2WMIB

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 in complex with the a-trisaccharide blood group antigen.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
582
structure length
571
Chain Sequence
VDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTENYWIWANDIENKAADYLKVSAKNGGYFIWAEQNNGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKSKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 212
structure length 571
sequence length 582
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmiB03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmiB01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmiB02
5AC4A 5BXTA 5CPQA 1UD8A 2BV9A 2O9OA 3MV01 4AZIA 2C7FA 4M1RA 1LXMA 2IXUA 1MW1A 4PEEA 5GPRA 2XVLA 5I0DA 2Q1FA 1AVAA 4CD4A 3AS2A 2X8RA 3UETA 5A3HA 3RIKA 1W9BM 1MQQA 2WWCA 1E9LA 1OGBA 3EDEA 5E09A 1KBBA 2WVVA 1GOWA 4HU0A 1C92A 2DIJA 2WHLA 3VGBA 4TX6A 1J0ZA 4UZUA 4M29A 1EHAA 1EOKA 3MSGA 2D0GA 1MYRA 5DO8A 1PJ9A 3SUUA 1HIZA 1KXTA 1V3KA 2CERA 2YJQA 5CLTA 5I5RA 5E6ZA 1E6XM 2J8GA 3THCA 1UR4A 2GK1B 1UWQA 4H8HA 1TVNA 2EXOA 2G3NA 1X1HA 5DFAA 1RWFA 4XV0A 1C93A 1HX0A 5DMYA 1X6NA 4ZENA 1SR0A 4W8BA 1WZMA 4YHGA 4IPLA 4GQQA 4J27A 1UD2A 1E6SM 4HTYA 1WP6A 2Y5EA 3MO4A 4IUGA 1QW9A 4HP5A 4CCEA 3N12A 2D0HA 2Y2WA 5FOOA 1AQHA 1NQ6A 3VGHA 3MMWA 3WDPP 3WD1A 1CTNA 5F7UA 1UQYA 1UWUA 3W24A 4AD1A 4CCDA 1IZJA 5FD0A 2ZWZA 3WNLA 3GH4A 1E71M 1KGUA 4QCFA 2A3AA 4D6DA 3T08A 3VGEA 1XYZA 2BRPA 3LPPA 4JHOA 4R5EA 1UD4A 4AEFA 4LYPA 5KZ6A 3ALGA 1QI2A 2ZX6A 4HA3A 2BRVX 2PWFA 4PMQA 2GSJA 2VRKA 2WVTA 3AIBA 2ZUVA 1PIFA 1E6ZA 2Z1SA 1HJVA 3ARTA 2CETA 5A6LA 2RGLA 2XHYA 2D20A 3EDFA 1W91A 3VIIA 3RM9A 2D1ZA 1ISVA 3QHOA 4U5IA 1I75A 4X0NA 4D1JA 4BS0A 4DUWA 1ZL1A 3RO8A 1C7TA 1EDGA 2PBGA 3VX1A 3ZMRA 3N9KA 1KQZA 3T0BA 4B16A 1UH3A 3CGTA 1FH8A 2ZICA 1I1XA 3PN8A 4PMZA 4RE2A 1EQPA 1QI4A 4HA4A 1XSKA 2HVMA 2YDSA 4PTVA 3WUEA 4JL2A 3DHUA 2D3NA 4LGXA 1UD5A 2VMFA 1HKMA 1J0MA 1Q6CA 3WDRA 1E55A 1XC6A 3CHCA 4QLLA 2PBOA 1BYCA 1UR2A 1FH9A 3L2MA 4HMDA 2XGIA 1WDSA 5GNYA 3AOFA 1J11A 5M3WA 2WCGA 4QFUA 3CHDA 3CUFA 3A4AA 3WUFA 1JYXA 4AZCB 1OM0A 2BY0A 2DSZA 1FA2A 2EO7A 5A8MA 4LPCA 3M46A 2VO5A 4UOQA 3L4UA 1UR9A 1X6LA 1XD0A 1B90A 4TTUA 5CGMA 1B3VA 2BFGA 2VR4A 1G5AA 1RW9A 2WB5A 4JCLA 1K9TA 2BHUA 3T0AA 3EYPA 1FFRA 4D72A 4JZ5A 1N7NA 4EKJA 4OKDA 3SUSA 3AYRA 4PSRA 3WQ5A 1UYQA 3AHYA 4LQ1A 4PUEA 2WLZA 4AMCA 4U2YA 2O92A 5HDRA 1OGGA 5CG0A 1GOQA 3CO4A 1C7SA 2X1IA 3VU2A 1I1WA 1JAKA 2VRQA 2J8FA 4Z2JA 4JIEA 4MAZA 1G01A 1E4LA 4PRWA 1UR0A 2Y8VA 3AS3A 3PZNA 1JNEA 3T2QA 1JIBA 1W2VA 2BVDA 4E4PA 2WCSA 4MJ2A 4ATDA 6A3HA 8CGTA 5DT7A 1OSEA 1VFFA 3PZ9A 2X03A 3BXWA 1NH6A 2OYLA 3WF4A 1LQ0A 2OWWA 4QLJA 1ZJAA 2WVSA 3GNRA 3SCNA 2WM0A 3L4TA 1PBGA 3VM7A 4P7LA 4UFLA 4EK7A 1QNQA 1QHZA 1BHGA 2Q8XA 3VIHA 5I2UA 4PMXA 4HMCA 4UFKA 5IFPA 1CXLA 1E15A 1E40A 3QR3A 1KWKA 2WYSA 4PMNA 4W8LA 2VZOA 1V6XA 2VZUA 4F9JA 1XHGA 2V5CA 1M53A 1RWHA 3SCPA 2ZUSA 2VOTA 4CUCA 1UUQA 4H41A 3CZGA 1JZ6A 1JGIA 4MB4A 4X9YA 5DEZA 4BQ3A 1WB0A 3WF1A 4UNIA 1JYNA 2UWFA 2XFRA 4R27A 1EOMA 2CBVA 4U2ZA 5EFFA 3PZVA 4HU8A 1SYTA 1G0CA 3RILA 1H1NA 1W9VA 3PBGA 3NIYA 4K68A 2BS9A 4J7RA 4RE3A 2PWEA 2BY1A 3WN6A 5CLWA 4UQ9A 2DT2A 1KR1A 3AHVA 1CDGA 4AEEA 1R7OA 2YA2A 1DWIM 4WIWA 2HISA 2JF6A 4CD5A 1HN0A 1GOOA 2D22A 3DC0A 4W89A 3KEHA 1PZ2A 1QI3A 3ZT5A 4UOZA 1LLOA 1WKYA 1C90A 2W91A 3MUY1 1OJNA 5A6AA 1TA3A 3A4WA 1OIFA 3POHA 3ALFA 3IJ8A 4QP0A 3ZR5A 3QHMA 1VEMA 3M6DA 3N1AA 4D1IA 3BGAA 3BSHA 3IJ7A 1RWCA 5JBDA 2NT1A 4PMYA 2C0HA 1W9PA 1ODZA 1HM3A 2OSYA 3M7SA 2E3ZA 1JNDA 3N04A 3O2LA 3ARUA 4GI9A 5CXPA 2WK2A 2X09A 2OSWA 1NOUA 1OINA 5FCZA 2VQTA 2CYGA 2FGZA 2X05A 1U33A 4MADA 3ARRA 1VBUA 4CVWA 3I3BA 3PZTA 1BPLB 1J0YA 2XSAA 4U3AA 3SEPA 5A6SA 5A8PA 4B9YA 3PZUA 5I24A 4WSKA 3KL0A 2AOSA 4W85A 5EMYA 3A47A 4JFUA 1JZ5A 3IAPA 3N18A 1C8QA 1EXPA 2VX6A 1LOHA 5M17A 3BAYA 3GXFA 2DH2A 1MW2A 1US3A 2VX4A 1QBAA 4WKHA 5CSUA 5ABEA 1Q6GA 2DDXA 3GTNA 1ODUA 1H0GA 3CBWA 1P6WA 3WD2A 1UHVA 5IHRA 3WH8A 5CPSA 2VZSA 2YKKA 1W1YA 1G94A 1WDQA 4OOZA 2BVYA 1E4NA 3OGSA 3TA9A 2WAGA 2YLLA 4LX4A 5C71A 1V6WA 4AIOA 5M5DA 2W4XA 4B9ZA 1TUXA 1QNOA 4MPKA 2W92A 4FLOA 3WEOA 4CD6A 3EBVA 3L4WA 5C8BB 3WDJA 2G3JA 4YPJA 2YLAA 1QNPA 2E8ZA 1GHRA 2WWDA 2D2OA 3AMDA 3MKKA 5CPTA 5JIWA 5I23A 4BQ4A 3PHAA 2E40A 1QI0A 4GI8A 1VJSA 1R86A 3ZJ6A 1KGXA 1HKJA 5EB8A 3RM4A 5AYIA 2BHZA 1Z32X 3WSUA 1J18A 2CBUA 3ZJ8A 4E8CA 3WUBA 1F4HA 1VAHA 3CMJA 1GUVA 5AC5A 5JIPA 4W7UA 3S6TA 1QHPA 3GNOA 3CUHA 4CCCA 4V28A 4D6EA 1EIBA 4MNJA 1DEDA 1TFVA 4EE9A 3WF3A 4AZ7A 2XFYA 1J0JA 2WMFA 2ZUUA 1JG9A 2XPKA 4HZ6A 1GOKA 4LXFA 2GUYA 4HOWA 2WZHA 4DWSD 3NDYA 3AMKA 2DEPA 2J62A 2DT3A 2DT1A 1V02E 5A2AA 1E5NA 4S3KA 4M81A 3KL3A 1FH7A 2ZUWA 1CWYA 3FAXA 1CGXA 2ZIDA 3W6LA 1NWSA 3T2OA 4ACZB 3AJ7A 2JF7A 3SUTA 3VX0A 3VIFA 4WF7A 1NM9A 1DWJM 4NF7A 3VIMA 4AISA 4W7WA 2G4FA 2QPUA 1XH1A 5LYRA 3L4XA 4URIA 3WDHA 5KEZA 2VJXA 1KCLA 3GBDA 1H3GA 1LXKA 4XZWA 4FF5A 2ZXAA 1V0NA 3BLPX 3ARPA 5E70A 4D6IA 3WQ6A 5A6MA 4W93A 3AS0A 3VD3A 4P8VA 2DSWA 2F8QA 1E70M 3OLEA 4J3UA 4J3VA 1J9YA 2QF8A 4TVCA 1QOXA 5HPCA 3BMVA 1UKTA 2X2YA 1OJMA 3RDKA 2DGAA 3L4YA 1CBGA 3GH5A 5CZKA 2G41A 1H5VA 1XV8A 2GJPA 4WJXA 4UFMA 5HBFA 3VUPA 4V27A 4U33A 3MMDA 4GZJA 2D3LA 4PSPA 1CNVA 1HL9A 2D0FA 3GBEA 3UR7A 1XSIA 2FH6A 4P8XA 4J28A 2VTFA 1I8QA 3GZAA 4PN2A 1GOIA 1OB0A 3RJXA 3WUGA 3QGVA 2J77A 1RPKA 4F8XA 2PB1A 5C70A 5CJ5A 3A3HA 1VF8A 3L4ZA 1QVBA 4AZBA 1R87A 1BG9A 3ARZA 5FIPA 2CKSA 1V6UA 2XM1A 1BTCA 1JXKA 3A4XA 4CU8A 1D3CA 3HN3A 2WKGA 4MB5A 1QW8A 2VI0A 1M04A 2VZTA 1HM2A 1PPIA 4Z2HA 1UKSA 1ZU8A 5I77A 4UZSA 1Q6DA 4ZXLA 3O6AA 1MW0A 1NWUA 4U5KA 4Z2IA 4M8UA 4KRTA 3NDZA 2ZE0A 4AZCA 2BRWA 2YDRA 5IDIA 2E4TA 1AQMA 2VX5A 1GQLA 1ZBWA 3MUZ1 2YA0A 2ZX9A 4DUXA 4W7VA 2VR5A 4NRRA 3ARSA 3AXXA 3BAJA 4D6JA 4PCSA 1RP9A 2JALA 3WQWA 4F79A 2VVNA 2O9RA 1JYWA 1N7QA 3AQUA 4Q22A 3LPGA 1WZLA 3AZSA 4MTVA 1Q6FA 1B31A 1B3XA 2ZWYA 4L4PA 5A1AA 2XUCA 2VVSA 1F1SA 4CN4A 1X1JA 5A95A 1V03A 3APGA 5E6YA 4JKLA 3WBEA 3BSGA 6CGTA 1CECA 3TTQA 4NSBA 1C3FA 2E9LA 3VINA 3ZIZA 1CGTA 1E3ZA 3G6MA 2YL8A 3B8SA 2VL4A 2A3BA 5BRPA 3VDHA 3WFZA 3K46A 2UY2A 1BGGA 2G3MA 5I78A 1EGZA 2XSBA 2GDUA 3SCRA 4DUVA 4UQCA 1JI2A 7CGTA 3FNDA 1GQIA 3VMOA 2UY4A 4AZ5A 4CN1A 3AIWA 3F5LA 4KH2A 1HVXA 1W32A 2XG9A 3EMQA 3AHZA 1CB8A 4PMDA 5TD4A 1OCQA 1OT1A 4BF7A 3PZGA 2V3DA 3RCNA 3ZOAA 1E6PA 1WDRA 3W82A 2NT0A 3WQ8A 2GJRA 2XWEA 1HKIA 4J3SA 3PTMA 1TE1A 1U30A 4JFSA 1M7XA 2NSXA 1MFVA 2VQUA 5A8OA 3E1F1 3AZRA 2UY3A 3VD9A 4P7NA 3VM5A 1C8YA 3WH6A 1L0PA 3G6LA 1K6AA 3MS8A 1KB3A 4FLSA 4JKMA 4WKAA 1J0KA 1VENA 1UWTA 4WKFA 4RE4A 3WIJA 4C7DA 4M82A 2WMJA 4A3YA 1VFMA 5ABHA 3VDBA 3WH7A 1EDTA 1W3HA 1R7AA 2IUZA 4N42A 2ZUTA 1FHDA 3ZSSA 2DH3A 2WPGA 3VNZA 4XZBA 4AD4A 2WHMA 3TTOA 4KGLA 2WC4A 1BG4A 1UQZA 3TTSA 4D6FA 5ABFB 4W86A 5CSYA 5HXMA 3PZMA 4LYRA 4KGJA 1HKKA 7A3HA 1E0XA 3D3AA 1KWGA 1IZKA 1SMDA 2XYLA 4ATWA 1L8NA 5A2BA 3ZSTA 4NI3A 4MNLA 3MSDA 3WNOA 4Z2LA 3AHTA 1MQPA 1LWJA 1KXQA 4YHEA 1DP0A 3FN9A 5D9MA 1V3LA 4P7RA 3WELA 1E1EA 3ECQA 5AY7A 2DPEA 2W66A 4B3LA 3AIEA 3LPOA 1PZ3A 2WC3A 1W1TA 1B0IA 3VGFA 5BYWA 1JYVA 5ABGA 4CVUA 1JD7A 2GVYA 4P8WA 1QI5A 1UKPA 1XYFA 3VD7A 3K4AA 1TMQA 4JAWA 4MDPA 3RJYA 1XGZA 1US2A 2OSXA 1UOKA 1EO5A 3CPUA 3QOKA 2XIIA 1ITXA 4OOUA 3OB8A 1GVYA 3BAWA 5A6BA 2ZXBA 1CXIA 4HMEA 2CIPA 2CNCA 2PWGA 2PWHA 1DWGM 2J75A 2EPKX 1Q4NX 1B3ZA 2GDVA 1NOWA 4AC1X 1C82A 3CZJA 3WKZA 1MFUA 1NOFA 3SCSA 4GQRA 1V3JA 3AROA 4JCMA 1CXEA 2WBGA 4GPNA 1JF5A 1NWRA 4E8DA 3WFLA 2EPNA 3FW6A 1V0LA 1WZAA 1GORA 2CESA 3DECA 1JXJA 5GQBA 4GKLA 1HJXA 1BYDA 1R8LA 1UKOA 4AXNA 6TAAA 3UG4A 4D6HA 1JAEA 3SURA 1GNXA 2C8NA 2XM2A 3W38A 1K9EA 1CPUA 1EHNA 2CBIA 3J7HA 1QNSA 2WW5A 5AYBA 3HJEA 1E73M 5CGTA 1WAWA 1PX3A 4JFVA 5A2CA 2YBTA 1ITCA 4UR9A 3VGGA 1ECEA 1GQJA 3A6OA 4QCEA 5A6JA 1BVNP 1TG7A 2EEXA 4QAWA 4GINA 1LG2A 1TR1A 2FGLA 2XJ7A 3GYCA 4UFJA 3ARQA 4JFTA 5BXRA 1RP8A 5BROA 5GNXA 4F9DA 5A6BD 1ZB5A 2WKLA 1KQYA 4DWSA 3AHXA 3O9NA 2Y24A 2J7DA 2ZUMA 3AIQA 1GHSA 3UCQA 1DHKA 4TX8A 4ACZA 3VNYA 3EDDA 4CU7A 2WANA 4HA1A 2E9BA 4TVUA 1VEOA 2YDQA 2CHOA 2YA1A 2PI6A 2QHAA 1M01A 1ZBKA 1LL4A 2YL5A 3WMCA 4BQ2A 1CGYA 3WQ4A 1W9XA 2OWXA 2A3HA 1D2KA 1H2JA 3ARWA 1CXKA 3SIMA 3WDQA 3WMBA 1UH2A 1CXFA 1B1YA 2AMGA 5ECUA 4AZ6A 2DT0A 2DIEA 3U7VA 2FHFA 1LWHA 3ZJKA 1QPKA 5A69A 1CGVA 3ZR6A 3CTTA 2WC7A 2WNWA 3VIKA 5EBAA 5DT5A 1NWTA 2W63A 5EFDA 3WD0A 3CLWA 1WO2A 3AICA 4AD2A 2XGBA 4MB3A 1JZ2A 1V0MA 4H8VA 1BGAA 1JD9A 3N17A 1HP5A 1OJPA 3BAXA 2V3GA 1D7FA 1CZ1A 4GXPA 3VOCA 1NARA 1E0WA 2E0PA 3GXIA 1E3XA 5D8WA 3OLIA 3UR8A 4JHZA 1X1IA 3WF0A 3W4RA 2W61A 2ZUNA 2VRJA 1HN1A 1FFQA 1ZBVA 3GXDA 2EBNA 4J3XA 3N13A 1GW1A 2BY3A 2J79A 4N0RA 1E4MM 3CHFA 1BLIA 3CUGA 2XVNA 4WLCA 2J25A 4GZIA 1C8XA 1OGSA 1MWOA 2GK1A 2BVTA 2CXGA 4J3TA 1H11A 3VKKA 1IT0A 4HPHA 4F66A 1VEPA 4NZCA 5FL1A 4PTWA 4W5UA 1E56A 2EPOA 5E0CA 3IK2A 1NP0A 2ZXQA 4WSJA 1WZKA 2F2HA 4MAVA 2QPSA 3VPLA 3FAWA 1V3MA 1GCYA 3CZLA 3NJ3A 2OYKA 4W84A 1CLXA 3FHAA 2VT0A 3SCWA 1HJSA 1XD1A 1GPFA 2WMIB 4UQBA 3KL5A 3WD4A 1OJOA 3VILA 3GNPA 1JZ4A 4AZGA 2VNCA 2WZIA 4P8UA 1DTUA 3ZJ7A 1J01A 1JZ8A 2BXYA 2JEQA 3NCOA 2CBJA 1DWHM 1ZS2A 3WH5A 3VD5A 1B3YA 2W5FA 2NW0A 1RH9A 3WMSA 2VUYA 3OGVA 2YOCA 1HL8A 3U5UA 3SUVA 2CKRA 3ARXA 1V08A 3BC9A 2GJXB 3WNMA 3VTRA 3IJ9A 2XFFA 1VFOA 1HNYA 3UG5A 1GJUA 1N7OA 3ARVA 3F5JA 3NSXA 3CIVA 2J47A 1BF2A 4Q7NA 4CD7A 1ZJBA 5BWFA 5I6SA 1M03A 1S46A 4OZOA 3GDBA 1GVIA 2QMJA 2CITA 3AMCA 3K4DA 1UZ1A 5A94A 3GXMA 1PAMA 2JE8A 1JZ7A 2WMHA 5BXPA 4A3HA 1KFWA 3SCTA 1B9ZA 3W28A 3TTYA 3K1DA 4YN5A 1XCXA 4MDOA 3CZ8A 3OZPA 4H2CA 5CQ1A 2XVPA 3AIUA 1EGUA 1BAGA 1J12A 3WBAA 3AYSA 5DF0A 4BZYA 1JFXA 4LYQA 3SCVA 3BAIA 3II1A 1JDDA 1H41A 3TP4A 2Y8KA 4M24A 1ISZA 4Z2KA 5IHSA 4HPGA 1QNRA 2DQXA 3EDKA 2CPUA 2AAAA 1FHLA 1MXGA 1J0IA 1UWIA 2J7CA 4QDMA 2XWDA 4A4AA 4IISA 1J10A 3UESA 2FHBA 1UR8A 2EJ1A 3HU7A 2Y4SA 3GM8A 4Z2GA 1CGWA 1JDAA 1QBBA 2BY2A 3CMGA 4CU6A 1PX4A 3VGDA 1UA7A 5HOSA 7TAAA 2RGMA 3N15A 3K8LA 1OD0A 4AWEA 1SFSA 4U31A 4MNMA 3U5YA 3AI0A 2V3FA 4GIAA 1NP2A 1CEOA 5IXEA 1J0NA 3CHEA 3ZT6A 1GQKA 3U7BA 1G9HA 2WVVB 3W81A 1TZ7A 2CHNA 3BLKA 3F5KA 1E6NA 3T2PA 3U57A 1WNOA 5LA1A 3WNKA 3LMYA 3L4VA 4PCTA 4DM2A 4HZ7A 4U3CA 5D9PA 3BMWA 8A3HA 4GO8A 2ZX5A 4GI6A 2W67A 4XX6A 1E4IA 1UKQA 5E0FA 1Q6EA 2OYMA 1XRVA 3MUAA 3OBAA 1N82A 1W3JA 1TCMA 2WBKA 3MANA 4KMQA 3OZOA 5ABFA 1JDCA 2X0YA 4AW7A 1VBRA 1GONA 4XUYA 1LG1A 2VURA 3W25A 4L4OA 1VRXA 1CENA 2EPLX 1HP4A 3EMZA 5I79A 1E6RA 3NSNA 1HJQA 4S3JA 2CCRA 3AMGA 3I3EA 1W1VA 3SCOA 1WCGA 2WXDM 2XTKA 3BCDA 4EAMA 3FXYA 2EQDA 3CZEA 4J3WA 3ZT7A 1HT6A 1FP9A 2E9MA 1CYGA 1W9UA 3OLDA 1OBAA 5A8QA 1C91A 1W3KA 2ZX8A 3AIRA 1WDPA 1OWQA 3WEZA 2V5DA 1VB9A 5BCAA 1JI1A 4P7QA 1Y7VA 4OUEA 3W53A 2O9TA 4TOQA 2VC9A 4GZEA 2PWDA 3OLGA 5JUVA 1X1NA 4AD3A 2DSUA 3OA5A 1DWFM 2WMGA 1BSIA 2EPMX 3W0KA 4ZEPA 3WL1A 4TXEA 2E24A 1ZBCA 3MMUA 4PMRA 2E22A 2YIHA 4KWUA 3FY1A 2IXVA 3UERA 1WE5A 1EQCA 4IM4A 3I3DA 4UCFA 2B31A 1CIUA 2WZEA 2MANA 3AXIA 4HOXA 2VCAA 5M03A 2GFTA 4PYSA 4PMOA 2JIWA 4W88A 1LF1A 5LA0A 3CZKA 4MNKA 1V3HA 3L2LA 9CGTA 1V3IA 3PTKA 3VMPA 2FDMA 4CN6A 1V6VA 1AQ0A 5D8ZA 3F4VA 5HPOA 1GZJA 2QLYA 2JIEA 1TVPA 3VVGA 1UA3A 2WDAA 1N7PA 1E43A 3KWXA 3LPFA 2A3CA 3THDA 3ZM8A 4AY1A 2J7EA 1JZ3A 1W2PA 4AZHA 5LA2A 4MJ4A 1KCKA 4Y7EA 3SUWA 3RPMA 3NYDA 3EDJA 4W87A 1UD6A 4W5ZA 1ISXA 1H4PA 2Z1KA 2FHCA 1UZ4A 1K9DA 5D9NA 1IV8A 3CH9A 3OG2A 5A6KA 3KE0A 2WHJA 5GNZA 1KXHA 1CXHA 3DYOA 4AD5A 1KXVA 4RL3A 3KZSA 3SCUA 4AYSA 2G8ZA 2VCBA 3WNNA 1XH2A 2ZX7A 3K8MA 3W37A 3BAKA 1RWGA 2X0HA 3MUIA 4DM1A 3PZOA 4D6CA 1ISYA 5D9OA 2J78A 5FL0A 2D24A 2BNJA 3B9EA 4IPNB 3WL0A 1H0IA 4PMUA 3WENA 2J7GA 1BFNA 1PEZA 1WPCA 1OD8A 3TOPA 2V3EA 3BH4A 1PX8A 4XB3A 3WD3A 4AIUA 2FH8A 3N11A 3DYMA 2QV4A 2UY5A 4QLKA 3DYPA 3W6MA 2D23A 4NRSA 1R85A 3VIJA 1W1PA 2A3EA 4UOJA 5FKYA 1OIMA 4V2XA 1V0KA 2WVUA 2WMKA 3CUJA 1UD3A 4FLQA 1EO7A 4W8AA 4M80A 1A3HA 4B15A 4JL1A 3UEQA 3WF2A 3VO0A 2F61A 1EA9C 1KGWA 3AZTA 1KBKA 4UQAA 4DWSC 5E9AA 4ZE4A 4CD8A 3SCQA 2V38A 3HMCA 4FMVA 4OBRA 3GH7A 1ESWA 4PUDA 3BCFA 3UG3A 1MW3A 3QOMA 4HZ8A 2ESCA 5BRQA 2OWCA 2WCOA 3WNPA 4UFIA 3RMEA 4JKKA 2J7FA 3PZQA 1UR1A 5IFTA 4KRUA 4PBGA 1JL8A 4H8UA 4FK9A 1GOMA 3IAQA 1B2YA 4CKQA 1H49A 2ZXDA 3B9AA 4HOZA 1VFUA 3AS1A 1EH9A 3VDAA 4ZXOA 5A8NA 4BA0A 2OLHA 2JEPA 4ML4A 4UTFA 2YL6A 3CUIA 2VCCA 5BXSA 3OIHA 1F9GA 1VIWA 4H04A 2E8YA 1JFHA 3ZQ9A 2XVGA 3T0DA 1UG6A 1RWAA 4ZE5A 3WQVA 3M07A 2YBUA 1XSJA 4P7OA 4E2OA 1HVQA 2WCAA 1FP8A 3EMCA 4D71A 3MV11 4WK9A 3POCA 3AMLA 3WY1A 1SMAA 1K9FA 1FOBA 1W3LA 3AXHA 1YQ2A 1CGUA 1B3WA 3D5HA 2WMIA 2DSKA 3AFBA 3ARYA 1HMUA 3PZIA 1E6QM 1AMYA 1LL6A 2PF0A 1UWRA 3WEMA 1YHTA 1E72M 3VIGA 3W29A 1BYBA 4UQEA 5I3DA 3PTQA 3VDCA 3IANA 1XCWA 1TA3B 2VX7A 3ZO9A 1B30A 1N7RA 1MVYA 1MQRA 1VJZA 1E5JA 5JBFA 1BQCA 1XH0A 3VIOA 2DSVA 4CGTA 3QHNA 4M56A 3VMNA 1F4AA 2W62A 2WHKA 3DHPA 1LL7A 1UH4A 2GJXA 2BXZA 4TUFA 2JFEX 2O9PA 4AD0A 4MB1A 4TVDA 1A47A 2WSKA 2YL9A 3TONA 4ACYA 4OBSA 4TTGA 1O6IA 4PTXA 2G3IA 3AISA 1OT2A 3RM8A 4BQ5A 3B9DA 2PC8A 1GJWA 3NSMA 2J7HA 2J7BA 4C7GA 3W27A 1J0HA 1EDQA 1PIGA 4D6GA 3K8KA 2WSPA 1HMWA 2XIBA 5JBEA 4C7FA 4EANA 3VIPA 3OGRA 1KR0A 1BVZA 2J74A 1UWSA 2XVKA 1W9DM 1O7AA 3WDIA 1V02A 4UFHA 4AIEA 4PTMA 1HJWA 1E1FA 1LJYA 2J4GA 4DWSB 4JFWA 2BHYA 3NUKA 4B3KA 1HF6A 4OIFA 3MU7A 4BCEA 1HJUA 4GO9A 5HNNA 1V6YA 4H7VA 2QMKA 1DWAM 3VD4A 5D4YA 2WLYA 4OJYA 3W26A 1MXDA 3JUGA 2TAAA 1E0VA 1CLVA 1H09A 4FLRA 1JF6A 1G1YA 4ATLA 1QHOA 4ZFMA 2CEQA 1HXJA 1BYAA 4X0VA 3T09A 1U2YA 3WH9A 4UQDA 2VZVA 3AIVA 4PMVA 2ZOXA 3FHQA 1W3YA 1ISWA 3S2CA 1RD6A
chains in the Genus database with same CATH superfamily
2Y61A 3UYIA 4JIIX 1EJSC 5GPRA 4LNCA 4IP5A 1QDSA 3GVRA 3UZYA 3PJUA 1AVAA 3KHJA 2QCGA 4Q4SA 4C1NA 4CEXC 2X8RA 3UETA 5A3HA 1MQQA 4I8DA 3EDEA 2WNNA 3UJSA 2WVVA 2O7SA 3BG9A 4ALDA 4D2JA 5CZJA 2WQPA 2VWSA 4TX6A 1J0ZA 4Q7BA 1W1B1 2Z6JA 4F0LA 1IYXA 1X1ZA 3PUGA 5LZLA 1XPYA 4C5ZA 1PJ9A 1HIZA 1KXTA 1V3KA 2YJQA 3C8NA 4QQ3A 1UR4A 4JIPA 4EAYA 3GUGA 1L9WA 2C13A 1M1BA 1RWFA 1HX0A 3IGUA 3CJPA 2BOGX 1UD2A 1E6SM 4G7FA 4DY1A 5AC8A 3GFXA 3RG6A 1FWJC 2OOFA 4CCEA 3VFCA 1IIGA 4QSHA 1DQWA 3R11A 2Y62A 5FOOA 1NQ6A 3MMWA 1CTNA 5T8GA 3T8QA 5F7UA 3W24A 3LCLA 4G7EB 1E71M 3QJAA 3VGEA 5CPLA 3SGZA 4JHOA 2OTDA 1DJYA 1J6OA 2PC4A 4C6QA 5LIXX 4AUBA 1EUNA 4LYPA 3ALGA 1KNWA 4M19A 2F6XA 1YPXA 3JS3A 4HA3A 3GDRA 2A1YA 3BLFA 3EOOA 4GKTA 4PMQA 2GUUA 3FIGA 2WVTA 3AIBA 4FOKA 3LHUA 3E0VA 2Z1SA 5A6LA 4L4MA 1I2QA 3RX2A 2RGLA 3N9SA 2Y7EA 3E6EA 4UTLA 3RM9A 2D1ZA 4G1NA 3QHOA 3R10A 4GHRA 3CWOX 3USBA 4DUWA 3RO8A 5DBUA 2PBGA 3MBFA 3ZMRA 1E51A 4B3ZA 3HMJG 3I6EA 3PN8A 3S1UA 5AHFA 1QI4A 4HA4A 1UUOA 3FKKA 1KV8A 4LGXA 2XGZA 4XQ6A 1U1UA 1J0MA 3KDOA 3EWBX 4LANA 3EPMA 3EB4A 1DXEA 1K8ZA 3RR1A 2PD9A 3W2MA 3L2MA 4HMDA 2XGIA 1WDSA 1OF8A 1SR9A 3W7LA 2VFDA 1QO2A 3A4AA 3IIVA 1JYXA 4R34A 4AZCB 3OYXA 1OM0A 2OZ0A 2O4MA 2DSZA 1SO5A 5A8MA 3M46A 4R7JA 2C1HA 3W7DA 1B90A 2Z00A 3ATYA 4GI4A 3FGCA 2WB5A 4JCLA 5G2HA 1K9TA 1FWSA 1DOSA 3HO8A 3DFOA 1N7NA 3DFYA 4H3DA 3EWCA 3YPIA 1S1PA 3AYRA 4PSRA 3WQ5A 3AHYA 4LQ1A 3MSYA 3CAWA 5XIAA 2RJGA 2WLZA 4AMCA 5HDRA 3B0YA 1I1WA 2VRQA 4JX6A 2J8FA 1NFBA 3P81A 1E4LA 3LCFA 1TV7A 3CPGA 2XN0A 4XO6A 1JNEA 1P43A 4A35A 4ATDA 3PZ9A 1NH6A 3NVTA 2OYLA 1KO0A 3W7HA 1JJKA 3WF4A 1NQKA 1LQ0A 2ZRUA 3G1XA 3HGRA 2G5WA 3GG1A 1QU4A 2WM0A 4XSLA 1SU5A 3KDNA 2XDFA 1PZ1A 3T81A 3BSMA 3VM7A 4UFLA 4EK7A 1S3HA 4DLFA 1BHGA 1ZP3A 5I2UA 2TMDA 4CNPA 2QR6A 3Q67A 4JHMA 1E15A 1E40A 2IKGA 4GYPC 4DVOA 3SQSA 3EB2A 1XHGA 2V5CA 1M53A 1RWHA 2QVHA 2GVJA 5G4EA 3KW3A 1A53A 3LQLA 3KVMA 5JU6A 2GQ9A 4P61A 5DEZA 2CZVA 4UNIA 1EOMA 2CBVA 4CLMA 1A4LA 4MVAA 1SYTA 4LVAA 1G0CA 4LUYA 5C5YA 4RPPA 1W9VA 1F05A 3NIYA 4J7RA 4KWSA 5FACA 4LVBA 3RAOA 2BY1A 3WN6A 4UQ9A 3AHVA 4XZLX 2VEIA 4GY0A 4S3CA 2NV9A 4A21A 4CD5A 4TO8A 1HN0A 1NELA 5JQ9A 3AALA 4W89A 3KEHA 4L5ZA 1PZ2A 1XYLA 2PTWA 3ZT5A 4PL1A 4UOZA 1LLOA 1WKYA 4IPJA 5CG7A 1YNYA 3UWUA 3WFAA 4IGHA 3UVAA 4QP0A 3ZR5A 4B92A 4D1IA 6ENLA 4YTTA 1RWCA 1QW7A 1WV2A 3W1XA 4Q8MA 2INZA 3QGKC 1AW5A 3W7JA 1AFSA 1W9PA 2PDNA 4JYEA 2AL1A 1IEWA 2NUXA 1JNDA 1V7AA 1TYGA 3ARUA 5CXPA 2WK2A 3BLEA 1TB3A 1OCJA 2OSWA 1NOUA 2C79A 1QWKA 1OINA 1V4YA 2OGJA 2ISWA 2QULA 4MUZA 2CYGA 2YYUA 3QR8A 4HN4A 4CVWA 3I3BA 3PBMA 1BPLB 5A6SA 1LM1A 4B9YA 1ONRA 3PZUA 1VCFA 4KFPA 5I24A 2W0UA 4W85A 3ITTA 5EMYA 1UC5A 1JZ5A 2W9MA 4ZBCA 4N6EA 5EMJA 2OZ3A 1RR2A 1DTNA 1TZ9A 3QZEA 5M17A 4WKHA 5CSUA 1US3A 2VX4A 3GTNA 3GC5A 3CBWA 3WD2A 4M5PA 3G3DA 2YKKA 1Z69A 2YCLB 4GYFA 1UCWA 5BRBA 4LX4A 4B4HA 1V6WA 4AIOA 2OLSA 5MKGA 2W4XA 4B9ZA 3O0FA 4PUWA 3EBVA 3ISIX 1XC4A 4YPJA 3KVJA 2WWDA 5FA5A 3AMDA 3U6WA 3PP7A 2VWTA 4BQ4A 4C6BA 3H26A 4GI8A 4RDZA 3ZJ6A 1R86A 3RRAA 1KGXA 1HKJA 3SSZA 5EB8A 4JQ4A 2DZBA 5AYIA 1EA0A 1VR6A 4DHGA 4QIUA 1J18A 3KCOA 2REQB 1PTDA 3ZJ8A 1VHNA 3WUBA 3MKVA 3MTWA 5BU9A 4C6CA 2HPMA 3AO0A 3KAOA 1J8VA 1H7WA 4DELA 5EPDA 4F4RA 3VNDA 3B8TA 1QHPA 3ITXA 5HULA 5FF2A 3N3MA 4MNJA 4EE9A 2WMFA 1GZGA 2ZUUA 1JG9A 3LLXA 4HZ6A 1EGMA 2HS6A 5J5RA 3SN0A 2GUYA 3S2JA 1QMLA 3BV4A 4LF1A 2J62A 4DF2A 2DT1A 2BG5A 4QEHA 4FX7A 4M81A 2ZUWA 3P74A 4GJ1A 4LBUA 4G5DA 4RDVA 2ZIDA 2PDQA 3G22A 1VYSX 3R0KA 6TIMA 4LY4A 2QPUA 3LQGA 1XH1A 2DUAA 3B40A 3L4XA 4URIA 4IIDA 3KRUA 1H3GA 1GWJA 2ZXAA 1PYFA 3AUOA 5A6MA 3WQ6A 2F8QA 1E70M 3OLEA 1JR1A 2I17A 5CBIA 4J3VA 2Q8ZA 3C2OA 2VGBA 1QOXA 3ZLFA 2CLIA 1ZAHA 3JU2A 4X63A 1L6WA 3UD1A 1Q85A 1W3TA 1UROA 4GUIA 1QPNA 3IPWA 5FEPA 3GH5A 2ABBA 3P84A 2QJIA 3UWEA 4DPPA 3KBUC 2Z4GA 4IXHA 3VUPA 1KV5A 1EX5A 3MMDA 1GW9A 1SW3A 2D3LA 2ZC8A 4N4PA 1CNVA 4QX4A 1L6SA 2D69A 2D0FA 3GTHA 3BO9A 4HJFA 3LERA 2VTFA 1I8QA 4PN2A 1GOIA 7REQB 1OB0A 4H9UA 4RW3A 3QGVA 1JPMA 2PB1A 5CJ5A 3A3HA 1QVBA 4CNNA 2TPSA 1IWAA 1W5MA 3C6CA 3ARZA 2CKSA 4C6IA 4JEQA 1JXKA 4CU8A 4HPJA 2WKGA 1E9IA 1QW8A 3W2KA 2VI0A 4YYFA 1HM2A 1PPIA 3HFYA 4A8RA 4UZSA 4GNKB 4ZXLA 3UQNA 1RBOB 2I56A 4LY8A 4Z2IA 4M8UA 3JZUA 4N2YA 4K6AA 2C1GA 3NDZA 1U1HA 4C90A 2A2IA 1Q7ZA 2QGYA 2YDRA 2DZXA 2VX5A 4IIEA 1EIXA 3BCJA 3MUZ1 2YA0A 1EP2A 2ZX9A 3LLDA 4DUXA 1VPYA 3E3HA 4Q8UA 4OE7A 3VKJA 2VVNA 1VQTA 4UCGA 2MUCA 1ICSA 2XIJA 1LCOA 2X1SA 5DRCA 1WZLA 1FCBA 4I9TA 1SW0A 3NQVA 1RK5A 4MWAC 4IX0A 2ONEA 2XUCA 3GVQA 3MCNA 1F1SA 2PODA 1P6BA 3EOSA 1U5HA 3NXLA 5CSSA 3S2MA 2V5JA 3LK6A 3PBUA 1DYSA 1KRAC 5D02A 1H51A 2V2DA 2DZWA 2FFCA 4ADUA 4YTRA 2GVEA 2YL8A 3UG8A 3K46A 2UY2A 1EJRC 2ICSA 2GGJA 5I78A 4Q4OA 3WLNA 3UD2A 4HNCA 4MKVA 1JUKA 3GE7A 4IG2A 4Z0JA 3IEBA 3VMOA 2ZE3A 5ECVA 4ECLA 3LBCA 3APYA 5BNKA 4RZ5A 1ZFJA 4L9YA 1CB8A 3KOYA 2FIQA 5TD4A 2UV8G 2HMCA 3A13A 2Y63A 2PGFA 3E0LA 3NFUA 4AIBA 1DJXA 3W82A 3URAA 4YMZA 3WQ8A 2GJRA 1YDYA 1REQB 4D8ZA 5CC6A 1M7OA 1M7XA 5HUOA 4LEFA 4XZNX 1KCZA 3UZJA 3O06A 1HKVA 4ZQMA 3GKAA 1ZALA 4HK5A 3VD9A 4TMBA 1K6AA 5HJLA 1BRLB 1J0KA 1X8FA 1MUCA 3SGGA 3C2YA 4WKFA 4L7ZA 3WIJA 2Q09A 4C7DA 2X41A 1IZCA 5ABHA 3VDBA 3UWZA 4MPQA 5IOBA 4DNHA 1EDTA 2Z0IA 3LUTA 1R7AA 3GU2A 2ZUTA 3ZSSA 1FHDA 2QPXA 2WPGA 3OHIA 5DN1A 1XLLA 1UOZA 3VNZA 2VOMA 2WJDA 4Q4RA 4XZBA 5PTDA 3TTOA 5IBXC 4KGLA 1LT7A 2HJPA 1K7FA 4W86A 1GKRA 4GQGA 2OFJA 3E12A 3MYOA 4UTWA 1FBAA 3LN3A 3C56A 3LCHA 4O18A 3WLLA 4UTIA 4LYRA 3UGRA 7A3HA 1NF7A 1WKFA 1Z42A 1UP0A 1L8NA 3TWAA 4AEOA 4MNLA 1V7YA 3AHTA 1MQPA 2ASHA 3GDLA 1DP0A 1XDLA 1TTPA 3F59A 4IJCA 1PCKA 2HXTA 5D9MA 1V3LA 4MWAB 4ZQOA 1IR2A 3LPOA 1PZ3A 4F0RA 5I3HA 4PRTA 3B06A 2TYSA 2ZZ5A 3BW3A 3I6TA 4Y2WA 5ABGA 4P8WA 1QI5A 1UKPA 1QCWA 1XYFA 4JAWA 4BY3A 1I60A 4DJDD 2OSXA 1DE5A 1EO5A 3CPUA 1F6PA 4OOUA 1XRSA 1F6KA 1PTAA 2HNHA 1X7IA 4NP7A 2ZXBA 1CXIA 2PDPA 1DWGM 3V0UA 4F2BA 1JPDX 1B3ZA 4ZOBA 2OEJA 3TX9A 1NOWA 3A9BA 4AF0A 4BR1A 2DJXA 1Y0EA 1OJXA 2FJKA 3LGDA 5D04C 4GQRA 2AGTA 4GPNA 1JF5A 1NWRA 1TPUA 2EPNA 1V0LA 3FW6A 1AJ0A 5I3GA 2C18A 1JXJA 5HANA 1BYDA 2PDXA 1H5YA 4CQAA 5BZAA 3GX9A 3R7MA 2E68A 1CPUA 1RY8A 5AYBA 3T7VA 3HJEA 2G0WA 5AHNA 5CGTA 4TX9A 4JFVA 4E2VA 3OYZA 1FCQA 3GTFA 3KCLA 3WLQA 3WJZA 5A6JA 5I02A 3BDKA 4EX4A 3UZZA 3LXBA 1WUEA 2EEXA 3NEHA 4GINA 1YBQA 1LP6A 4UFJA 4JFTA 4DO7A 4YXGA 5BXRA 1SUXA 4F9DA 3NQBA 1ZB5A 3HGOA 2CZFA 3TJ4A 4DWSA 1O66A 4GUHA 4QGCA 3WK2A 2Y24A 2J7DA 1IT7A 4F48A 2R8WA 3E0IA 4EXAA 3UCQA 2NXGA 3FA4A 4Y8EA 3UT0A 1A5CA 2Z1VA 5I3FA 1PHQA 3VNYA 3GXNA 3DAQA 1RUSA 2QF7A 3TN5A 1W1IE 2E9BA 1DPMA 2YDQA 2YA1A 4HPNA 2PI6A 2QHAA 1M01A 4ICCX 2QEZA 1LL4A 2E5CA 2Z2BA 3WK3A 3W7PA 3EX3A 2PUZA 1XJBA 1XR2A 1I0BA 3LM3A 2G50A 2OWXA 2FGBA 4KEMA 1CXFA 4LFYA 1O4UA 2DIEA 3U7VA 2A6LA 2FHFA 4MOZA 1LWHA 1G4TA 3ZJKA 1TPH1 3TFCA 3RUBL 3N6QA 3ZR6A 3ENLA 3O63A 1XLGA 4O52A 1NWTA 5EFDA 3CLWA 1WO2A 2XGBA 4MB3A 1JZ2A 4H8VA 3N17A 3T6CA 1HP5A 1DE6A 1OJPA 4K37A 3BAXA 5CC5A 3STCA 1TJPA 4X22A 4LBSA 1NARA 1LRTA 1I45A 2E0PA 3GXIA 1E3XA 4IWWA 5D8WA 4LB4A 1QWGA 3PWGA 4FSAA 1X1IA 3MBDA 3OVPA 4IMAA 1YRRA 1J2BA 1VBJA 2W61A 5I00A 1FFQA 3GXDA 4K3ZA 1GW1A 2J79A 1LWIA 3B3DA 5EA9A 3CHFA 3N6HA 4C65A 4GZIA 1MWOA 3WZ0E 3QGAC 3NZ1A 3USZA 2OZTA 3KVKA 3IGHX 1VEPA 1OY0A 5FL1A 4PTWA 4KESA 3IGSA 4PUUA 1NP0A 3VNKA 3M0MA 4MG4A 3M7WA 4LC6A 3F4CA 4MAVA 3VPLA 4PFMA 3CZLA 2OYKA 1CLXA 5I7GA 1KBLA 1GG0A 3MP5A 4Q4MA 2IS7A 3HG5A 3C0SA 1GPFA 3GTIA 1TPEA 4E3VA 3N19B 3KL5A 3E5PA 3PF3A 1JZ4A 2PFHA 1GPWA 2H6RA 1JZ8A 5CSRA 2BXYA 3N2TA 2FTWA 1WXJA 3W73A 1ZS2A 3T05A 2EKCA 2VC7A 1B3YA 1LLWA 1KBIA 2NW0A 1RH9A 4IQDA 4WQ6A 3SDOA 2J9XA 1JPKA 3WLHA 2CKRA 3H4GA 3PPGA 5J8LA 3IVUA 3BC9A 4RPQA 5CZTA 3WNMA 2BDQA 3HGJA 1VFOA 2ZRVA 4LJ3A 4WY0A 4E4FA 1GJUA 1MZHA 3LRKA 1Q6QA 3CQJA 1ICQA 5BMXA 1S5VA 4BKNA 3P62A 1TJ2A 1TWWA 4L1GA 1KFCA 1ZJBA 2PWVA 4AY7A 1JDEA 1ZUAX 1XF0A 1GJPA 2YZRA 3K4DA 2V67A 3A22A 1GVEA 2PRLA 3IUHA 4IL0A 4NHVA 2PDMA 3K1DA 3DHDA 4X60A 1XCXA 2DVTA 4E2DA 3CZ8A 3CYVA 2VDGA 1UJPA 2POZA 2XVPA 1PYMA 2NXIA 3TC6A 1DHPA 1EBGA 1BAGA 1J12A 4PB5A 5DF0A 1JFXA 3QKEA 3BAIA 3II1A 3SCVA 1H41A 3EKGA 4O4VA 1ISZA 1TV4A 1X96A 2NWRA 4HPGA 2DQXA 2QYGA 3ITCA 3EDKA 2YXOA 2CPUA 1FHLA 3W1LA 1SFTA 1UWIA 3GHTA 4A4AA 1XUUA 1Q4WA 3GS6A 4UTMA 3NQ6A 5HMEA 2Y4SA 4I6KA 2VZKB 3UGVA 3RR4A 1SJCA 3VGDA 5HOSA 3IJQA 1ZHAA 3GNXA 3GWQA 3SSJA 3ZXWA 3U5YA 1N2VA 3AI0A 1NP2A 4ILSA 3IRDA 5GJNA 4PBEA 1AQFA 4HSOA 3CPRA 3U7BA 4ZQCA 1RXOB 2G4JA 3UZWA 3QH2A 2CHNA 1E6NA 5T9BG 4NX5A 1A0DA 1WNOA 3WNKA 4MMWA 3QFEA 1MSSA 1DXIA 4MZ1A 5HAOA 3BMWA 4XX6A 4WDXA 4XISA 1XRVA 3F1QA 5L9FA 2Y7DA 1TCMA 3MANA 1GG1A 4LSBA 3W25A 2NVDA 4GBDA 1BWKA 4H4IA 2EPLX 4B5WA 4HZMA 1YXYA 3BG5A 4QJ3B 1QT1A 3GG8A 1YIXA 3BCDA 4M6VA 2CLHA 3SGUA 4J3WA 3ZT7A 1OABA 1YPIA 3KBNA 5A8QA 1C91A 3W85A 2ZX8A 1OWQA 3WEZA 3ZS4A 4WOZA 5BCAA 3EXTA 4KEZA 4GXWA 3VKAA 4S3DA 3F2DA 1IF2A 3BQ6A 4UTWC 4I7WA 3DENA 4AD3A 2PU1A 4PUKA 3HA1A 2OJPA 3U2EA 2CLOA 4PC8A 4O54A 3STEA 3LZ5A 3OP2A 4XUGA 1FDYA 2E5DA 4PMRA 3V16A 2VKZG 2FPTA 1F5ZA 3FY1A 1EQCA 4UCFA 3PBYA 3GR7A 1NTHA 1CIUA 3AXIA 4HOXA 5E5CA 5M03A 4HU4A 4PYSA 3LNMA 4IICA 1LF1A 4MNKA 2HVOA 1V3HA 2VHLA 3M6YA 2BGSA 1AJ2A 4DRSA 2J6XA 1IEXA 2FDMA 7ODCA 3E38A 5HPOA 1GZJA 3N2OA 2GQ3A 1Q7MA 1QPRA 1AJZA 1TVPA 3LM7A 1TPDA 1F74A 2WDAA 1N7PA 3HB9A 2A3CA 4AY1A 4AXKA 2J7EA 3S5SA 1YTEA 5LA2A 1YDVA 1KCKA 2ABAA 1M7JA 1O95A 4LRSA 3TKFA 4NKCA 4W87A 3O16A 4W5ZA 3U4AA 1ISXA 3HJZA 3ZVHB 1ICPA 3S2LA 1UZ4A 5T91A 4LVGA 1IV8A 4GQBA 3OG2A 3D46A 3KE0A 2WHJA 1KXHA 2OT0A 3DYOA 4RL3A 3ZFHA 3TJIA 1T5AA 2Q6ZA 3W37A 2AGKA 1RWGA 4DNMA 1ISYA 5D9OA 5FL0A 3UPWA 4GC3A 4A29A 3WL0A 2QT3A 2H8XA 2ATMA 3NO1A 1WPCA 2OB3A 2A85A 2V3EA 4MLRA 4XB3A 3FLUA 2FH8A 3N11A 2QV4A 1NIUA 4QLKA 3DYPA 1R85A 3VIJA 1OIMA 1KRCC 2DU2A 3CUJA 1EO7A 5J5DA 4J1OA 2AQOA 1TV5A 3G2GA 3UEQA 3WF2A 1LDCA 3PULA 3QSTA 1EA9C 4E8GA 4UQAA 4DWSC 3EGJA 3CQHA 4MJZA 3UD6A 2FJUB 4L65A 5E9AA 4ZE4A 1J2WA 3SM0A 1UUMA 2W27A 4IMDA 4KT2A 1ML1A 2G95A 1ESWA 4PUDA 3BCFA 4R9OA 1W3NA 1MW3A 3QOMA 2RH9A 3BWWA 2WV8A 1S2AA 2OWCA 4UFIA 2QJMA 4LH8A 4L61A 1R2RA 5K9XA 3PZQA 3PANA 4IH3A 4KRUA 3QEZA 1Q8JA 1B2YA 2PTXA 3CV1A 4C6EA 4HOZA 3MWCA 1VFUA 1XLEA 4EPDC 2V69A 1EH9A 5CBBA 3TJLA 1F9GA 4LS1A 2E8YA 3ZQ9A 6ALDA 2QCFA 3GD6A 4NJIA 2X0SA 1CB7B 2OZ8A 1DORA 3QV6A 1RWAA 2OQYA 3LV6A 4ZE5A 3WQVA 1O5XA 2FFIA 3N9RA 4P7OA 4E2OA 2Z27A 4C6KA 4D71A 1OZMA 4WK9A 3WQEA 4JPGA 4RLIA 4WHBA 3WY1A 4R7OA 3BQ5A 4QQUA 1K1DA 3QF0A 1W3LA 3AXHA 4Q4PA 3MA8A 1BWVA 2VENA 3PJWA 3LYEA 3WBYA 1XLCA 3W29A 4Z17A 2BOFX 3CU2A 3IANA 1TA3B 2X42A 5LIYX 8XIMA 1MVYA 1MQRA 1VJZA 3LY0A 5JBFA 1BQCA 3GZ3A 3TROA 4M6UA 3VMNA 2WZMA 1LL7A 3LXAA 2GJXA 2BXZA 2JFEX 2O9PA 3I68A 1X39A 3P6LA 1A80A 3P3BA 4TTGA 4RE0A 1H7NA 1JVNA 2ZQ0A 3NL6A 2PC8A 5AYZA 3W27A 7PTDA 4HSNA 1HMWA 1YNPA 4CQBA 1W6TA 4JX4A 2YBVA 4C7FA 4EANA 3VIPA 2KAUC 1UWSA 2E77A 4DXVA 5AHEA 1O5RA 1VD6A 1HJWA 4UTKA 4NG3A 1ME8A 1OYAA 3Q4DA 4DWSB 4JFWA 4F3HA 3NUKA 3K2GA 4B3KA 1W8GA 1J93A 3MU7A 4BCEA 1HJUA 4H7VA 3T9PA 2QCLA 2WLYA 3UPMA 1XYAA 5D32A 4L9ZA 2X7VA 4X0VA 1MNZA 2JBMA 3BMXA 2VZVA 1ZCCA 4Q8WA 1W3YA 2Z1XA 3LHWA 1ISWA 5FEXA 3S2CA 4RR4A 3F2BA 3AWOA 4Z08A 5CPQA 2X16A 3TEVA 3RU6A 1YE6A 3BICA 4BWLC 2IXUA 1MW1A 3H12A 1WUFA 4FEZA 2XVLA 2KXRA 4WZHA 1KM0A 1W54A 2Q1FA 2BSLA 3KVLA 4KEUA 3B9NA 1VH7A 3LHZA 2E6YA 3QMRA 1KBBA 3W7NA 1S5NA 4HU0A 2DIJA 4YS1A 2WHLA 3VGBA 1B4KA 8XIAA 2YXXA 3A9IA 3DI1A 1EHAA 1EOKA 1OG6A 3MSGA 2D0GA 5DO8A 5BOOA 2CLKA 2RFGA 1Q6OA 1F3TA 5CLTA 5I5RA 1E6XM 4S23A 3CQKA 4H8HA 1TVNA 4DAIA 1FWCC 4N9EA 3DXIA 4CQ8A 4ZENA 4NVTA 1WZMA 3UNTA 1FWWA 4GQQA 4J27A 1P0BA 4RCXA 2Y5EA 1QW9A 4N6FA 3N12A 3KBMA 2Y2WA 1XINA 1DXFA 3I4EA 1AQHA 3ITGA 3VGHA 3KTXA 3DBNA 4BJHA 1VJIA 2UZ9A 3GH4A 3W87A 4QCFA 1KGUA 4MZ8A 2FZDA 1R2TA 1PDZA 2VGIA 2VFGA 2AL2A 5F2LA 4S2CA 5HUPA 2CLEA 3UXDA 4DJFA 5CC7A 2Y7FA 1SFJA 4AEFA 2B7QA 5KZ6A 5U4NA 1QI2A 4XKYA 4JNZA 4FNRA 2PWFA 2QJGA 5M2FX 2GSJA 3P5YA 2BVWA 4IFRA 4IUOA 1PIFA 1LRQA 1HJVA 3ARTA 1RHCA 2A21A 3KOWA 4JGDA 4L1XA 2F2KA 4RNIA 5BW6A 1M68A 3V7PA 5A6TC 1ISVA 5AHIA 2GDQA 3GQYA 4QITA 4D1JA 3QC3A 8RUCA 4I8YA 4DJEC 1YDNA 1A5NC 1N8IA 5FF4A 1A5AA 3GC4A 1KQZA 4AG0A 1YDOA 1NU5A 4PL2A 4B16A 3HG2A 4IP4A 2HVMA 5D30A 3WUEA 2D3NA 1RA0A 1MI3A 3TOYA 5FAGA 1HGYA 3IUDA 4WDTA 1I2PA 3VE9A 4L6HA 4QLLA 4U4MA 3LD5A 5REQA 4I5XA 3I4KA 3VZZA 2JQXA 3RLGA 1A5MC 3AOFA 4KWWA 4YTUA 3QFWA 3GIPA 1R3QA 4MWAE 5LHEA 4D8LA 1N8FA 4INFA 3L4UA 4O1FA 1EYWA 3QYQA 4HNOA 3HOJA 1RW9A 1QRQA 2BHUA 3EYPA 1U1JA 4D72A 3O07A 4PZVA 5EMKA 4OKDA 4MIMA 4PUEA 2A6NA 3ZWSA 4LOCA 4U2YA 3XINA 1OGGA 3MUCA 2X1IA 1GEQA 4JIEA 3CV6A 4L6DA 2NX3A 2GGIA 3OU8A 2QVNA 2Y8VA 4ML9A 1RPXA 3P82A 5K4ZA 2VP8A 1W2VA 2H8ZA 2VDHA 4NILA 2AAMA 8CGTA 1OSEA 1VFFA 4O1EA 2X03A 4MM1A 2OWWA 2RUSA 2BASA 4QLJA 4LUTA 1VBGA 3L4TA 1MNSA 4J4KA 3GVWA 3SB0A 1THFD 1CLKA 4ES4A 2HCVA 4UFKA 1VFHA 5IFPA 1TKKA 3BE7A 3BJTA 3QR3A 4W8LA 2VZOA 2VZUA 3O0KA 3SCPA 2ZUSA 2VOTA 1DJGA 3UJRA 5G1TA 1TIWA 3ITOA 3CZGA 3GVVA 4PGLA 3M0HA 4R88A 1OX6A 2NXHA 1RCQA 1ADSA 3L23A 5AN7A 3PY2A 4ZOEA 1RQHA 5DMMA 1XXXA 5LNSA 3URQA 5EFFA 3G8RA 4EWND 2ON3A 3RILA 4G2DA 3S0CA 3XISA 1TWZA 3E2VA 1F73A 1P0DA 2J9YA 2PWEA 3BOXA 5CPNA 3H7UA 2V63A 1XDJA 5CLWA 1KR1A 1R7OA 3BL3A 1EC9A 1P4CA 3EXRA 1GOOA 3OHMB 3DC0A 1RBLA 1OCNA 2H90A 3R2GA 1QI3A 4XTDA 4IX2A 2CXEA 1TX0A 1TPVA 4O53A 5A6AA 3A4WA 3HQNA 1FWFC 2PEVA 3ALFA 3IJ8A 4A22A 3M6DA 4O17A 3GHUA 5XINA 1EP3A 4DB7A 3UA4A 3BGAA 4LEQA 3IJ7A 1J4EA 1XS2A 3CASA 3B4UA 1ODZA 1D8WA 1JCJA 2ZDRA 2B0MA 2DQWA 5LNUA 3QPYA 4GI9A 3PTDA 2X09A 4IFKB 2VR2A 4JTUA 2VEGA 2QCDB 3PNZA 5MF5A 1XX1A 1EC7A 2X05A 1U33A 4MADA 1XYCA 1EF2A 3MCMA 2CWXA 3PZTA 1TWSA 4LALA 2XSAA 2YGYA 1GVRA 1XQLA 4GXMA 1JCMP 5BOFA 2O56A 1KA9F 3IAPA 3N18A 4I3GA 2JK2A 4ZQRA 2PAJA 3L5LA 1C8QA 3PG9A 4PR4A 1QBAA 2DDXA 1ODUA 1H0GA 2XH4A 3L21A 4LUJA 3LRMA 1LLZA 5IHRA 3WH8A 2VZSA 1W1YA 1G94A 1WDQA 4OOZA 4JD4A 4KCTA 2YLLA 3FX4A 1TUXA 1QNOA 4FLOA 3VXGA 5C8BB 3WDJA 2YFOA 2G3JA 4J2PA 2V0TA 3NR0A 1ONEA 5CPTA 4RKAA 3WLMA 2E40A 1MDLA 1OZQA 1VJSA 1OFPA 1C29A 3BV7A 3GFYA 3PFRA 1Z32X 3WSUA 2CHRA 1AW2A 4FIQA 1Z6KA 3W76A 3GYEA 3GU1A 4ENLA 1XG4A 7TIMA 4E8CA 1S2TA 5K3VA 5K2ZA 3TU9A 1GUVA 3QN3A 5AC5A 1P48A 4CCCA 3P61A 1TFVA 3WF3A 4AZ7A 1YPFA 1J0JA 3EWWA 3A21A 4EF8A 2KXSA 4LXFA 4WGXA 4Q8NA 3PBVA 1FKWA 4HGXA 4KFOA 4XBKA 3NDYA 1EJXC 2Y89A 2DEPA 2DT3A 1V02E 2FVKA 5A2AA 4GJIA 2CLFA 3QKZA 3DDMA 4IQEA 4S3KA 1B54A 4OUIA 1FH7A 1CWYA 1CGXA 3T2OA 3WLJA 4WGHA 1V6TA 3TA6A 3AJ7A 3VIFA 1XLIA 4NF7A 3VIMA 3PR2A 4WRHA 1NAL1 5LYRA 5K9CA 3WDHA 5KEZA 3GBDA 4GD0A 4G7EA 1P1XA 4JICA 5BU6A 5LNVA 4FXRA 4JX5A 3ARPA 5E70A 4WY0F 3AS0A 3VD3A 1RALA 4P8VA 4F0HA 3S83A 3PB0A 4J3UA 5FEWA 3ABQA 3B97A 1IT8A 3RITA 4D9PA 3UWYA 3EKLA 1J9YA 4S39A 4GWEA 5AFDA 4TVCA 5HPCA 3BMVA 3UZ5A 1UKTA 2X2YA 3GIYA 3W1NA 1OJMA 2Z2AA 3L4YA 4NASA 4H83A 1H5VA 4JY9A 2GJPA 5CPMA 4UFMA 5AYYA 2XFWA 2AQVA 3OW1A 4PSPA 3DFSA 3L0KA 3VNLA 4POCA 1HL9A 3UR7A 4O4WA 4DZIA 5AZ0A 4US5D 1XSIA 4R85A 3KHDA 3S2NA 4J28A 3IGXA 3GZAA 3NPXA 1XBYA 3RJXA 3H2NA 2KZHA 3B9OA 3AAMA 5C70A 3L4ZA 1R87A 2OG9A 4JQ1A 1BG9A 3V1HA 1QATA 1V6UA 1XBVA 5FSEC 1DIEA 3QSRA 1AH3A 1UASA 4Q8TA 4Z2HA 1DIKA 1ZU8A 4M51A 1Q6DA 5CBJA 4DO6A 4YCOA 3O6AA 3PWIA 2ZE0A 2F38A 2HS8A 2BRWA 4HTBA 4AZCA 4K7YA 1G7VA 3URBA 2I14A 2E4TA 3O05A 1N7KA 3LTYA 2RDWA 4Q8QA 3AU6A 4W7VA 2VR5A 5CJMA 4NRRA 2I57A 3L2IA 3PC0A 2V81A 1VLWA 4A8LA 3BAJA 2ZZ6A 1TQXA 4PCSA 1J79A 5HK4A 4KEVA 1FWHC 3I65A 2PP1A 3WQWA 3GR8A 3PVFA 1K4HA 1XLBA 2O9RA 4N4QA 3BARA 1PTGA 1N7QA 3VYLA 3BLOA 4GCAA 1ZENA 1QR7A 5A1AA 1V03A 5E6YA 4NYYA 3HPAA 4JKLA 4HN8A 4Z1AA 1NF0A 2EPHA 4NSBA 1WBJA 1NDZA 4O8RA 4REQB 1RCOB 4I9JA 3QV7A 1J6PA 3ZIZA 1ZAJA 3FOKA 4Y96A 5A5WA 2VGFA 3B8SA 3WFZA 2NLYA 3M43A 2XSBA 1W8SA 3TXVA 4ZL1A 3SCRA 3SW6A 4UQCA 4PH6A 1JI2A 3FNDA 2UY4A 3NZRA 1PUDA 4M1BA 2QAPA 1X6UA 3AIWA 4XZ9A 3HBLA 5C2CA 1BTMA 5HNUA 4KH2A 1HUVA 3W86A 1S3TC 2F6UA 4PMDA 1Q5MA 2P53A 1OCQA 2Z24A 1G7UA 3ZOAA 3DH7A 1E6PA 1WDRA 2NQJA 1WKEA 3PTMA 1TE1A 2Q02A 3IACA 3H54A 2GOKA 2CZDA 3B0PA 3CC1A 4GY7A 3RHGA 3AZRA 3FYYA 1IEQA 3IJDA 4J5NA 4GGBA 1G67A 1C8YA 3WH6A 3H22A 1U5JA 3P80A 3THAA 1FHVA 5GJMA 2Z2UA 3R8RA 2PDYA 1L2QA 3QW4B 3KBTC 3CB3A 1VFMA 3JR2A 2B81A 4UMCA 1GQNA 1W3HA 2HK1A 4XBJA 3HPZA 3RX4A 1LOLA 2ACUA 2VEPA 3VDGA 4AD4A 3L67A 1XYMA 4MY8A 1ZCOA 3IV8A 1WXZA 5EU9A 5CSYA 3IV3A 4NJJA 1HKKA 1E0XA 3W71A 2DZVA 3IT6B 4AVNA 3ZSTA 3DGBA 4NI3A 2B4GA 2CWNA 3QY6A 1KXQA 1S1RA 3W7MA 4RZBA 3DERA 3WELA 3ECQA 2W66A 4LCSA 1W1TA 1B0IA 3VGFA 3CM4A 3VNMA 1S5WA 3B05A 1O68A 1JYVA 1GKPA 2EJAA 4CVUA 2GUBA 1GVQA 3VD7A 3K4AA 4MDPA 1XGZA 3BW2A 3KBJA 2P50A 2XIIA 1T99A 1ITXA 3WX7A 4KS0A 1YE4A 1K3UA 2D2GA 1KRMA 4HMEA 2CIPA 2CNCA 2PWGA 3SN1A 4A8NA 2VFIA 2C15A 2GDVA 3TQPA 1C82A 3CZJA 2YCLA 2VDIA 4IJRA 1NOFA 2YB1A 3C8FA 1V3JA 3MP4A 3AROA 3ONCA 2EG6A 3WFLA 1WZAA 3VK5A 1GKQA 4GYPA 3DECA 1TTJA 1HJXA 1UR3M 3H2AA 2VFFA 4AXNA 4QROA 3R58A 2XM2A 5T26A 3W38A 1K9EA 3J7HA 4NX0A 2WW5A 1A49A 2REQA 1WAWA 1PX3A 4UBPC 4DBSA 4H01A 1T0OA 3QQ1A 1Q6RA 4UR9A 2NVAA 5F2IA 4GUFA 1A5SA 1BVNP 4GIEA 4UTJA 3H6OA 3IJ6A 1LZOA 3ARQA 1Z89A 3WQPA 5BROA 1XIDA 4EWJA 4V1YA 3MT1A 5GNXA 2E6FA 3LCWA 3DN5A 1KQYA 3RYSA 3AHXA 4GGHA 2PDJA 3QBUA 1F76A 3Q45A 3TYEA 1AL8A 3SQLA 3CLMA 3BOLA 3IUIA 1KFJA 2WANA 1JEZA 5L6UA 2CHOA 3K30A 3WMCA 2YL5A 4KCVA 1CGYA 4E6MA 3NL3A 3G5EA 1D2KA 3SIMA 4V33A 3WMBA 1UH2A 1B1YA 4EOUA 4OGZA 4JN8A 3HZ3A 3E49A 1QPKA 1XRTA 5A69A 4LNYA 4AVFA 4W4QA 5AVHA 2WNWA 5EBAA 5DT5A 1EFZA 4GUJA 4UTTA 4ROPA 2FZMA 1WOBA 3ITLA 1V0MA 3SRFA 2ACQA 3VABA 1JD9A 3ZYZA 3PSWA 2V3GA 1D7FA 1D3HA 1FWEC 1PCWA 1E0WA 4H00A 2ADAA 1EZ2A 2FLIA 3WF0A 4IHCA 3W4RA 5G4WA 4GVIA 1ZBVA 4BI6A 2EBNA 3EWXA 2BY3A 2CW6A 1JGMA 2VEKA 1VS1A 4CNSA 4K1WA 5G2IA 2BGQA 3CUGA 1QASA 2XVNA 3C3UA 1C8XA 2GK1A 3ZWTA 1R2SA 3VKKA 1IT0A 7REQA 3H2MA 2WO5A 3TYBA 3ONBA 4W5UA 1W17A 1SZNA 2TRSA 3H8AA 1UP2A 3N25A 1WZKA 3W2JA 2QPSA 3L5AA 4L4LA 1AD4A 1BQGA 4AH7A 3FHAA 4ZTYA 4CQDA 3VC6A 3W7IA 1HJSA 3TMQA 2DUZA 2WMIB 4UQBA 2CZEA 3NQCA 1JCYA 2I5QA 2QNEA 4I90A 3LHTA 4FP1A 1OFBA 2JEQA 1BXCA 4ADSA 1DWHM 3WH5A 1M7PA 3XIMA 2W5FA 3B8UA 3OPSA 3E5BA 2PDUA 1HL8A 4S38A 4NT0A 3WYZA 1D8CA 1ZAIA 3S6OA 3U5UA 3SUVA 4Q33A 4GX9A 1M65A 1P0KA 4V15A 4FI4A 3MQTA 4OFCA 2XH2A 3O8AA 4MFEA 3Q94A 3UG5A 1N7OA 1TE6A 3ARVA 3SBFA 3TLLA 1W31A 2E1WA 4J40A 2J47A 3QY8A 1LQ2A 5BWFA 1M03A 3C2FA 4OZOA 3GDBA 4LB3A 1GVIA 2CITA 1XRFA 3EEGA 3P8JA 1ZP4A 3AMCA 4XIAA 1NDVA 1WXYA 3F2CA 3GXMA 2D73A 4A3HA 3W28A 3NZPA 5JVLA 1MEIA 1EUAA 4H2CA 1A5LC 3VA8A 1S2UA 3AIUA 1YEYA 3T4CA 1EGUA 1XIEA 3WBAA 4BZYA 4LYQA 3EX6A 3CV2A 3P8IA 4IPIA 2QIWA 2IPFA 4UUIA 2AAAA 1MXGA 1T8QA 1J0IA 2OO6A 2J7CA 2XWDA 1KFKA 3RRXA 1FRBA 4DYJA 3PB2A 4JIQA 1TZZA 2EAWA 3GM8A 1QK0A 4Z2GA 1J5SA 3UYCA 1CGWA 3CMGA 1QBBA 3EAUA 3FA5A 1WBHA 3FJ6A 3FA3A 3RNDA 3WBXA 1REQA 3WJXA 4QJ4B 1S38A 1TWIA 1VPQA 3PG8A 2RGMA 4XAFA 3H21A 4Q6XA 4AWEA 3R0DA 1G4PA 1SFSA 4MNMA 1MZRA 3RGTA 2QIIA 3GTXA 1BRLA 4QBXA 3CHEA 3ZT6A 1LORA 3EB3A 1G9HA 1OYCA 1H1ZA 1DVJA 1TZ7A 4C91A 3BLDA 3S8HA 4DZHA 3F5KA 3T2PA 1IXOA 4KF1A 4HJWA 4PCTA 1XGEA 4GIYA 3FKRA 3GNDA 2IW0A 4JDYA 4GNVA 5D9PA 3FDGA 3TK7A 4WX2A 2BXVA 1E4IA 1UKQA 1Q6EA 2OYMA 1N82A 3IT4B 3PUDA 4RXFA 4JQAA 4GJJA 3OZOA 4IMCA 3U9IA 1JDCA 1M3UA 2QDDA 3PFMA 1GONA 1LG1A 3W00A 5FAJA 4L4OA 3QPZA 1VRXA 3AU2A 1HGWA 5K9DA 3NSNA 1FWIC 2XINA 4S3JA 3AMGA 1WCGA 2Y1HA 1Q66A 1LBFA 1KLYA 3M41A 3EWYA 1OBAA 3QTPA 1KKRA 1SFLA 3AIRA 3ANYA 3DESA 4MWAA 3M16A 5C54A 3NYZA 4FXFA 2O9TA 3LA4A 1KM4A 2PWDA 5C0QA 3R4IA 3OLGA 5JUVA 2DSUA 1Q13A 3BK0A 1PWMA 3OA5A 1DWFM 1SZGA 2PLMA 4NY2A 3DFQA 4BF9A 4GOAA 3C4UA 3KS5A 2Q3OA 4ZEPA 1ONWA 2P3EA 4XK2A 2YIHA 1FDZA 1Z7AA 1WE5A 4IM4A 2MANA 3T4WA 1A4MA 2XH7A 2GFTA 3W1QA 4PMOA 1A5UA 5I09A 5LA0A 3E2RA 3D0CA 1PDYA 1C9WA 1V5XA 9CGTA 1W1ZA 2BBFA 3TYUA 3B8WA 4CN6A 3RLHA 1V6VA 1EKOA 3F4VA 2HPIA 4S1FA 1KFEA 4OV9A 5FJJA 4NJGA 3S5OA 3U2CA 2Y5JA 1UJQA 1OFDA 3MW7A 3EX4A 3CHVA 2VC6A 3K13A 3MP3A 4QXIA 2ZRYA 2G96A 3ZM8A 3THDA 1O5QA 1JZ3A 4AZHA 4MGGA 3RPMA 3GY1A 3V1PA 4MWAD 5AHLA 1H4PA 1I2RA 3F4NA 4GC4A 3QC0A 4R3UA 4R9XA 5IDZA 3CH0A 2PDFA 3S1GA 2HE8A 4K7VA 3V0SA 2PGEA 4GA8A 5EMMA 3V5OA 1A5KC 5E9XA 1CXHA 1KXVA 1ZY9A 4AYSA 3OBEA 3WNNA 3K8MA 2CZ5A 3M0JA 2VEFA 4NYUA 3B9EA 4ZOCA 5AECA 5DCEA 1H0IA 5IBXA 2J24A 1BFNA 1PEZA 4O0ZA 4YWSA 1K6WA 1GZ1A 5E93A 5I06A 1RSCA 4AIUA 3C2VA 1RVGA 2OKTA 3ATZA 4O0QA 2X30A 4V2XA 2WMKA 2WM1A 3EX1A 1UD3A 4M80A 4GVHA 1A3HA 2POTA 2Y88A 4V1XA 3VO0A 1Y65A 2ZKMX 3AZTA 1KBKA 1SM9A 3D47A 5HINA 1G69A 2V38A 3HMCA 1PV8A 3LU2A 1D7KA 5LIWX 4UR8A 3PWAA 5BRQA 1UIOA 1TX2A 1UR1A 3CNYA 1TTQA 3MZNA 2ZTKA 3RU8X 4PBGA 4CNTA 3OODA 1XW8A 2HTMA 2H9AB 2R94A 4G9PA 5HQMA 1GOMA 3IAQA 4CKQA 1H49A 2ZXDA 4ICMA 3OZMA 3AS1A 3G24A 3V75A 1ZPTA 5A8NA 3PAOA 2JEPA 3TUUA 2VCCA 4FNTA 4Q4KA 1VIWA 3E02A 4AU0A 1JFHA 3UR2A 2BMBA 2YCJA 3JRKA 2OO0A 4IIHA 3UZXA 4ERIA 2JGYA 4UTTC 3V36A 1VKFA 2YBUA 3NG3A 3FSUA 3HV9A 2QJJA 4HVXA 1V77A 1SMAA 3QW3A 1FOBA 4FAMA 3OIXA 1WX0A 1XLDA 2OPJA 2GYIA 1B3WA 4PTNA 3KFTA 1RCXB 4JNMA 2C19A 1RBAA 2DSKA 2YR1A 3PZIA 1E6QM 1AMYA 4I7VA 2PF0A 1OG0A 3WEMA 3BJSA 1BYBA 3NQDA 1OK6A 1KTBA 1RQBA 5D2YA 2R24A 1XCWA 2VX7A 2XZ7A 3ZR4A 3B8VA 4NXSA 1W3IA 3S47A 3QHNA 2WHKA 2P1FA 3DHPA 1Y5XA 4ZO9A 4TUFA 1FY6A 1O12A 1T7LA 4YU1A 2WSKA 5DY3A 2C71A 3NAVA 1S2CA 1XWYA 1O6IA 2INEA 1AUSL 2G3IA 1OT2A 3RM8A 1F8IA 2Y70A 1XLHA 4A2SA 4C7GA 1VHCA 1J0HA 4FALA 4D6GA 5EMUA 5D2VA 4FR1A 1MRQA 3TYDA 3W75A 3ES7A 3VCCA 3ZLGA 3ITYA 1H62A 2ZZ3A 3OGRA 2J74A 2OCZA 1W9DM 3UWVA 1V02A 3PM6A 1QJWA 3COTA 4PTMA 4EF9A 5TIMA 3PBWA 3WO8A 4QISA 3NO5A 3LGGA 1FUYA 1XI3A 3L5MA 1HF6A 3HURA 3LOTA 1RJPA 2GJNA 3D3FA 3VD4A 1DWAM 1V51A 5H91A 3BGGA 2NWSA 2EG7A 5H8UA 1MXDA 2XN2A 1R6WA 3JUGA 1E0VA 4DI8A 1QHOA 4XAGA 4LYKA 1VYRA 4A3QA 1WAUA 1ME9A 3T09A 5CCZA 4UQDA 6PTDA 3BG3A 4H6RA 2YEPB 1XKJA 2ZOXA 3FHQA 4WXYA 1UPMB 3G1VA 1LUCB 4R7WA 1RD6A 3TE9A 4GG9A 1X1OA 3NTYA 3N4FA 2DZTA 4LUSA 3R89A 2O9OA 4AZIA 1EP1A 3CL7A 1LXMA 4PEEA 3KM8A 1FXQA 1OYBA 5I0DA 4CD4A 1DJNA 3AS2A 2C14A 3GC2A 3NZGA 2WWCA 3TR2A 1E9LA 1GVSA 1OGBA 1R3WA 3VZXA 3DUGA 1C92A 1I0DA 4CQ9A 3GXTA 1MYRA 3QZAA 1K8CA 2QXWA 1O60A 4JTSA 1AW1A 2A7NA 2CERA 4B4FA 5E6ZA 2J8GA 4AB4A 3THCA 1H61A 2V5KA 2DORA 3QZ6A 3UF9A 2GK1B 4QR6A 2Z25A 2NUYA 4IFOA 4ZA0A 5GVJA 3S5YA 2EXOA 3P0XA 4DPQA 4GACA 4H6QA 1R9XA 4XV0A 2VFEA 1C93A 1V93A 5BMWA 1GTHA 4YHGA 4IPLA 4B5VA 3W70A 2CLLA 3MO4A 4KQNA 3NURA 3GNNA 4MYAA 4Y9MA 4JEJA 3MYPA 4HP5A 4FX6M 4YIWA 1GYNA 2D0HA 4O10A 3WDPP 3WD1A 2E5BA 1UWUA 4KFNA 4AD1A 1DIDA 4CCDA 2ZWZA 3WNLA 3L0GA 2ZRXA 2A3AA 2V5LA 4D6DA 3TW7A 1V8EA 2BRPA 3LPPA 4U28A 3E2SA 1AZ2A 4R5EA 1SJAA 1DJZA 2DZUA 3FSTA 2ZX6A 4GY1A 4JTJA 3VZYA 2BRVX 2XIQA 3BTNA 3TJXA 3THUA 4HU3A 3PK7A 1CB2A 2XHYA 1OEPA 3GIQA 4ROQA 4RX0A 3T40A 4BS0A 4MFDA 3DGRA 4JTIA 1C7TA 2ZZ7A 3WLIA 1TRIA 2YX0A 1UH3A 3CGTA 1SZEA 2ZICA 1I1XA 4L56A 3ANUA 4D8AA 4RE2A 2Q8LA 1EQPA 4KCWA 1FWBC 3UJ2A 2Z1WA 5KMYA 4JL2A 3DHUA 2P10A 2TODA 1UD5A 1H7OA 3LS9A 1HKMA 3R94A 2NQLA 5C7VA 2FKPA 3NNTA 3DC8A 2PE4A 1XC6A 1W56A 4KWVA 3CHCA 1OHLA 5C9XA 4OECA 4PULA 1UR2A 2R14A 3P14A 5DMLA 5GNYA 1WOAA 3S1VA 1J11A 3ZVHA 5M3WA 2WCGA 4QFUA 4B91A 3CHDA 3CUFA 1N55A 4XIMA 1BVWA 1J5TA 1FA2A 4UOQA 2VO5A 1XD0A 4TTUA 5CGMA 4DZ5A 3TXZA 4DX3A 3S42A 3T0AA 2X2GA 1SJBA 3GSMA 5AYXA 4JZ5A 4EKJA 4JTRA 5CJNA 4J9JA 3SUSA 4JTQA 4IIFA 2PDHA 4L9XA 3TN6A 5CG0A 1RJRA 1GOQA 1CX9A 3MHUA 2Z1BA 4MAZA 3TMLA 1NSJA 3AS3A 2QJHA 3ZLHA 3T2QA 2BVDA 4E4PA 2WCSA 4MJ2A 6A3HA 4GZ7A 3DCPA 5F1VA 1VGAA 4HQVA 1UIPA 3CQIA 4AYGA 3GNRA 3SCNA 2GJLA 1PBGA 2ACSA 3MB9A 4RV3A 2X40A 4GNJA 1SZFA 1QNQA 3G0XA 2NQ5A 2C0AA 4M6QA 3PJXA 4FA3A 1XIIA 1CXLA 3W7CA 1JQXA 1PWLA 3GU9A 4E38A 2LLEA 1E1CB 1V6XA 2E6DA 3LHYA 2D2JA 4HD5A 3ME3A 1B9BA 1O94A 4XAPA 3MHFA 3L66A 4CUCA 4Z1CA 4O50A 3G1YA 4PMJA 1A5OC 1JGIA 3QY7A 2NQHA 3R12A 1LOSA 4HSHA 3W7OA 4X9YA 1EEXA 1SZRA 1L6YA 4BQ3A 1WB0A 2CFFA 1DKWA 3ZVIA 4FNSA 2FYMA 3DHFA 2UWFA 3TQKA 2DZAA 4EPEC 3IJLA 1KRBC 5D37A 3LSBA 3QMTA 3H2OA 2BTMA 1H1NA 1P5BA 3Q58A 3SRKA 3GO2A 1SQ7A 3S1WA 4K68A 3WLOA 4X2PA 3BLIA 3CIXA 2IQTA 4HNTA 2YA2A 2PLKA 5DCBA 5LIKX 4WIWA 3UU0A 3EA3A 4JTGA 3LI1A 1GGOA 1F7BA 1C90A 2C91A 3RFAA 3GDTA 1TA3A 3FVDA 4JTHA 5C9UA 3MSRA 4GFSA 2ZCGA 3S3GA 1Z3NA 1XICA 1WDWA 4RUBA 3H23A 4XSMA 5JBDA 4PMYA 4ZOAA 3WLTA 1DIOA 4KCUA 2FZBA 3KRBA 4C6DA 3KOFA 4Q3MA 2E3ZA 5KSWA 4ZFCA 3AJXA 3TYZA 5CZ0A 3SI9A 2HNEA 1M6JA 2FGZA 4DEFA 4KPLA 2QGHA 3ARRA 1J0YA 4AWSA 4L1WA 3SEPA 2IPJA 3P67A 4OT7A 4UB9A 1TREA 3QM3A 5A8PA 8TIMA 4S3AA 2OT1A 1JCLA 1MMFA 3GG7A 2RKXA 3FV9A 4DF0A 1FX6A 4WSKA 2AOSA 3A47A 1K7XA 2YEPF 1TSIA 3T8LA 4N7QA 1PS9A 2VX6A 1SGJA 4Y9AA 1Q45A 3GXFA 3QPEA 4FIRA 1Q6GA 2R9RA 1K8XA 1P6WA 2OELA 3C3NA 2C6QA 5CPSA 1HL2A 3MDUA 2BVYA 4IMGA 1E4NA 3OGSA 3M44A 2WAGA 2X7WA 4FHAA 5C71A 3ABOA 3GB6A 4MPKA 4IPPA 4UIOA 3CUZA 1D3GA 2GSEA 3WEOA 4CD6A 3Q65A 3N4AA 3W83A 2YLAA 2E8ZA 4LWWA 4R53A 1ADOA 3FK4A 3DG7A 4X61A 4DZAA 1IXQA 2QCMA 3R25A 3RM4A 4XZMX 2DW6A 4A05A 2CBUA 3CAQA 4O1BA 1TUFA 3LEPA 3E2QA 1ZGDA 1F4HA 1YMYA 3M0ZA 4IF2A 4ZGYA 2EG8A 3VNIA 4DBDA 2YCIX 3A24A 3GNOA 2IKHA 1EIBA 1XGDA 4MJMA 1UBSA 3M4HA 1DEDA 3P5ZA 4KWOA 2XFYA 4RNJA 4XTIA 1EPVA 2XPKA 4DXXA 1UWAA 1GOKA 2PCEA 4C6NA 1GOXA 1XBXA 2WZHA 4DWSD 3SRDA 3AMKA 2FQIA 1XLAA 3LB0A 1OX4B 2OEMA 1BXNA 1F3WA 4J35A 3KL3A 3QLDA 1RLCL 3MDWA 3FAXA 1NWSA 4ACZB 3VCRA 3RO6A 3RCMA 4FNPA 2ODOA 3VX0A 5I3JA 3HPXA 1DWJM 1F3EA 2G4FA 2Q01A 3HG3A 4Q6JA 4Z1BA 3W22A 2VJXA 1KCLA 4O8AA 3PPFA 4XZWA 4Z1DA 4FF5A 2XIOA 1V0NA 3UPBA 1FWRA 2QDEA 4X3ZA 2DSWA 1OX5A 4RDWA 5DX7A 4PUNA 5G1MA 3DG6A 2QZRA 4YJ5A 2QF8A 1W5OA 3IIOA 1AL7A 3RDKA 4KETA 2J66A 1IWBA 2DGAA 5CZKA 2G41A 3KRZA 1XV8A 3BANA 5DY2A 1HO4A 4WJXA 4B5XA 2WQDA 4H9VA 3FJNA 4GZJA 3RXZA 1K4GA 2QCCA 4G8TA 4YTQA 3GBEA 3TVAA 3W84A 1EL3A 3UXIA 2FZ8A 3QLLA 1RPKA 1POKA 3TNBA 1VF8A 1QNVA 3O6DA 3CT7A 2XM1A 3JVAA 3WQGA 3A4XA 4BWLA 1Q2SA 3GHSA 4DBEA 3HN3A 4MKNA 3KLLA 4S2BA 4NU7A 3REQB 4MB5A 2Y0FA 1H63A 1F8MA 1PZ0A 3QV9A 1NWUA 4U5KA 5A8GA 4OQVA 1FVPA 4KRTA 4O15A 3O15A 4JDBA 3EOUA 5FSDC 5CGQA 5HATA 1GQLA 1ZBWA 4UNLA 4LC8A 4Z0SA 4C6JA 4RJEA 4LUSB 2A3LA 2BWGA 4XG1A 1OC5A 3M5VA 4D6JA 2JALA 3UXAA 1BKSA 2PZNA 4M3PA 4QE5A 2A79A 4H1ZA 3LDVA 2QKFA 4QNEA 3AQUA 4Q22A 2DVXA 5EYWA 3W88A 3AZSA 4Y6GA 4MTVA 1B3XA 2ZWYA 4L4PA 2R1LA 5LGZA 1ZJHA 1X1JA 4OHQA 4AVOA 3AUJA 4CN4A 1MEWA 3UWQA 4MY1A 3WBEA 3GXPA 3BSGA 1CECA 1NFPA 3SN4A 3TTQA 3A5VA 4UTUA 2V4IB 1C3FA 5FJPA 2E9LA 3RK8A 4GUGA 1K02A 1ZRQA 2ZADA 1UB3A 3IJIA 3G6MA 2A3BA 5BRPA 3VDHA 2AQWA 1BGGA 2DZSA 3UWWA 1T41A 1EBHA 1GQIA 1TO3A 1P0NA 2YFNA 3HTWA 1HVXA 1W32A 2NUWA 2XG9A 3WLRA 1AH0A 3DX5A 4FF7A 5B7YA 3MC5A 4BF7A 1H7XA 4RDYA 2V3DA 3RCNA 3W1PA 1JPHA 5HMDA 1R0MA 4RV8A 2NT0A 2BODX 4DJEA 1T40A 2XWEA 2Z7GA 3UA3A 4AWTA 2FPYA 1U30A 4JFSA 1YX1A 2NSXA 1MFVA 2VQUA 4X2RA 5A8OA 4OV4A 5H6HA 1O5KA 3M0VA 1QO5A 1NEYA 1KB3A 4FLSA 3S9ZA 4WKAA 3LTSA 1VENA 2BP1A 3H55A 1ZSXA 4RE4A 1CT5A 2WMJA 4DI9A 1UW9A 3GW3A 5D2TA 3SADA 3U8GA 4N42A 3IIPA 3OA3A 5BWAA 2RDUA 2XISA 1VCVA 3S5ZA 2W3ZA 3H2FA 4IQLA 1IQ8A 3WLSA 5HJXA 2WHMA 2WOQA 4AMAA 1EJVC 2V2HA 1BG4A 3MMTA 1VIZA 4WDUA 3TTSA 5ABFB 5HNTA 1KFBA 2R1PA 3PZMA 2GOUA 4ZSTA 5HWJA 2OX1A 3SY1A 1IZKA 3TC7A 4A2RA 4ATWA 5A2BA 3HPFA 4DJED 2Z29A 3WNOA 1X7FA 3QMSA 4Z2LA 5IM51 3UNDA 4CNOA 4IFKA 3FN9A 3QRHA 4H19A 1MUWA 2QCDA 4LCQA 3LTPA 4EXBA 2WC3A 1TJRA 3SY5A 4KIEA 3B0XA 4K2SA 5H8MA