3FOKA 3EYPA 5CSYA 2QXWA 4M51A 1QFEA 2GOUA 3RM8A 4FNTA 3W82A 4B4FA 3A22A 3EWUA 2Y61A 4S38A 3BLPX 5FKYA 3AXIA 1ZGDA 5I3HA 4LV4A 3TN6A 4CEUC 1OC6A 3W7IA 4ZL1A 3N2MA 3H2CA 4G1KA 3BJSA 3L4UA 4TIMA 4AIUA 1POKA 2GVYA 4ZA0A 4QDWA 1GOMA 5I3KA 1L2QA 4V33A 3GS6A 3NDYA 4GQQA 3E5BA 2OGJA 4HOWA 2EPKX 3BWWA 1TWDA 3IUHA 4JKMA 2H8XA 1K9TA 1X1NA 5BWAA 3V0SA 5M5DA 1VJIA 5T9CE 3CZKA 2DIJA 3I6EA 4IISA 4WJXA 1V7YA 2VELA 2ZRWA 3RX4A 3NGFA 5E9XA 3Q94A 4M1BA 1V77A 3T55A 4GH3A 1LUCB 5JH1A 1E3ZA 1ONWA 1Z3NA 1B30A 2XFYA 3BAYA 4C60A 4E4UA 3PG9A 4CD5A 4O1AA 1X1JA 2EJAA 5FA5A 2VFHA 3EDKA 1Q2SA 3IGSA 3UNTA 1GOWA 1OHLA 1Z48A 4AAJA 3M4HA 1W1PA 2ZZ6A 4RE3A 1OFOA 1M6JA 4HKPA 1SPQA 4BEQA 2NT0A 4H6RA 4ZQCA 3ZIZA 4G8TA 4U5IA 2D2HA 3LOTA 4BR1A 5CZKA 3W2UA 1CECA 1TZZA 2ANUA 3GVWA 1Q7ZA 3SUWA 2RGMA 2V5LA 3VGFA 1XL9A 2QIIA 2VO5A 3OG2A 1UD2A 2O9TA 4GNKB 1TE6A 4LSBA 4H1ZA 4PMZA 4AZGA 3O6CA 3WQVA 1EHNA 1W5PA 1D7KA 1QPQA 3RG6A 2WC3A 1F9GA 3AU6A 3QXBA 3RPDA 3ZJ6A 3ZT7A 5EBUA 4DY1A 4QSHA 3W23A 1F7BA 3SN4A 4R7WA 2NX1A 4RW3A 4UUIA 5HNNA 3FXYA 5GNYA 5A8OA 2IKJA 4EOUA 3UG3A 1H60A 1VPQA 2QEZA 3BG3A 3CAWA 3N6JA 2G5WA 3QPZA 2VEFA 3R8GA 1L6FA 4ZMGA 4JN6A 2CLFA 4LS1A 3QYQA 4ADTA 2HE5A 1TCMA 1M7XA 4JTDA 5F4SA 4IUOA 4C6FA 3G0UA 3NDOA 4JICA 4O13A 3EDDA 5JU6A 4JHMA 3BSHA 3EOUA 1E6ZA 3UZWA 1E6RA 4LRSA 4ZOCA 1QNOA 3VK5A 1AVAA 5LYRA 4K39A 1EC7A 4NZ4A 1YNQA 3D5HA 1HM2A 5JIPA 1LL6A 1RCXB 4XIMA 3THQA 4MJZA 4K36A 3TVAA 3M47A 3PZVA 1BTCA 1X7FA 1JQXA 5IFTA 1G69A 5HQMA 4HSHA 2PAJA 4W87A 2B7PA 2R1NA 3WZ0E 4P7NA 1EOKA 1OJNA 1P1MA 5D33A 3QQ1A 3MDWA 7ENLA 5C54A 2FVLA 1MDLA 1RW9A 3N2CA 4E4FA 2QUMA 2YOCA 3E96A 3H21A 3NURA 5FEXA 1ZQ5A 1W91A 1K9FA 3MKCA 2QCDA 1KC7A 5L6UA 3WK2A 3RAOA 2DV0A 1IWAA 2E4TA 4FAMA 2P1FA 2PS2A 4QGCA 4DWSC 5A6SA 4KGJA 4KMQA 2XG9A 4JYEA 4IFOA 4AC7C 1TTQA 4K68A 3UA3A 4NIRA 1VLIA 3PTDA 4XTIA 4GKLA 3EOEA 1B54A 4AY8A 2PD5A 2VQUA 4OOUA 2QZRA 2GJPA 1R2TA 5TIMA 1S2UA 3N9KA 4C7DA 3P2VA 1DWFM 3T0CA 2WKLA 4Q8MA 3M1ZA 1K9DA 4IJBA 3RJYA 4GO9A 4J3UA 3WF3A 5FJPA 4YMZA 3CL7A 2ATSA 1OT1A 1GVOA 1OK6A 2GWGA 1UQZA 3D3FA 2B0MA 3O7UA 2GK1A 4AZ5A 3H4GA 3QRHA 1FWSA 3DYMA 2VM8A 4O1FA 1WX0A 1R86A 4H41A 4JEJA 2C0HA 2WWCA 4ADSA 3W70A 3UPMA 1RR2A 3N25A 3CIXA 1GYNA 1RP8A 1OQFA 2A3LA 3EX4A 3T4CA 1LXKA 4XD5A 2A7PA 3GZAA 5T26A 3O0KA 1RWCA 4KH2A 4W7VA 1E1EA 2DH2A 3VYLA 1ITXA 4XBJA 2Z26A 3GC2A 3ATYA 2VCBA 4DO6A 5HDRA 1RJPA 3GUGA 4PTVA 4UFJA 3G1HA 4ATWA 3OGSA 4S2CA 1XXXA 3WG6A 4JQ3A 3VMPA 3LBMA 1ITQA 1XIHA 2V63A 4KWWA 1GW9A 5E93A 3V75A 2WMIB 4IICA 3T0BA 4KCUA 3ENLA 1K02A 2OU4A 1I6NA 4ZEPA 2V3EA 1KV5A 3A6OA 5EMMA 1RWHA 5IM51 1FWEC 4NZ3A 1XPGA 2BWGA 1W3LA 3FYYA 3KUMA 2PSNA 3NZ1A 2DW6A 4EF9A 3GU9A 3WDJA 4WXYA 2ZZ4A 4C7GA 4ZQRA 3GYEA 3OLEA 3U2EA 1T6MA 2VD8A 2WOQA 2PDGA 5CZ0A 4ZE4A 5EA9A 3UETA 4WGHA 3G1VA 3L12A 3ZOAA 4QAIA 2P8BA 4WY0F 3W73A 5AYYA 3CUIA 1FWHC 2UZ9A 3W2MA 3PZQA 3AMLA 4PUJA 1BWVA 1QPRA 3H26A 5FIPA 3O3RA 3IIZA 5EB8A 3QTPA 8A3HA 3WL1A 4E8CA 5F1VA 4HZ6A 4F9DA 4UCFA 1Q6CA 2XH4A 1IWPA 5KITA 4QJ4B 4M82A 3LEPA 5EFFA 1DKWA 1FWFC 1V8EA 2VOTA 3G24A 2YLLA 3F2DA 5LNWA 4S3CA 2EG7A 3QTGA 3T81A 3CYVA 4F0MA 3SGZA 1VCGA 3WH6A 1LZOA 3VMOA 5HNTA 2BP1A 3NYDA 3MB9A 1HJQA 1X98A 1ONRA 3RDKA 2DIKA 3S1UA 4GI6A 5FEZA 1E6QM 1GK8A 4D8AA 1DJHA 1VF8A 2DVUA 2PDUA 4I3GA 3ARSA 5HR7A 4EIVA 4M6QA 4IPLA 3WNLA 2DZVA 3IUDA 1ZBWA 4W89A 3APTA 1IWBA 4BFAA 1AW1A 3WDRA 2F6XA 3N4AA 2VMFA 2QJGA 4MG4A 1TPFA 2YYTA 5ABFA 3L2MA 3BDKA 1MUMA 4M24A 4NNCA 3LTYA 5DBUA 3VNMA 4DXVA 5HMFA 3CQJA 1RXOB 4Q4OA 3CHVA 1VZWA 3NVDA 3TUUA 1EUNA 5F1UA 3KRUA 4C6KA 3VCNA 1A5AA 1OK4A 2VGGA 4RZ6A 4S3BA 3AJ7A 4HCLA 4JTIA 4M3PA 1ML1A 3ZO9A 3WD1A 1WOAA 1CPUA 4GBUA 3NIYA 1A5BA 3EX2A 4JS3A 1HF6A 4GYPC 4JFTA 2EG6A 3LN3A 2YFOA 2PWVA 3RU8X 1HW6A 5IXEA 1UJQA 4CQ8A 4W86A 2Z29A 3VD4A 4N42A 5G5IA 4LB4A 4YHEA 1H1YA 4LANA 3PB0A 1LT7A 1JCJA 3WDQA 4IIHA 5ABTA 3NJ3A 3TYZA 4FSAA 3A12A 1TX2A 3BGGA 3P60A 1A80A 2POZA 5C8BB 2NUWA 5DXXA 3LBCA 2Y7GA 3QZAA 3CTTA 4FI4A 3LXAA 3USZA 1DXIA 4MDOA 3LD5A 2D24A 3GK0A 4AB4A 2TPSA 1UMYA 2VI0A 4J40A 4Q3MA 4CD4A 4IPIA 5DMNA 2RAGA 2Y5SA 3P0WA 3MUAA 2HTMA 2J4GA 1XYCA 3WENA 2XN0A 3FY1A 3FGCB 3HV8A 4L6DA 4AHQA 4C6DA 5KZ6A 4IP5A 2HWGA 3AIVA 4JDYA 3KP1A 4ZE5A 4ZZ9A 1MSSA 5G4HC 3MKVA 5D2TA 4ORIA 5A6JA 2ZADA 2EJ1A 2GQAA 3SCUA 2P76A 2IS7A 2UWFA 4QCEA 5JXQA 3TROA 5FF7A 1VJSA 1KM0A 1EA0A 4IH3A 1PCKA 3H23A 1DBTA 1LWHA 2VL4A 2O4QA 5I06A 3GHRA 5D32A 2G3FA 1P0NA 4X61A 2B4GA 1VEOA 3SCVA 5C9WA 5CJNA 3SRFA 1L6YA 5FAJA 1CYGA 3U2ZA 1RA0A 2V4IB 2KXSA 4UTTA 4OV9A 3BV7A 2Q01A 1TVNA 3SFWA 4HBKA 1JNEA 1PEZA 1OCBA 4LU0A 4N9BA 3PAJA 5IHSA 3B8TA 1W5MA 5AHFA 1WE5A 1UD4A 4YYCA 2HPMA 3PK7A 3KBTC 3ZSTA 4LB3A 3SO7A 3DHPA 3R89A 5CZJA 3U6WA 1XDMA 1V79A 2P8CA 3IJ6A 4P61A 2JKAA 2OT1A 4MAVA 2VZUA 1RWGA 3MYPA 3JZEA 4CCDA 4D6CA 3APGA 4GI4A 4H9XA 3RYSA 1REQB 1GVIA 1JD7A 2XZ7A 1NWTA 3NL5A 3CWNA 3CZGA 5BRPA 3PM6A 2PDJA 3MCNA 3G6MA 5H6HA 3QZEA 4BWLA 1IXQA 2VDHA 3OA5A 1YYAA 1VYPX 2QJJA 8XIMA 2ISSA 3AZTA 2QCFA 4KFPA 4NNAA 2ZC1A 3TYUA 1GZ1A 3LQLA 5CC5A 2PLJA 3WLTA 1J11A 4H9YA 1BKHA 2E0PA 4E4PA 5FF3A 3SN0A 1SJCA 2ZZ7A 4R33A 5KZEA 2OQHA 1ZAHA 3WKZA 3IVUA 3B06A 3W3OA 3UXLA 4O14A 4M8UA 4IFKB 4WGXA 4WX2A 3TR2A 3NQGA 5XIMA 2VGBA 1AJ0A 1G94A 2AQOA 1JZ7A 1RJQA 1TA3B 1DTUA 2IUZA 4GFIA 1OFBA 2E9LA 4LH8A 2B81A 2CBIA 1YE6A 4EAMA 2DQWA 2J7FA 3LCWA 4UBPC 1VFUA 2QMKA 4KRTA 3CASA 2EO7A 1VIZA 3M0LA 4U5KA 2G4FA 5E9AA 4U3CA 4N4QA 1PKNA 4HHPA 4WVXA 1ADSA 4LVDA 4N2YA 5A6BA 3MUCA 3ICJA 1H1ZA 2PRLA 1BYDA 3KZPA 1R6WA 3BLDA 2J8GA 1FP8A 4WLCA 4DYJA 1HT6A 1HIZA 5EMKA 4JNMA 1S2VA 1NFBA 3APYA 4XAGA 2R82A 2X42A 5I3JA 1ICQA 4AIBA 1XQLA 3VUSA 3WK3A 1XFCA 3NOEA 2NQ9A 3CQHA 4PCPA 2NV2A 1EZ2A 1ZRQA 1TQJA 4A3QA 1W1VA 1FWWA 3LGEA 2MUCA 4PSRA 1NU5A 1E6SM 1PTDA 5AYZA 3LGGA 4UNKA 3S3GA 2ZX6A 2FFCA 2AOSA 5C2CA 1GGOA 1POJA 1OX4A 7CGTA 3VOJA 1SZGA 1A50A 3B0YA 5A2CA 5F2IA 4BY3A 2VFFA 2EHHA 4I9JA 5CPTA 3M6YA 1GQIA 4GJJA 4A8NA 5I07A 1T8XA 3KS5A 2FVKA 2ACRA 1WAUA 2OYLA 2FB2A 4EACA 4B9YA 3VZXA 2E09A 5I79A 3AC0A 4WJ8A 5D2XA 4ZQMA 1TPWA 2OOGA 1AUSL 2OZ8A 4I5XA 1JIBA 4W5ZA 2CKSA 4KWSA 3QV7A 4RNFA 4IX2A 3MYOA 4DJFA 1PUDA 5H8UA 5KMYA 4QLKA 5E5CA 4KESA 2C91A 2V0TA 4F0KA 2QW5A 4ZSUA 1VHCA 3VNIA 2J25A 1AFSA 4AQLA 3BLEA 3ARVA 3POHA 3OPSA 3IV8A 1E0TA 4RV3A 1TREA 1KA9F 4JY9A 3VDCA 4JTSA 4OUIA 3VNJA 5I3DA 8RUCA 1IHIA 5TAOA 2NV9A 1UUQA 4RDZA 3KBWA 2NUYA 3NUKA 2WSRA 1HUVA 3OZYA 5C6MA 3GWQA 2PCEA 1RPXA 1S2CA 4H19A 3GG1A 1UKSA 1W1A1 1CB7B 2PDWA 4D1IA 2ZDSA 4NAEB 4W88A 3HJEA 2PDNA 2XIIA 3LHTA 1PTGA 2OO6A 2YB4A 5JMUA 3O05A 2PTZA 2R91A 4P7OA 2OWXA 1UA7A 3L4WA 1JXJA 4WOQA 1TRDA 2YXOA 5BNKA 1AH0A 3W76A 4PMOA 3NEVA 4JTJA 3GFXA 1RP9A 4ZXLA 5F4WA 3LERA 3W24A 1OABA 5I23A 5KZDA 2BASA 1PX8A 4DI9A 3A5VA 2ALDA 1EP3A 2X1RA 3B8SA 1IYXA 3V5CA 1KRAC 1TPH1 4DO5A 3B0VC 4MM1A 3M0YA 4GG9A 4Q8WA 3DFQA 1EJVC 4CNOA 3TDFA 5AC5A 1XUZA 1TZ7A 2BGNE 2JIWA 1BHGA 3UG8A 1UG6A 1KM2A 4OIFA 1Q8AA 4JKLA 4DLQA 2JBMA 1LP6A 1EGMA 3M0HA 4AG0A 3KXQA 5G2WA 5LA2A 1PZ3A 2GQ9A 1AQFA 3NO1A 1IEVA 4AZCB 1XDJA 1G4TA 3TJIA 1W2PA 4AIOA 3PY2A 3K5XA 2KZHA 4KWVA 3WFLA 4UFKA 2WPBA 3W7RA 4Q8VA 2VOMA 1XRVA 1MQQA 1LLQA 2O7QA 3G1AA 4P7RA 3SRKA 5E09A 3THUA 1PE1A 1ZUAX 5D4YA 3W29A 5CQ1A 4QRNA 1FCVA 1T40A 3WMLA 2GVLA 1B3OA 4Y9OA 1K8CA 3S6OA 4IMGA 3P81A 1B0IA 2Y85A 4GIEA 2X16A 2P10A 4GH1A 3R10A 3VE9A 1G4SA 1FWTA 2EPMX 1P4CA 3SY5A 2NXGA 2HJPA 3FJNA 1GCYA 3AYSA 3MHUA 4N0RA 4DZHA 2FZBA 1XYZA 3I3EA 3NGJA 3VGEA 3TJ4A 9RUBA 2PE4A 3LCIA 1I1WA 2CIPA 2PMQA 1CZ1A 2ODOA 3VUPA 4Z1DA 5CJ5A 4OKDA 4D2JA 4B3ZA 3KTCA 2LLEA 3BSMA 3UY7A 1CXFA 2YPIA 2YBTA 2HQAA 3WLMA 3KW3A 1PIIA 3R0KA 3LRLA 3MVIA 1YIXA 3CPRA 5CG7A 2VR2A 1XC4A 1L9WA 1S3HA 3GDMA 3UWVA 1XCXA 2W91A 4HMDA 5BU9A 4DNHA 4GVFA 4TTGA 1GUVA 3WFAA 4V15A 2HNHA 3ITVA 1G0CA 4UFMA 3RLVA 1F1SA 3AWNA 4QIUA 1FOBA 4J3WA 4AMAA 2VEMA 4RLIA 2ZVIA 4XX6A 1UCWA 2CCRA 2CLHA 5LA0A 1R2SA 4CCEA 1W31A 4HMCA 1RQHA 4AW7A 3EPOA 3MANA 3B3DA 1QAPA 1RJRA 3AU2A 2XM1A 1PAMA 3UCQA 5CGQA 2NV1A 2PTWA 2PDYA 2E3ZA 2VWTA 4RXFA 3CHDA 4C6IA 2CITA 4M0XA 4HZ7A 4CQCA 2VEPA 1M04A 3I6RA 4NJIA 3OG3A 2ZDRA 3SUSA 4HNOA 2Y1HA 4YVVA 4MY8A 4LAZA 4K1WA 3VD5A 3KE0A 1C7SA 3NQMA 5BMWA 4R7JA 3O6DA 4UR7A 1QASA 1XD0A 1SZEA 1IE7C 4MLRA 3TSDA 4HOXA 1Z8AA 1VBGA 1N8WA 1XRTA 1EWDA 3GX9A 4H04A 2YJQA 3FX4A 5DF0A 4UTWC 1QNSA 5HWMA 4DJED 3IIXA 1NDVA 1JL8A 4PRTA 1JYXA 4QDMA 3V7PA 2GDQA 3ABRA 2JEPA 1V3HA 3CZJA 1X97A 2WMHA 1T5AA 3EPMA 3SY1A 2X0HA 4WR3A 1C82A 2OKTA 3PPHA 2PUZA 3T09A 3U9IA 3P61A 2IMRA 3VGHA 4IIGA 1OJPA 4V2XA 2BRVX 4P8WA 3QGKC 2PTDA 4CNTA 2D2JA 1EEPA 1OGGA 3V5OA 4O15A 1IGWA 1X8FA 1KFWA 5IRPA 3WEMA 2XHYA 4XTDA 2FLIA 3QR8A 4DM2A 5K9CA 1BSIA 1NDZA 3L67A 3Q58A 9CGTA 2E7FA 1UZHA 1EP2A 1FP9A 2DSZA 1YPFA 4ICCX 5LGZA 1DWGM 4I5UA 3MPGA 5D37A 3VOCA 3LNPA 4HU0A 5DX7A 3PF3A 2KXRA 1HKJA 3D46A 3H7RA 4L6OA 5K2ZA 4XK2A 3M43A 1TV7A 3S1VA 3H2EA 1A3WA 3B04A 4PR4A 4JR5A 4ROPA 2OXNA 3HV9A 1JZ5A 3W84A 4UTIA 2SFPA 3EWBX 3S5ZA 5EU9A 3OZPA 1CXHA 1FFQA 3ONBA 3NSNA 1W3IA 1EL3A 2BTMA 4JCLA 4F3HA 4FR1A 4QP0A 4UTWA 1SMAA 2XFWA 3B9EA 3C2EA 1B9ZA 1Q4WA 3G2GA 3NPVA 3T05A 1X6NA 5H2ZA 2CLLA 3H6OA 3A4AA 1A4LA 1VCVA 1YW1A 2ZXBA 5HK4A 2H3DA 4TVUA 4WEVX 3CAQA 1QOPA 3D3AA 2GJNA 3OVQA 5MKGB 4NL1A 3DIPA 3KS6A 1LUCA 1IZKA 4PFMA 1EJRC 3H2OA 3S5OA 4KIEA 3W88A 1TB3A 3EZ4A 3GNRA 4C6NA 4DELA 1CIUA 3SDOA 1BG4A 4IGMA 3TOYA 3CBWA 1L2UA 3DFHA 2YGYA 4A22A 1LWJA 2I17A 5G4EA 3F2CA 3POCA 1TPEA 1W1B1 1ZB5A 4Q8TA 4Z1BA 1GOIA 2G3NA 3UZYA 4FXRA 3N13A 3H7UA 4MJMA 4U31A 3M0IA 1XIFA 2OGYA 2E6FA 4MAZA 2YR1A 3ABOA 1CWYA 2FTPA 3WY1A 4E2BA 1NJJA 1V6WA 4L65A 4GLEA 1BQCA 1F6KA 3WQFA 1CXKA 5FJRA 1UWUA 2FPTA 3ITGA 1E51A 1NH6A 1E4NA 4FALA 3O63A 3VC6A 5M03A 3LI1A 3GHSA 3N29A 2O55A 5G1MA 1XDLA 3BLLA 4LVBA 4GQRA 3U2OA 1N7OA 2BVTA 1UR9A 3I4KA 4D71A 4GFSA 3DGRA 4WCJA 2QCGA 2QVHA 4QXIA 4S3DA 1W8GA 4B9ZA 2I5IA 1KR0A 2PI6A 1QBBA 3WLRA 3QV8A 4DNMA 3P67A 2I16A 3WBAA 4C5YA 4GUIA 4JFUA 4L7ZA 1D8CA 1QO2A 2ZZ2A 1B90A 1Q7MA 1Z44A 4XZHA 1H50A 3W53A 3EA1A 1S46A 4EK7A 2ALRA 2GZXA 3USBA 4WDUA 3TK7A 3ITLA 3MJYA 1O6IA 3PJTA 4KETA 3UESA 1PKLA 1NDYA 2QUTA 4WQ6A 1GVRA 1DJXA 3M5VA 5A6MA 4ZCWA 4ZGYA 5H91A 3GG7A 3LXCA 3CNYA 1XBXA 1MFUA 1S5WA 1LOQA 3CV2A 4S3EA 3TFXA 3MMWA 1UH3A 1DYSA 1J0HA 1M01A 3E1F1 2NLIA 4DUOA 4MYAA 3S4TA 3W1XA 4MKNA 1TTPA 2XVNA 3S8HA 2J27A 2E8ZA 2TSYA 3CUHA 1UKQA 1QJWA 1FWRA 3HO8A 2XIOA 2R1KA 4A3RA 4PODA 3JU2A 4M6UA 3NM3A 3RLHA 3VIFA 1UHVA 3QN3A 3DKJA 3C2VA 1M1BA 1BG9A 4O1EA 4H7ZA 1SYTA 2ASHA 4IOTA 3K4AA 2C19A 2VQTA 3RU6A 2CZDA 2VENA 4OZOA 1RWFA 3E0VA 1JCTA 1LRNA 1VKFA 1JG9A 2OX1A 2NQHA 3E6EA 3LY0A 2RJHA 3MS8A 1JCNA 1O5QA 2R8WA 3DDMA 1P43A 1U30A 1WCGA 1M7JA 5CSRA 3KOWA 4RE0A 4AISA 4FX6M 3BQ5A 2F61A 1ITCA 2Q8LA 4PUWA 1EP1A 5AYXA 3A21A 3UJSA 2J88A 1DP0A 1PBGA 1G4EA 1MI3A 3CV1A 3GXIA 5DFAA 3PUDA 4GJIA 1I0BA 1I0DA 5T9BG 3FVDA 4K7VA 1KLZA 2Q3RA 1A0DA 1CNVA 5DLCA 5GNXA 1WV2A 3SZ8A 4DLMA 3SECA 3UR2A 2YA2A 5AHEA 4UQAA 4NXKA 4LS2A 4NRRA 3V18A 1O1HA 1AW2A 3LMZA 4ERGA 4O17A 3OHMB 1UD8A 3BMVA 4GUJA 1H7OA 1DQUA 1CGUA 3WQCA 3TFCA 2XH2A 3QY8A 1A5MC 1LLOA 2CEQA 3GAYA 1ZS2A 4QEEA 4MWAC 4E3TA 4A05A 1CLXA 1BGGA 4IJRA 3CZ8A 4AHOA 1ODUA 2WMIA 4PMXA 2E5BA 2HVMA 1OX5A 3M0MA 2BXVA 3QKZA 4N6FA 3VDAA 5DCDA 2Y8VA 1JUEA 2OSXA 3TTEA 1XYBA 2GK1B 3BJTA 1FKXA 4XD6A 4KCWA 3LLDA 2O4MA 1T96A 1QWGA 1TPUA 2VC9A 3E12A 2FH6A 4GQ0A 1GJPA 2WMFA 4LRTA 2W62A 2ZTKA 1XH2A 3UA4A 4XZWA 1UQYA 4C6CA 3FHQA 1UKOA 3W6MA 2IQDA 3WLSA 4IP7A 1K6WA 1Z9AA 3ORWA 3K13A 4ALDA 4HNVA 4DJDC 4A29A 4RNIA 3K2GA 4X3ZA 1TPDA 4W85A 2VUYA 4DEFA 2ZKMX 1Q6FA 2IXVA 4O18A 4QE4A 1F6PA 2OT0A 4DWSB 1SZRA 4C1NB 6A3HA 4Z1YA 4JTEA 2HROA 1R47A 3CO4A 1K4HA 5D03A 4XKYB 3RLUA 2OLAA 1KM4A 4KFNA 1J9YA 3DAQA 4ACZB 1F4HA 3NZPA 4Q8OA 1IT8A 3DBPA 3PBUA 5HUOA 1XLGA 2C15A 3ABQA 4F2BA 1W9PA 1KXVA 4I7UA 2F6KA 4C90A 5GPRA 1KXQA 1DJQA 2DQXA 3P7YA 2DUAA 2P53A 3NDZA 4DLFA 3B8DA 4UMAA 5DY2A 5BROA 3ZT5A 3N04A 3CQIA 1T99A 3WLJA 2NT1A 1CW2A 3UWEA 2QCNA 4RDYA 4OBSA 1ME9A 2E9MA 1OJOA 1QOQA 1TMQA 3WD0A 3WJSA 3OJGA 3U7BA 3H55A 3MTWA 4K38A 1JDCA 5JBDA 5ECUA 3G1RA 4E8GA 3ITYA 4W7WA 1OX6A 2AGKA 3DYOA 5RUBA 4REQB 4Y9AA 4TU1A 1R3WA 1OG6A 4UOZA 1QW7A 1F3EA 3AS1A 4IQEA 3OBAA 1OB0A 2NLYA 4WXZA 3VNKA 4NZCA 2W66A 4V1YA 3L5LA 2DZAA 4GIAA 1H49A 4LW7A 3AIQA 4Z2JA 3GH4A 3UEQA 1J2BA 1AD1A 4QLLA 1BVWA 2OMAA 1W9BM 1XF0A 1W56A 1H5VA 4MF4A 5EBAA 3VKAA 2PDKA 2I1OA 3O8AA 2V5KA 2Y8UA 3TIMA 1MWOA 3FGCA 2PRHA 5ABGA 4IQDA 2ACQA 3IJLA 2PRMA 4XAPA 4QISA 3DEQA 3FAWA 4JN7A 3WLOA 2D3NA 2RGLA 3RR4A 3WNNA 4C6EA 2W61A 3WN6A 3VXGA 3PPGA 4PL2A 2BZNA 3HQOA 4C6LA 1JGIA 4FNUA 3T0AA 2EKGA 1I2NA 2FHBA 3KBSA 3SCTA 1SO5A 1LT8A 4ZSTA 3W27A 1A47A 3MO4A 4DBUA 4GISA 1MW3A 2ZICA 3WMCA 4RDVA 3ARRA 1XH0A 4TX8A 2HS6A 2VR5A 2E8YA 3P62A 1QVBA 1JDFA 1E6PA 4IIFA 1UA3A 4LAKA 3R0UA 4B5WA 3W7HA 3OZOA 1W8SA 1E5NA 1VPXA 4H00A 3FA4A 4H8NA 3QLLA 4AWEA 4GQBA 5TNVA 4H83A 1EQCA 3W2JA 3CLWA 1TV3A 3T08A 1PZ0A 2P0OA 3LHUA 3PJUA 3BG9A 1Q6LA 5E6YA 2ABBA 1ZBKA 4TV5A 2PP0A 2QQ6A 3MBFA 4DF0A 5MF5A 4EVZA 3WBYA 5ECVA 1V6UA 1C9DA 3UG4A 1PYMA 5HNUA 5EMYA 3TMQA 3IGXA 1ZLPA 4AD3A 4GYKA 1NTHA 1REQA 1VFFA 2ZUSA 2G37A 4X0NA 3NSXA 4HMNA 4JIQA 1I4NA 4GBDA 4LWWA 3AXKA 4MZYA 1ISWA 2A6LA 2XVPA 4TMCA 3B8IA 4PUEA 4IPJA 1QO5A 4B16A 1KM3A 3PBGA 1N7RA 5M3WA 3LGDA 3IAPA 2G4JA 5BZAA 4IIEA 4LC6A 1GQJA 5CPLA 1NIUA 4YU1A 2DZPA 3BAKA 1K77A 1SU5A 4FB7A 1ZJAA 3RMJA 1W6TA 2C1GA 3M9YA 1AQHA 3GLCA 2JKEA 4IFKA 1ONEA 1VB9A 4Y8EA 5C0QA 4CVUA 3DI1A 2HK0A 3UF9A 4L9YA 1J12A 2PWDA 1A5LC 1IV8A 3ZLFA 4NP7A 1EGUA 2BY2A 3UQNA 4B2DA 2J9YA 2VHLA 5H1WA 1H0GA 3GNOA 2IKIA 3AICA 3LHZA 1QBAA 3ITCA 4Q32A 3TEVA 2DDXA 1K3UA 3FIGA 7REQB 4FIQA 1XIIA 1WA3A 2GUBA 4ERIA 1P7TB 3LCHA 3DN5A 2Y70A 1Y5VA 3R58A 3R8HA 1TRIA 4EPBC 3G1FA 4PUNA 2Y0FA 2HISA 4WSKA 3W1MA 3N3TA 5KEZA 2DPEA 5CPNA 1XLDA 1H41A 4LFYA 4RJEA 5CC3A 3ZR4A 4DX3A 3ZJ7A 1SFJA 4O4WA 1WDPA 3DG3A 2WSKA 4JHOA 2Q8XA 2TYSA 4QITA 4H2CA 3KHJA 3W26A 1J0IA 1BXNA 1G67A 1GVQA 3RM4A 1O60A 2BVWA 1K7FA 3T4WA 1XX1A 3KWSA 2QCEA 1ZCCA 3VIIA 3MP3A 3SUVA 2CLOA 1Q6EA 4ZO9A 1J4EA 2FH8A 1UOKA 1E9YB 4C6OA 4HTYA 2ZFAA 1OM0A 5A94A 4HA1A 3NFUA 1Q5MA 3N19B 3ABSA 1KKRA 4Y8FA 4AH7A 3TKFA 1W3NA 2ZZ1A 3NZQA 4M6VA 1QTWA 3NL6A 3SRDA 4XO6A 3R43A 1ODZA 1GT8A 3AXXA 5G2IA 4L80A 1XSKA 1B5TA 3EX3A 1QHPA 1WBJA 1DJGA 3MW7A 3MKKA 5D8WA 3KHDA 1HJXA 1JULA 5T91A 3RX2A 1I2OA 3H24A 1OYBA 1V08A 2UY4A 4FZIA 4PSPA 4XG1A 4MB1A 1CEOA 3I4EA 1EHAA 3STEA 3ZXWA 2XPKA 3MQTA 3EGJA 1KCLA 1SQ7A 4YTTA 4O11A 1QMLA 1CB8A 4LUJA 1F74A 3NVTA 3IRDA 1CGVA 1TV2A 4NZJA 1TMHA 4E2VA 4URIA 1V7AA 2D69A 2QDEA 5LGXA 4LUYA 3LDVA 2V5DA 2Q6ZA 3GVGA 3CMGA 4JL2A 3HGOA 3VX0A 2ZUVA 4YWIA 1LWIA 1B4EA 2PURA 4DF1A 3VIKA 4R85A 4A8RA 4NRSA 1EDQA 2YW4A 9XIMA 3CUXA 3IJIA 1OFQA 3GXNA 3KOXA 3DFOA 2D0FA 3W22A 3L23A 1SR0A 4F2UA 2E1DA 3GR8A 1HG3A 2INZA 4NAEA 2RDWA 4P7QA 3W72A 3EMZA 2OR2A 3N4FA 1VD6A 3TOPA 1TJ2A 1R3SA 1GOOA 4GACA 5K7JA 2Z1SA 2XGZA 4LYRA 4QNEA 2XYLA 1KWKA 1F76A 4CD6A 3G8RA 3TX9A 1H1NA 3MO7A 3OZMA 2YCJA 4G7EB 1AG1O 2O9PA 3ANUA 2J7BA 2OOFA 4TQTA 3NQ6A 1VFSA 4AYGA 1QCWA 3ARYA 4H9UA 1R38A 2ZC8A 3UYIA 3TR9A 3VKJA 4GPNA 3P8JA 5BU6A 4PMUA 4ROQA 5TD4A 2GQ3A 5CBBA 3HPZA 4GZEA 2PWHA 1RD6A 2WQPA 4AY1A 3R6IA 3WDHA 3BTNA 3JZUA 3SEPA 3GDLA 4MJ4A 4JX6A 4PUKA 2BY1A 3ME3A 4F48A 1R30A 6XIMA 4GO8A 1W5NA 4L9XA 2BRPA 4E2OA 1E4MM 3U4FA 4KF1A 4ML9A 4R9XA 2VZKB 3E2RA 3PWGA 1DXFA 1FDZA 3L2IA 1UWQA 3UY8A 4NYUA 4AMCA 4I7WA 4J7RA 1B4KA 2G3JA 4ZB5A 3GH5A 1LLWA 4O54A 4AZCA 2ZX8A 5D9PA 3QH2A 2X1TA 3IANA 4D9PA 4DUXA 3KL3A 3GB6A 3NO3A 1G4PA 4UFLA 4OJYA 1UIOA 7A3HA 4LTSA 2QAFA 2OJPA 4S3AA 1FCQA 2Z24A 3W07A 3TLQA 3KTXA 5LA1A 3U3HA 3SY8A 1U5VA 3WLQA 5IBXC 4IXXA 4CQ9A 3W2KA 4BZYA 3KL0A 5AOUA 3EXRA 1Q6OA 4QQ3A 2Z2AA 3WJYA 3URBA 4PEEA 1J0JA 4NZ5A 1KBLA 4QDPA 1QDSA 1MEIA 1RQBA 3NQEA 1W37A