2WMIB

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 in complex with the a-trisaccharide blood group antigen.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
582
structure length
571
Chain Sequence
VDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTENYWIWANDIENKAADYLKVSAKNGGYFIWAEQNNGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKSKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords FUCOLECTIN-RELATED PROTEIN
total genus 212
structure length 571
sequence length 582
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmiB03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmiB01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmiB02
1N7PA 1GOKA 2ZXDA 1EDGA 4PCSA 1WZKA 2EQDA 3L4YA 3W27A 4CU8A 4QCEA 3WDQA 1L0PA 1PEZA 1O7AA 1W9BM 1B30A 1C8QA 2DPEA 3N18A 4GI9A 2A3CA 4ACZB 5A8PA 2E0PA 3EDJA 4P7OA 2D2OA 1UHVA 1E4LA 4S3KA 3WQ6A 4WKFA 2RGMA 4LYRA 3UCQA 2WCAA 5I78A 3APGA 2YKKA 1VFOA 4AZ6A 5TD4A 1CXKA 1AQMA 2G3NA 3NIYA 2XVLA 3SCVA 4WSKA 1JAKA 1UOKA 3ARZA 3WMCA 2CITA 5AC5A 1B3XA 3T2PA 3BSHA 4HA1A 4PRWA 3RCNA 5A69A 1W3JA 1FHLA 1V03A 1J12A 1GQLA 4JCMA 4PMNA 3VOCA 3KWXA 2XGBA 4WKAA 1CBGA 1ISZA 1J0MA 3BAWA 1JI2A 2D3LA 3AMLA 3WDIA 4BCEA 1XH2A 3T0AA 5BXSA 2Y4SA 4M56A 3BC9A 4CKQA 2E4TA 2WZIA 4ZE5A 3VD5A 3WNKA 5HPCA 3OZPA 1UWQA 3UETA 1N7NA 6A3HA 3M46A 1RW9A 3CUIA 4HA3A 1HX0A 4ZEPA 4Z2HA 3BCFA 3TTYA 4U5KA 2O9PA 5A2CA 1IZJA 1CGXA 5IHRA 2W61A 5E6ZA 2WC7A 1H4PA 2Z1SA 2CPUA 3WL0A 3ZJ7A 3DHUA 4AZBA 1V6UA 2D24A 3K46A 2YL6A 3L4XA 1VJSA 1ZS2A 5AC4A 1B3ZA 1KCKA 5FKYA 2OYLA 4Z2JA 4N0RA 3N12A 3VIPA 3K1DA 2AMGA 1FFQA 4TVCA 3PZTA 1CWYA 2J47A 3EDDA 4J28A 4D1IA 4GO9A 2JIEA 3ALGA 1NP0A 2PWHA 3K8KA 1DWGM 2OYKA 4F9JA 1TUXA 2GUYA 5AYIA 4ZFMA 3AROA 4PSPA 3E1F1 2PF0A 4W87A 3ARYA 2PWFA 1CB8A 3AZSA 3WD3A 5DF0A 3WH7A 3VD3A 3QOMA 3L4TA 3AYSA 1V3IA 2C8NA 3ARPA 1YHTA 1BQCA 4XB3A 4RE3A 1XH0A 2ZIDA 4XV0A 3I3DA 2PI6A 2WMJA 3U7BA 3DYOA 3LMYA 2VO5A 3PZUA 2YL8A 4PMOA 2D1ZA 4J3WA 2G8ZA 4GZIA 2WMKA 4P7NA 1Q6FA 1BYCA 1RP9A 2DT1A 5A6MA 1I75A 1U30A 1JZ2A 1JDCA 3NJ3A 2J7HA 1QBBA 2C7FA 3NDZA 2DEPA 5EB8A 3RDKA 1E6PA 1ZBWA 5DEZA 1X1JA 2PB1A 5A1AA 1Q6DA 3WNMA 1ITCA 4C7DA 2J25A 1TCMA 3FW6A 3U57A 5CG0A 1PX4A 3SIMA 5A3HA 2XJ7A 4D6EA 2VJXA 2DT0A 1C90A 1E0WA 2WSPA 2X0HA 3EMCA 3EYPA 2BVYA 1HL8A 3TTOA 5LA2A 3GH7A 2YBUA 5EFDA 1E56A 2WVTA 4DWSD 1BHGA 5C70A 1L8NA 4GPNA 3VIKA 3LPOA 2XVPA 2W92A 4UQAA 1SFSA 4JIEA 1V02A 2J8FA 3T2QA 3A47A 1TMQA 2XVNA 3MV11 5CPSA 2OWWA 5I24A 1VEPA 1M7XA 3QR3A 5C8BB 1H2JA 3CZJA 4NRSA 5EMYA 3ZO9A 2EPMX 1E3ZA 4UQEA 3CZGA 3AIBA 2VX4A 1HMUA 3LPFA 1KQYA 1IZKA 4AIEA 1UKTA 5KZ6A 4BQ2A 4QCFA 3WH5A 4DM2A 4F9DA 4EK7A 4IISA 1VFFA 1CENA 2XFYA 5IHSA 1PZ2A 4QLJA 2FH8A 2YLLA 1JI1A 2DSWA 3M6DA 3AI0A 1N7QA 1V6YA 1E6SM 2YJQA 1J9YA 3MUY1 2BHZA 1UQYA 1EQPA 1OB0A 1UD5A 3QGVA 4MNKA 1NARA 4YHEA 2DQXA 2XSBA 4L4PA 3W53A 2BRPA 1PBGA 1E0VA 4MAZA 1OGSA 2YA1A 3MSGA 4CN6A 3J7HA 3IAQA 2WHJA 1US3A 4DUWA 1JXKA 3VGDA 3VX1A 4WK9A 2QLYA 4MDPA 3RPMA 2WK2A 4PMRA 3ZT5A 2V3DA 2YOCA 2ZX7A 1W9PA 4P8WA 3N17A 2XG9A 5A6AA 1OWQA 3K4DA 4TUFA 1OJOA 1UKSA 3W6LA 5E0FA 2ZOXA 4IM4A 5A8MA 3F5JA 4Z2LA 5F7UA 3WH8A 2CCRA 1TG7A 4E8DA 2WM0A 3VD4A 3SEPA 2NSXA 1BG9A 4KRUA 2VRJA 3WKZA 1HP5A 3RM4A 2VZOA 3AFBA 1GOMA 1X1IA 3OG2A 3OGSA 4OBSA 1UR8A 2WWDA 3W0KA 1OSEA 1Q6GA 3VIIA 3VMNA 1R87A 4Q7NA 1MQPA 4KMQA 3U5UA 5KEZA 2WMIB 6CGTA 5M5DA 3BSGA 2VCCA 4ZE4A 2VQUA 2WW5A 3WD4A 4BZYA 3AMCA 1GJUA 3MUIA 5HDRA 2E9BA 4HP5A 3VIGA 4KH2A 3MSDA 2EPOA 5C71A 4W84A 2D0FA 4M29A 1HVQA 3F5KA 2J7FA 1XD1A 4PMZA 4ZENA 1QNOA 4H8VA 1EO5A 1DP0A 2FGLA 2WLYA 1B3VA 1C91A 3THCA 4AEFA 1ODZA 5CPTA 5D9NA 2W4XA 5E9AA 4HMCA 5D9PA 4B3KA 3NDYA 5JBDA 3CUHA 1US2A 2JEPA 3UG5A 3SCWA 2CXGA 4F8XA 1KXVA 2NW0A 4WLCA 5CSUA 4KWUA 3EBVA 4IPLA 2QMJA 2DT3A 3U7VA 2NT0A 1NOUA 3O6AA 1JZ6A 1ZB5A 2DGAA 2ZE0A 4L4OA 1R7AA 2G4FA 2XVGA 1KXQA 4PCTA 1C7SA 1UWTA 4HMEA 3CLWA 1ODUA 1W1VA 3ZSTA 4M80A 3LPGA 1HM3A 1OT2A 2DT2A 2BS9A 1KXHA 1W32A 2ZX5A 4TOQA 1E4MM 2WDAA 1BYBA 2DDXA 1QW9A 1OM0A 2EO7A 2Q8XA 1UA3A 1LL6A 1XSIA 1MWOA 3L4VA 1CNVA 3NSMA 1JZ7A 3AOFA 3BLKA 3VPLA 5I77A 1UYQA 2DIJA 2WKGA 3CZLA 3GH5A 3OA5A 3ZR5A 3AYRA 4CVUA 4P7RA 1RWFA 5ABFB 1OIFA 3JUGA 1UH4A 1OJMA 3OGVA 7CGTA 3VGGA 1I8QA 2JIWA 3ARSA 2NT1A 4FLOA 5BXRA 1WZMA 2J79A 4CU7A 3SUVA 3EMZA 5A2BA 4H8HA 2E9MA 3K4AA 4R5EA 1CXLA 4AZCB 1V0KA 2Y5EA 3HN3A 1EIBA 4RE2A 4HMDA 1LOHA 3VD7A 1ZJAA 6TAAA 1OD0A 1GQKA 1UD3A 2OWCA 3AHZA 5A6LA 1UD2A 5HOSA 1QOXA 1HF6A 1V02E 3W29A 1CGTA 1N7OA 4X0NA 3OLGA 3BAKA 3IJ9A 2JEQA 4OOUA 1DEDA 3UEQA 4UFIA 2ZXBA 1CGVA 1J11A 5DFAA 3SURA 2DSKA 1W9UA 4URIA 1PIGA 1OGGA 3WELA 2CHOA 1W9XA 1J0HA 2VTFA 3AMGA 2QF8A 5BRPA 2VMFA 1R7OA 2YBTA 4AD3A 3ZT6A 4D72A 4J3UA 3D3AA 4OUEA 2W67A 2WMIA 1U2YA 3PZVA 4C7GA 2O9RA 3SUUA 1LLOA 3S6TA 4NF7A 4PN2A 3WF4A 3WFZA 4FLSA 1V6VA 1UH3A 2Y8VA 2XFFA 1KWKA 1JZ5A 2GDUA 1QHPA 3PZOA 3K8MA 4CD4A 2XYLA 3ZR6A 4CN1A 4H7VA 4D6FA 1HN0A 4C7FA 1A3HA 2YL5A 4UOZA 4D6HA 1VBUA 1QNRA 4BS0A 1LWHA 3AICA 3SCOA 1FOBA 1CLVA 1JZ3A 3U5YA 1ZJBA 5D9OA 2VZSA 2GJXA 1HVXA 1JZ8A 1GOIA 1YQ2A 4WF7A 4HOXA 4BQ4A 1PJ9A 2CHNA 3GZAA 2FHBA 3L4UA 1NQ6A 2W66A 4EAMA 4TX6A 2JALA 4W7VA 2WVSA 1GJWA 1W3YA 1I1XA 2J74A 5BROA 4PUDA 3WY1A 1B3YA 1QI2A 2J7GA 3WNPA 1XYFA 4PTXA 3ZJ8A 1B2YA 1V6WA 4HU8A 2AOSA 1EH9A 3CPUA 1RWHA 2G41A 3KZSA 1EGZA 4CD5A 2BHUA 1J0JA 5FIPA 1PZ3A 2IXVA 5EBAA 3EDEA 3WH9A 5JBFA 3N04A 2VOTA 3AXXA 1JF5A 2WCGA 4UFJA 2WWCA 2VX5A 2O9TA 2PC8A 1ZL1A 1HJVA 3WFLA 1BVNP 1E1FA 1WO2A 2OSYA 1OJNA 1JD9A 3WNOA 1GOOA 1UWIA 4CUCA 1EO7A 2VZTA 5GNXA 4CGTA 1NWSA 5FL1A 2A3AA 3WUFA 1MW1A 3DYMA 3GXMA 3CHEA 4OJYA 3QHMA 5D9MA 1QI4A 3WUBA 3ARTA 2D0GA 3CH9A 4EKJA 5A8OA 4PTMA 1EHNA 1MQQA 3FHQA 4CCEA 4AISA 4Z2GA 1JZ4A 1CXFA 2JF6A 1W91A 4U2YA 4W89A 2CIPA 2BY0A 3AIVA 1JDDA 3WQ4A 2BFGA 5ABFA 2QHAA 2CNCA 2D0HA 1LJYA 1UD6A 4LYPA 4QLLA 1F1SA 1JG9A 3FY1A 4CCCA 1SMDA 5GQBA 4W7UA 5IFPA 1J0IA 2V38A 4CVWA 4M81A 3RIKA 1PX3A 2XSAA 3VIHA 2VZVA 4QFUA 4A3HA 3VM5A 2BVDA 1MVYA 1WPCA 3GTNA 5CLWA 3ZJ6A 4JKLA 1XSKA 2GJPA 4E2OA 2WVUA 3AJ7A 4B15A 4UTFA 2VT0A 2OSWA 1H5VA 2D22A 1DWJM 4UFHA 3F5LA 2WBKA 1RWGA 3PZNA 3BGAA 5LA1A 5HNNA 2WPGA 1PX8A 3ARWA 3VUPA 3AHVA 1E6ZA 1SMAA 4RE4A 4AZIA 3W28A 3AS3A 3ZIZA 2GK1B 1QI0A 3AIUA 3M07A 1KB3A 3WBAA 3VNZA 1EDQA 3RMEA 1HIZA 4D6IA 3PZIA 1MXGA 4P7QA 2BXYA 4OBRA 4AY1A 4UFMA 3SCRA 1UKOA 3T09A 3QHOA 1AQ0A 1DWFM 3VX0A 4AZ5A 3SUSA 5I6SA 3TOPA 4AIUA 4GQQA 4XZBA 2X0YA 4CN4A 2DSVA 4JHZA 1EGUA 2DH3A 1GQJA 4NZCA 4J27A 2V5DA 1VIWA 4ATLA 4JFVA 1E70M 2F61A 4KGLA 1E5NA 4FF5A 1JNEA 2BXZA 1ISYA 3ZJKA 2J7BA 1QHZA 2WMGA 3BAXA 2EJ1A 3CZKA 3IK2A 3KL5A 2J7EA 1VJZA 4UOQA 2ZX8A 4OIFA 2G3MA 3HMCA 5HBFA 4V27A 1W1PA 2Y2WA 3DHPA 2WSKA 2VVSA 1B9ZA 1HKIA 1EA9C 5LYRA 3DC0A 1JL8A 4CD6A 1PIFA 1OD8A 3VM7A 1J01A 4AIOA 3TA9A 3ARXA 4PMUA 5AYBA 2CERA 2ZWZA 5DT5A 1M03A 3WUGA 1N7RA 4NRRA 4PMYA 4LPCA 1C8XA 3GBDA 4UFKA 2JFEX 1W1TA 3W4RA 3B8SA 3F4VA 1UG6A 4J3SA 3AZRA 3G6LA 1K9DA 2VZUA 4JFTA 1UKPA 3HJEA 5DO8A 4UR9A 2WVVB 3DECA 1C82A 3PZ9A 1VFMA 4HTYA 4B9YA 2ZUSA 3W37A 2VR4A 3AIWA 2GSJA 4U2ZA 4DM1A 2WANA 4QAWA 2D20A 2J8GA 5E0CA 1GNXA 3TTSA 2GK1A 2Y24A 1QI3A 1K6AA 1GVYA 1CPUA 1QPKA 1RH9A 3B9EA 1WDSA 1AMYA 2V3GA 4R27A 3CMGA 4PMQA 3WD2A 2WMFA 4OZOA 3VGEA 4AXNA 1GZJA 1H1NA 4HZ6A 1GVIA 2RGLA 1E4NA 1LL7A 3MMUA 3WF0A 1UH2A 2YLAA 4JFSA 3CBWA 5GNYA 4Z2IA 1TVNA 1RP8A 1X6LA 1FFRA 2HISA 1QBAA 4DWSC 4XZWA 4PUEA 1EOKA 1E40A 3VDHA 1B1YA 4QLKA 1D3CA 5IDIA 3W26A 5JBEA 1SR0A 4MB3A 1HMWA 4TVUA 3W6MA 4UFLA 1QHOA 1TR1A 5I0DA 1HKMA 1P6WA 1TA3B 5D8WA 3SCNA 4Z2KA 3VDCA 4D1JA 3A4AA 3AS2A 4X0VA 3QHNA 1MW3A 3CGTA 4J3VA 3CZ8A 3AS0A 4AEEA 2GJRA 2WC4A 4H41A 1UQZA 3LPPA 2EBNA 2PWDA 2PWEA 1SYTA 4MB5A 1Q6EA 4TX8A 3CUJA 2ZUNA 1TFVA 4KGJA 4AD5A 3N15A 5CSYA 2BV9A 3G6MA 3MUZ1 3AXIA 3O2LA 1MW0A 4HA4A 3PN8A 1GHSA 3TONA 1B0IA 2A3HA 1NWTA 4MNLA 2AAAA 3PTMA 3BMWA 1HKJA 1WZLA 3GYCA 3CHDA 4MB1A 1CGYA 3ARQA 1BGAA 4LQ1A 5E70A 1XHGA 3KL3A 2O9OA 3GNPA 1UWUA 1WDPA 1RPKA 5A6BD 4PYSA 1LL4A 4JL2A 1VEOA 3NSXA 1JIBA 1K9FA 4IPNB 1LXMA 1E71M 3B9DA 2A3EA 2ZXAA 7TAAA 5IXEA 4UNIA 3AHXA 1GHRA 4YN5A 3RM9A 3WIJA 1JYXA 2DSZA 4PSRA 2Y8KA 1R86A 1GOWA 2GDVA 2YDSA 3WNLA 4AD1A 1TZ7A 3OB8A 2V3EA 4W93A 3WN6A 1C3FA 1ISXA 2EEXA 3AZTA 2YDQA 1HN1A 1KGUA 1WDQA 2BY1A 1NH6A 1GONA 2E24A 2CBUA 2WXDM 4W85A 1MFVA 3I3EA 1KFWA 2VX7A 1QI5A 4DWSB 1J0KA 1AQHA 4ZXOA 5CJ5A 5A94A 3MMDA 3VDAA 3KL0A 2D3NA 2E22A 1PAMA 1E9LA 1KBBA 1VB9A 4GIAA 2DH2A 1LWJA 2O92A 2ESCA 1EQCA 4GI6A 3OBAA 2F2HA 1V3JA 2YDRA 2E8YA 1XH1A 3GXIA 4JKMA 1VBRA 1ESWA 3T0DA 2WZHA 3RJXA 4XUYA 2ZICA 1QVBA 5I79A 1Q4NX 1JD7A 1BTCA 4Y7EA 2ZX9A 2Q1FA 1BGGA 5CLTA 1C8YA 1E0XA 4UZUA 2CESA 4WSJA 1XCWA 4MPKA 4D6DA 2QPUA 1KBKA 1UZ4A 3EMQA 1HP4A 4W88A 3ARVA 5A6KA 4ACZA 5JIPA 3IAPA 2VR5A 1E1EA 4B3LA 5M03A 3VIFA 1DWIM 5BRQA 3WDHA 4FLRA 3OGRA 5IFTA 2OWXA 2VC9A 1WAWA 5JUVA 1HT6A 3GDBA 1BVZA 1H41A 4X9YA 4XX6A 3UR7A 4DUXA 2IXUA 4MJ4A 1X6NA 3VMOA 1UR9A 1CECA 4AZCA 2X09A 2QPSA 3WDJA 5JIWA 1TVPA 1NWRA 3VVGA 3UG4A 1JYNA 3GM8A 4HPGA 3CHCA 3VGFA 4U5IA 1W3HA 2IUZA 2G3IA 2OSXA 1OJPA 3DYPA 2PBGA 3VINA 4BF7A 4UCFA 4H8UA 2VL4A 3SCTA 3W24A 3BLPX 1NP2A 2VRKA 2VVNA 2UY2A 2YL9A 1KR0A 5DMYA 5A6JA 2ZX6A 3AHYA 4QDMA 2WHLA 4D6CA 2ZUUA 4E4PA 1W2PA 4M82A 1J0YA 2J77A 3WQ8A 3SCSA 1Y7VA 4BQ3A 4AYSA 1UR0A 3FN9A 2UY3A 4P7LA 1WDRA 4JKKA 5I2UA 3NUKA 1ZBVA 2CBJA 3CIVA 4M1RA 3CMJA 1XD0A 3PZGA 3VILA 4IUGA 1E6XM 1EHAA 1BF2A 1HKKA 2ZXQA 1VF8A 1XYZA 2XGIA 2QV4A 1E3XA 3WEOA 4GZJA 1G01A 1RWAA 3ARRA 1E5JA 2EPLX 4LYQA 2CBVA 1LF1A 2WBGA 4K68A 3IJ8A 4MJ2A 5A8QA 5ABGA 1BFNA 1GCYA 3CZEA 1DTUA 1WKYA 1J18A 1F4HA 4A3YA 4MB4A 3WQWA 1E6NA 1VEMA 5ABHA 2WCOA 3N9KA 1G5AA 4JCLA 3WF1A 1E73M 2CBIA 1OCQA 2V5CA 2HVMA 4PMXA 5CGTA 2WHMA 3M7SA 4EANA 4UQ9A 4LX4A 3VD9A 3CTTA 3BMVA 1ZBCA 4UQCA 1Z32X 4A4AA 5A6SA 1UKQA 4MAVA 1UUQA 1GPFA 1B31A 1KR1A 1IT0A 3MUAA 1HJWA 3VGBA 1V3MA 4AWEA 4J3XA 7A3HA 4CD8A 2X8RA 1FH9A 1KWGA 2D23A 2J7CA 1QNPA 1M04A 3AIQA 5LA0A 1OIMA 1W2VA 1CIUA 3MU7A 4J7RA 4D71A 2CYGA 3SCUA 3WQ5A 1KXTA 3POCA 1GORA 4N42A 1CZ1A 3VIMA 2WHKA 3GNOA 1J0NA 2OLHA 2W63A 3OIHA 3WBEA 4U33A 4HZ8A 1BG4A 2WB5A 5BXPA 5D4YA 1RWCA 1MXDA 4MNJA 2BRWA 1FH7A 4UQBA 2EPNA 5A6BA 5D8ZA 1UZ1A 3SUWA 3QOKA 3FAXA 3PBGA 4MTVA 3VNYA 4UZSA 2XTKA 3GBEA 4YPJA 1PPIA 4OKDA 3ZMRA 2WCSA 1WB0A 2VCBA 4J3TA 4ATDA 4OOZA 2VNCA 3FXYA 1HNYA 5A8NA 2XWDA 1CXEA 2E40A 1LQ0A 3EDKA 3SUTA 3A6OA 1XGZA 4P8UA 1O6IA 3BAIA 3L4ZA 1V08A 3IANA 1UR1A 4MNMA 2JF7A 2XPKA 3VO0A 3A3HA 4CU6A 1IV8A 5CPQA 2TAAA 3NYDA 4M8UA 1ISWA 4BA0A 3VIOA 4GZEA 1DHKA 2WLZA 1JF6A 1XRVA 1CYGA 1JGIA 1M01A 1HJXA 3MS8A 1G1YA 3AIEA 3VMPA 3KE0A 4JFWA 1VRXA 3SCPA 1R85A 3NSNA 1CEOA 2ZUWA 4JFUA 2YA2A 2ZUTA 4NI3A 4AZ7A 5BYWA 2BY2A 1OBAA 3HU7A 1V3LA 1NM9A 1W9DM 3ZOAA 4GO8A 1HM2A 2PWGA 3BCDA 3RO8A 4WJXA 3WD1A 5E6YA 1FA2A 4HOWA 1JYWA 3O9NA 1ZU8A 1W3KA 4P8XA 1FH8A 2XUCA 1C7TA 1JNDA 2J75A 3II1A 1CGUA 3GXFA 3A4WA 3W25A 3AMKA 3L4WA 1XC6A 4DWSA 3S2CA 5HPOA 1QNQA 2E3ZA 1WE5A 1H49A 1FHDA 1F9GA 1HJSA 2F8QA 4U31A 3CO4A 1GQIA 4AZHA 2MANA 5I5RA 4M24A 4PEEA 4B9ZA 4GINA 4NSBA 3WDRA 1FP8A 4PMDA 3NCOA 3PZMA 3OZOA 3CHFA 1V3KA 2FH6A 2FHFA 2JE8A 4FK9A 1AVAA 4W5ZA 1B3WA 4HOZA 5BCAA 1JAEA 4WIWA 8A3HA 2DIEA 4YHGA 2BHYA 3I3BA 1ITXA 3N13A 1CXHA 4U3AA 4CCDA 3UERA 2Z1KA 1F4AA 2VX6A 1OT1A 3WD0A 2VRQA 4HZ7A 2X2YA 1KGXA 3BAYA 1ZBKA 5HXMA 3ARUA 3ZM8A 1UWSA 1H09A 1XSJA 2J4GA 4V2XA 3RILA 4EE9A 2OYMA 2C0HA 4B16A 2X03A 1G94A 1E43A 1JFHA 1UR4A 3D5HA 5DT7A 5EFFA 4W86A 2VCAA 2J62A 4PTVA 1FP9A 1G0CA 1CXIA 4WKHA 4LGXA 3MV01 5A2AA 1DWAM 3WL1A 4F79A 3WQVA 2BRVX 4AMCA 1RD6A 1W3LA 3OLEA 1UWRA 1HJQA 1MW2A 4ZXLA 4HPHA 1BYDA 1E72M 1C92A 1HJUA 3W82A 4H2CA 3BAJA 3L2MA 3AHTA 3CUGA 4F66A 2WYSA 4CD7A 1GOQA 1CDGA 3UESA 3W38A 4PBGA 2FDMA 4BQ5A 1BSIA 1TA3A 2XVKA 3WH6A 5ECUA 2XIIA 5BWFA 4AD0A 2EXOA 3BXWA 3IJ7A 2WZEA 2BY3A 3CUFA 4UOJA 1WP6A 4FLQA 2VQTA 2XFRA 5M17A 5E09A 3ZT7A 2ZUMA 3ECQA 3PZQA 3THDA 3POHA 2XM1A 3W81A 1A47A 3N1AA 3AQUA 1G9HA 4GXPA 5FL0A 1WZAA 4W7WA 1M53A 5FCZA 3L2LA 1NOWA 1LXKA 1V3HA 4MADA 4U3CA 1GUVA 1N82A 1E6RA 1H3GA 3WDPP 5FD0A 1CTNA 3PTQA 3WMBA 4MDOA 1WCGA 2EPKX 4TTGA 2WVVA 5I3DA 3T2OA 2WMHA 3VGHA 2YIHA 4AC1X 1E6QM 2CEQA 2VI0A 4TTUA 5AY7A 2XHYA 2WKLA 4ML4A 1XV8A 3VIJA 1H0IA 2GFTA 4GI8A 2YA0A 4QP0A 1MYRA 2GJXB 3PTKA 3WSUA 2G3JA 2DSUA 1VAHA 1J0ZA 4TVDA 4W5UA 3BH4A 3B9AA 3GH4A 3EDFA 2FHCA 2UY4A 3AISA 4W8AA 1C93A 1BPLB 1S46A 3WUEA 3WEZA 3VU2A 1JYVA 4JHOA 2W5FA 2FGZA 3OLDA 5M3WA 5I23A 1V0MA 2B31A 5ABEA 1W9VA 5GNZA 3K8LA 4GQRA 4V28A 9CGTA 4AD2A 2X05A 2PBOA 1Q6CA 4AZGA 1LG2A 1V0LA 1EOMA 4RL3A 3WF2A 1UR2A 2WNWA 1K9TA 2ZWYA 1CLXA 4P8VA 4Q22A 3TTQA 4E8CA 1XCXA 2W91A 5CQ1A 1BLIA 1H0GA 1KGWA 2E8ZA 3MKKA 4AD4A 3T0BA 4JL1A 3T08A 1R8LA 1U33A 1W1YA 3AIRA 1BAGA 1D2KA 1UA7A 1H11A 3TP4A 3GXDA 1E4IA 4ACYA 2BNJA 4ATWA 3A4XA 2BVTA 3AS1A 2XIBA 4S3JA 4D6GA 2XM2A 2E9LA 4JZ5A 3VDBA 1CGWA 1OINA 4JAWA 3VKKA 4HU0A 4TXEA 2J7DA 5BXTA 1TE1A 4LXFA 1X1HA 3ZSSA 1JXJA 2CKRA 4UQDA 3WF3A 2WAGA 4W8LA 3FAWA 2UWFA 5CZKA 3OLIA 3PHAA 1KQZA 2GVYA 5GPRA 1KCLA 3RJYA 2A3BA 1MFUA 4H04A 4AW7A 1HXJA 1EXPA 1NOFA 4W8BA 1J10A 1D7FA 1E55A 5A95A 1JDAA 3ALFA 4PMVA 3WENA 1LG1A 1QNSA 3ZQ9A 3UG3A 3MO4A 2X1IA 3GNRA 1BYAA 3MMWA 2VURA 2XWEA 1VENA 1ECEA 4KRTA 4GKLA 5FOOA 3WNNA 1I1WA 3SCQA 2UY5A 2CKSA 1V0NA 5CXPA 1HL9A 3WEMA 1MQRA 5CGMA 1VFUA 2QMKA 4FMVA 8CGTA 1WNOA 1EDTA 1GW1A 2VUYA 3N11A 1E15A 1UD8A 1OGBA 2W62A 1QW8A 1DWHM 1NWUA 3UR8A 4D6JA 3FNDA 3AMDA 2J78A 3KEHA 1V6XA 3VTRA 2ZUVA 1UD4A 2WC3A 1B90A 1ISVA 1K9EA 3AXHA 3WMSA 2V3FA 4DUVA 3RM8A 2CETA 1X1NA 1JFXA 3MANA 3FHAA 4PTWA
chains in the Genus database with same CATH superfamily
3GG0A 4BEUA 4QTGA 1FKXA 3TSMA 3W27A 1T5AA 3NQDA 5LNWA 3BLDA 3TXVA 4MUZA 1PEZA 4UTWA 5XIMA 1X98A 3WQFA 2GWNA 2VXNA 2D2OA 3FV9A 1E4LA 4ENLA 1JRBA 2FZBA 5KZEA 3OQEA 3A23A 3APGA 1UWAA 5K2ZA 2YKKA 1VFOA 4AZ6A 5TD4A 1RQEA 4ZOEA 1JAKA 4BI6A 4AWUA 5AC5A 3CS2A 2NQHA 3IV8A 3OEXA 3BSHA 2BX7A 4PRWA 3NPUA 4H19A 4HYVA 1GGOA 3NOYA 3RCNA 4QNWA 5A69A 3TC7A 4JX4A 4EVZA 4JCMA 3LTPA 2ZTKA 3VOCA 4NAEA 3WYZA 4JQ3A 5D2WA 1CBGA 3BAWA 1JI2A 2PZ0A 3AMLA 4A2RA 3QBUA 4J40A 3T0AA 3SAZA 2Y4SA 4CKQA 2V6AA 3LHWA 4ZE5A 2DUXA 2VFIA 3M46A 1DE6A 1UP3A 2GQAA 1AJZA 5A2CA 1IZJA 4GK8A 4KWVA 1KV8A 2W61A 3PJUA 5HJYA 1Q5MA 2Z1SA 4DBEA 2QEZA 1QCWA 2YL6A 5HJLA 3CB8A 3TR2A 1HGWA 1TTIA 1OFQA 3NO1A 1B3ZA 3VE7A 1KCKA 4EX4A 4N0RA 2AMGA 3PZTA 3DI0A 4D1IA 3C2EA 4KF1A 1SJCA 3K8KA 4JD4A 2Q3OA 3BLFA 3E0FA 3MTWA 3KOFA 3L23A 1TUXA 4PSPA 3E1F1 3VYLA 3HPXA 3AZSA 5DF0A 3QOMA 3MO7A 4O0KA 4XB3A 2AL1A 4C6DA 2WNNA 3LS9A 3XINA 3MYPA 3LMYA 2DUAA 3PZUA 1E9ZB 2AKMA 3NZ1A 2YL8A 4PMOA 4IPPA 3TUUA 3S1VA 4O11A 3KHJA 5DRCA 1F3TA 2GVJA 2WOQA 4WSHA 1A0DA 1I2NA 4N9EA 4HK7A 2G97A 1QBBA 3IVTA 1OFEA 1ZBWA 3E6EA 5DEZA 2XH2A 4DJED 4AHPA 1Q6DA 3QXBA 4S23A 4C7DA 2YYTA 4DYJA 4LCSA 1KBIA 1ADOA 3KP1A 1VD6A 3CU2A 5HK4A 4D6EA 3BK0A 3PUDA 2DT0A 1C90A 1E0WA 3EMCA 1HL8A 2Y85A 5LA2A 2I1OA 2Y5JA 5EFDA 2WVTA 3UW6A 1XUZA 1BHGA 3LCHA 4NJJA 5LIWX 3IGUA 3VIKA 4UQAA 4DPQA 2I7GA 5I02A 2EGZA 1TYGA 1TMQA 4PH6A 2Z7GA 2XVNA 2TODA 5C8BB 2ACUA 1H2JA 3OTRA 1KLZA 1EIXA 5EMYA 3BZJA 3ZO9A 3AIBA 2WV8A 3S46A 1HMUA 2YPIA 1KQYA 3UXDA 5FF7A 2QUUA 1Z8AA 5KZ6A 2PTYA 3O7UA 2XFYA 3H53A 2FH8A 1OC7A 1SGJA 1N7QA 1E6SM 2YJQA 1J9YA 3MUY1 3BO9A 3CQHA 2HXUA 4GNVA 4HNTA 1UD5A 2PODA 2DQXA 1ALDA 3W53A 6XIAA 2BRPA 3XISA 4HBKA 1OCJA 4HNCA 1RLCL 3RR1A 4AQLA 3IGXA 1Q63A 4L6DA 4MLJA 4K6AA 4MM1A 1F6PA 1SUXA 4JBRA 4BY3A 3NZRA 2Q01A 2A7RA 2EHHA 3MB9A 5D2TA 4F4RA 3T05A 1LQ2A 1X8CA 3RPMA 1BWVA 1XLCA 4PMRA 5EMUA 4GABA 3MZNA 1W9PA 2XG9A 4TUFA 1UUOA 4WR3A 2ZOXA 2VDIA 3F5JA 5RUBA 1QMLA 2PD9A 3JZUA 2CCRA 1KKRA 3KM8A 3BZGA 3IIPA 2DZWA 2P0OA 3SIZA 4UC5A 3SEPA 3TOYA 1BG9A 3P3BA 1BVWA 3MCOA 2PZNA 4N6EA 2D69A 2VZOA 5SWUA 4Z1YA 3OG2A 2E09A 1PZ1A 4YWIA 1G4PA 2WWDA 1Q6GA 3QRHA 4DAIA 1MQPA 4L4MA 1DQUA 3U5UA 5I3FA 2ISVA 3M5XA 2FLIA 1DE5A 3MJYA 3ITOA 4C1KA 3QLDA 2PTXA 1UBSA 1GJUA 1XYBA 3SN0A 4DXVA 3UXIA 4HP5A 4KH2A 1U83A 3KCJA 3UPWA 1Q66A 2OLAA 2ALDA 3NPVA 3WQEA 2QF7A 4Z0JA 1O5XA 3MHGA 4E8GA 2CWNA 1QPNA 1HVQA 3T81A 2O7SA 1XFCA 2OTDA 1AW2A 4H8VA 4PODA 2YCJA 2VC7A 1ZJIA 5D9NA 4HMCA 2IQ0A 5JBDA 4I7WA 5DMLA 3MQTA 4ZQCA 1KM6A 1RBOB 4NJHA 5CSUA 3T07A 3QV7A 3EBVA 2E6AA 2QMJA 3AYTA 1GPWA 2BSLA 3VOGA 1KBLA 2NT0A 3LI0A 2V30A 1ZB5A 1OABA 2ZE0A 4L4OA 4QEEA 2I56A 5C9ZA 1UB3A 3LRMA 5D30A 2ACRA 1KXQA 1VKFA 3V0SA 1PKNA 4HMEA 3CLWA 4N6FA 3UVIA 1ODUA 1W1VA 3SR7A 1XX1A 1QDSA 2QDDA 1OFRA 5K9XA 3CL6A 3ANYA 1Z41A 3M0LA 4L6HA 2YBVA 2WDAA 2FB3A 1V77A 1LT7A 3K4WA 4M51A 1OM0A 2RDXA 2Q8XA 1LL6A 3LOTA 2PDQA 3EA3A 1MWOA 1VZWA 1CNVA 3NSMA 4O1CA 4I5RA 3ZLFA 3BLKA 4ZQPA 1UYQA 1M7PA 4GOAA 1P48A 3GH5A 3ZR5A 1DHPA 2P5NA 1UMYA 3JUGA 2JIWA 2NT1A 3RPDA 3EWBX 1UPMB 4JTIA 5BXRA 3M0MA 3O8AA 4LC8A 3SUVA 1K3UA 1BRLA 2ZZ5A 2E9MA 1F61A 5K9DA 3NM3A 1PKYA 1V0KA 2Y5EA 4XSLA 3EZ4A 4ROQA 1LOHA 4HKPA 3M9YA 3VD7A 5JXQA 1K7EA 5J8LA 4E2BA 4KIEA 3LRKA 3TIMA 3B8DA 2NLYA 2R91A 4IG2A 4DJFC 4J2MA 2YXOA 1XRTA 5CG7A 1H7XA 3A24A 2QULA 2ZRWA 1POKA 4NAFB 5CBBA 1AFSA 4QIUA 4URIA 2MNRA 1WKDA 1ENUA 2G95A 3RAOA 3ERPA 2OKOA 1WDWA 1IXOA 1LROA 3GDRA 3BOFA 4K8GA 2QCDB 3RLGA 1J0HA 3VNKA 2QF8A 2VMFA 2YBTA 3NDOA 1X39A 1ZP3A 2RJGA 3GU1A 4D72A 3E3HA 4J3UA 2WMIA 1GTHA 1HUVA 2DFAA 1LLOA 3FEQA 2H8ZA 2BASA 1V7YA 4FOJA 3UWWA 1JZ5A 1QHPA 4CD4A 4F0HA 4C7FA 4UOZA 3B03A 4D6HA 1SW0A 2ZZ6A 1FOBA 4HHLA 4QS5A 4RUBA 1ZJBA 4GE8A 1HVXA 4Q8VA 3S47A 4MF4A 1YQ2A 2Y7FA 1CX9A 2FHBA 4TU1A 4I3GA 3L4UA 1VIZA 1AH0A 2RKXA 2WVSA 3HGSA 4H00A 4ZO6A 4LAUA 4CQ8A 3ONCA 3GC4A 3MP3A 1UMLA 1UROA 2J7GA 4GX8A 2CZVA 4KEZA 1XYFA 4PTXA 3EEGA 3ZJ8A 1V6WA 1XW8A 2AOSA 4JTFA 3R7MA 4ZB2A 1EGZA 4XIAA 3N2XA 1J0JA 4S38A 2IXVA 1W3TA 2J9ZA 3FJNA 1PKMA 3WH9A 4W4QA 5EYWA 4PRRA 1ZL1A 3WFLA 1BVNP 4DO6A 2WO5A 1JD9A 2ZADA 4CUCA 1GOOA 1UWIA 4P61A 1EO7A 1YDYA 2CZ5A 1XDJA 4QSHA 3GFXA 1IEQA 4IGNA 2IPFA 2PD5A 3TYUA 4B5NA 2PC4A 3LM3A 3QHMA 5D9MA 1QI4A 2OMAA 3ARTA 1ZHAA 1EHNA 3B06A 3BV4A 3FHQA 4CCEA 3EWYA 4AISA 4U2YA 5TF0A 4GIEA 2ZE3A 3A13A 3PAOA 3R6IA 3NQGA 1KFBA 3P7YA 1GEQA 2QHAA 2CNCA 3L0KA 1REQB 1LJYA 4UTUA 1F1SA 1JG9A 2ANUA 3FY1A 4O8RA 3TFXA 1AJ0A 3V7PA 5GQBA 4W7UA 1ZP4A 5IFPA 1K6WA 1J0IA 4CVWA 4A3HA 2VDHA 3CAQA 4K8HA 3KVJA 3GTNA 4B15A 2VT0A 1F05A 1DWJM 4UFHA 2PDPA 4AEOA 2QJMA 1T41A 2WBKA 3BGAA 1WXJA 3SY1A 4FNUA 4CQCA 3ARWA 3USBA 3GVWA 3AHVA 2PTZA 1VYRA 5M2FX 2OGJA 4RE4A 1FDJA 4DJDD 3VZYA 1OVDA 5H8MA 3VNZA 3RLHA 1TUFA 1R3VA 4D6IA 5FEPA 3OHIA 1CW2A 4V1YA 4O14A 2BXYA 1R3RA 4OBRA 5E5CA 3FK4A 4ZODA 2A4AA 2DY3A 3QHOA 3HGOA 1DWFM 3VX0A 4AZ5A 4UTIA 3TOPA 3P80A 4RW3A 4AIUA 1P0BA 3U4AA 3TFCA 1EGUA 3STGA 1GQJA 4J27A 1BQGA 3W7NA 2ISWA 3EGJA 4ATLA 1OYBA 3R1ZA 1E5NA 4FF5A 3WK3A 1ISYA 5LXXA 1EL3A 2J7BA 1QHZA 4AVOA 3W7OA 3CASA 3W7DA 1IEWA 3TV8A 1TCDA 1AMKA 2OZ0A 3M0VA 4V27A 1RD5A 5EMMA 2C15A 2ACSA 2VVSA 4RPPA 1HKIA 4K7VA 4WX2A 3EKZA 3QF0A 4HA0A 1OCNA 4YTTA 1Q65A 4JTJA 2PTDA 3ARXA 3VKJA 1AZ1A 1R47A 5AYBA 3GVRA 5BRBA 1TJ0A 2CZDA 3M5YA 4QQUA 1QU4A 4UTKA 4G2DA 5XINA 4F2TA 3M0HA 3IVSA 4M7SA 1XIFA 4Q4QA 3B8SA 2CWXA 1X97A 1KCZA 2QYGA 1UG6A 4O1DA 3BQ5A 4R34A 2VZUA 3HJEA 2WVVB 3S6OA 3PZ9A 1VFMA 4HTYA 3W37A 2VR4A 3W01A 1T40A 3UD6A 3UR2A 4QAWA 2J8GA 1GNXA 2CLPA 3TTSA 5AHIA 1VGAA 2ABAA 2GK1A 4DB7A 1B4KA 2V5BA 1XLGA 4K8EA 5EBUA 4OZOA 3PSWA 1A5SA 3VGEA 2HV5A 1GZJA 1H1NA 4HZ6A 5J04A 4DO4A 5GNYA 1UH2A 4H7ZA 3V18A 3DN5A 1RP8A 2OX4A 3P5YA 1FFRA 2HISA 2XIJA 1QBAA 4DWSC 4XZWA 1EJXC 1A5LC 3DFYA 2OELA 4JIHA 1IWBA 3W26A 1SR0A 1QPQA 4MB3A 1HMWA 3GR8A 1TTPA 3IJDA 3EXTA 3LV5A 5I0DA 5CJMA 4G7EA 4FZIA 2JK2A 4KW2A 1SQ7A 4E2VA 3LQGA 3SCNA 1R9YA 4D1JA 5AHEA 3Q4DA 1NELA 3R0KA 2RAGA 3ABQA 9RUBA 3NZPA 2WC4A 2A3LA 3C8FA 3KRUA 4JN7A 1UQZA 2EBNA 3KP0A 4YVXA 1G7VA 4C6BA 3MPGA 3LLFA 4NX5A 4ECLA 4MKNA 2HQAA 5CSYA 5CZTA 3MUZ1 4NHVA 5CAKA 2J66A 3GXTA 2A3HA 2VFFA 5DY3A 2PLCA 1CGYA 2J24A 2RJHA 3VUSA 1XHGA 4GQGA 2O9OA 3GNPA 1A4MA 4O0ZA 4C65A 1WDPA 4JL2A 1B54A 1LXMA 1SFLA 3B9DA 4TR9A 5D03A 7TAAA 5IXEA 3SFWA 4UNIA 3AHXA 1GHRA 3RM9A 1M7JA 4LEQA 2PDCA 3B3DA 2Y8KA 2PLKA 2GDVA 4XQ6A 3WN6A 3LGDA 3VOFA 1ISXA 4ZO7A 2YXXA 4X60A 4YU1A 2E24A 4DYKA 1YNYA 2CBUA 2WXDM 4W85A 1KFWA 1ZQ5A 1QI5A 4DWSB 4LVAA 4XAPA 4RNIA 2QAFA 1AQHA 1QPRA 3MMDA 5HMSA 3TEVA 5CPMA 1J8VA 3B0UX 1V5XA 1IR2A 1K4GA 2DH2A 3DG3A 3HPAA 4GI6A 2F2HA 2QJHA 3KOZA 1OX4A 1MNSA 4DLQA 3GXIA 2ZVRA 2WZHA 3RF9A 1P0KA 3R4IA 2ZICA 4V1XA 1S5MA 5I79A 5E1QA 3MZ2A 5EKYA 2Q1FA 1SO5A 4MPKA 4NZ3A 5E0KA 4WDTA 3KTXA 3WLLA 5CBJA 3ARVA 5JIPA 2V68A 3DBPA 4X63A 4JQ2A 3HURA 1OYCA 3M0XA 2OWXA 3QZ6A 2VC9A 1U22A 3EPNA 4IX2A 3EWUA 2V69A 2A2IA 3VNDA 4XX6A 3SW6A 3UR7A 3WCZA 2IXUA 3HTWA 3VA8A 4MJ4A 2OCZA 1IXPA 3G1DA 1ADDA 3HPFA 4HSHA 4LTSA 1I2QA 3G1HA 1CECA 3IJLA 3NEVA 1W1IE 3PWGA 4AY7A 3WDJA 3BGJA 3NO5A 5AC6A 5I3JA 3WLIA 1NWRA 3VVGA 3UG4A 5CBIA 1E1CB 4U5IA 5ECVA 1QK2A 4HNVA 4PL2A 3H22A 1OJPA 3VINA 2PBGA 7PTDA 2OVLA 4UCFA 1KRMA 4H8UA 3N6JA 1J6OA 1OZMA 2VL4A 3SCTA 3BLPX 2VRKA 1EJVC 2UY2A 4XAGA 1PCKA 3ITTA 2ZX6A 4QDMA 3IARA 4D6CA 2ZUUA 1W2PA 4M82A 2BWGA 1K4HA 3WJZA 3SCSA 3WQPA 1FVPA 2PGFA 1LOLA 3W1LA 4H01A 3FN9A 3DFPA 5I2UA 1VBGA 2CBJA 2Z4GA 3CIVA 2PDIA 3CMJA 1XD0A 2O56A 1ME9A 1ZAJA 3L67A 5BU9A 2ZXQA 1VF8A 4Z08A 2HPMA 1E3XA 2HXTA 1E5JA 3D46A 2ZKMX 2D73A 3UY8A 2WBGA 3SSZA 4K68A 3W7LA 1BFNA 5E93A 1WKYA 1F4HA 1NDYA 4G7FA 4MB4A 4A3YA 3G24A 2INEA 4PCNA 1Q3NA 2QCEA 1VEMA 2F38A 2WQPA 3HO8A 4PMJA 3N9KA 1G5AA 2WJZA 3WF1A 5HQLA 4B92A 1TPDA 1E73M 4UIOA 3DHDA 1QW7A 2D2HA 1F8IA 3UPBA 3BMVA 4BF5A 2PCQA 4DJDC 2Z0IA 6REQA 1GVRA 4DHGA 4KFNA 4B2DD 3TNOA 1KR1A 4HNLA 1WYIA 1V3MA 4FF7A 3S1GA 1FH9A 2D23A 4F48A 2J7CA 3LHUA 4IF2A 1TJRA 4R7JA 5LA0A 1OIMA 4JTAA 3HQNA 2GOKA 3MU7A 3S2NA 1W56A 2CYGA 3WQ5A 1GYNA 3POCA 4QJ1A 2R1PA 2WHKA 1J0NA 4I6KA 3WBEA 3LX9A 5BXPA 5D4YA 1RQHA 5A6BA 3EEZA 1UZ1A 2G5WA 1UUMA 3JU2A 2GGJA 4MTVA 3G0XA 3LBCA 4UZSA 4JTCA 4YPJA 4OKDA 2WCSA 2BOEX 5AZ1A 4DBWA 3ZR4A 1L2QA 3AO0A 3U4FA 5D02A 2I17A 2VNCA 1U1HA 2OOFA 3FXYA 5A8NA 2BZNA 4YS1A 2E40A 1LQ0A 1IIGA 2EKCA 1N8WA 3IANA 3I10A 2JF7A 2XPKA 5G2HA 4AVNA 3H70A 2YCEA 3A64A 3OBEA 2VELA 1D7KA 4TX9A 2WLZA 1WV2A 2DP3A 1JF6A 5L9FA 3EX1A 3AAMA 3AIEA 3HA1A 4LRTA 3PF3A 1XS2A 2XN0A 4PUUA 3SCPA 2O0TA 1QWGA 4JFUA 3B8TA 2ZUTA 1KM1A 3M4HA 3OA3A 4RZBA 1V3LA 1XISA 1HM2A 4DVOA 4Q8TA 1WKEA 3FX4A 3G22A 3H7VA 3CV2A 2J75A 3II1A 1ITUA 3PBWA 3QLLA 3IWPA 3ISIX 3A4WA 4FO4A 3O15A 1QNQA 1JUKA 3V4BA 4WDWA 2E28A 2IMRA 1UIPA 1AD1A 3E5BA 3PWAA 3CO4A 1GQIA 2MANA 1NIUA 4M24A 3TC3A 4B9ZA 1DXEA 4DNHA 3P60A 3D3FA 3CHFA 3W70A 2FHFA 3L65A 1WUEA 4W5ZA 4ORMA 2D2GA 1JAEA 3B40A 3MY9A 4JYDA 4LH8A 2DIEA 4YHGA 2BHYA 4JTDA 4GVHA 4Q4MA 2EG7A 3KHDA 2QDHA 3DBNA 1I0DA 1IEIA 2E5CA 5FJTA 5GJMA 1F4AA 2VX6A 1I60A 4EPEC 1SSGA 3WD0A 1H63A 4KWOA 3EXSA 1XQLA 1W5OA 2FZDA 1ZBKA 4ZOCA 3BGGA 1FWCC 1XSJA 2OYMA 2C0HA 4B16A 1W17A 3GDMA 1EWEA 5L6UA 3GLCA 1UR4A 5DT7A 4LAOA 4K36A 2AL2B 1ZAHA 4WD0A 5FESA 1KM5A 1I2PA 4W86A 2VCAA 3R79A 4PTVA 4ILSA 1G0CA 1CXIA 4WKHA 1S1PA 4LGXA 3MV01 1JCYA 3N25A 1FWSA 1DWAM 2W0UA 3WJSA 2R82A 4F79A 2GWGA 4AMCA 4JS3A 4CNUA 1UWRA 1HJQA 4E4FA 1SZNA 1E72M 4DUOA 1L6GA 3LGGA 4IUOA 3L2MA 4F66A 2WYSA 4PBGA 2FDMA 1U1JA 4BQ5A 2IKIA 1QPOA 3G1SA 2WPBA 2FVMA 4IXHA 2WZEA 4UMBA 3SGGA 4UOJA 4DIAA 4AX7A 4IJRA 1WP6A 4FLQA 2QKFA 4O19A 2ZUMA 2E6YA 3ECQA 1P1MA 4NX0A 2H8XA 1A47A 3WQCA 3GKFA 3AQUA 5EPDA 1G9HA 4FOKA 4FNRA 3P81A 1OF8A 5FL0A 2YZ5A 1WZAA 2XZ7A 5KETA 4IMFA 3ZVIA 3DXIA 5FCZA 2I5QA 3CIWA 4X9SA 1LXKA 1P5BA 1V3HA 4P5UA 4MADA 4MY1A 1E6RA 3M16A 3LERA 4GIRA 1CTNA 1PDZA 3LK6A 3BL3A 3BJFA 4QRNA 4PUKA 1AL8A 4XIMA 2CEQA 5AY7A 1UR3M 2XHYA 4ML4A 1XV8A 1H0IA 4UTHA 1Q85A 4O1FA 3W7EA 3WSUA 4LEFA 3NO3A 1QRQA 3CTLA 3EDFA 4R9OA 3W2UA 2FHCA 5DBUA 3AISA 1S46A 3WUEA 2OX1A 2FGZA 5I23A 5ABEA 4DLMA 4WY0F 5GNZA 4V28A 1V6TA 3PS7A 3NWRA 4AD2A 3VNLA 2X05A 2P53A 5C2XA 1Q6CA 4AZGA 1JCMP 3N4AA 2R14A 2WNWA 3TYZA 4LAKA 4MYAA 1CLXA 4KWWA 3TTQA 4LUYA 2MUCA 2Q3RA 4YYCA 1EKOA 4AD4A 5DBTA 1U33A 3VXGA 1W1YA 1IXNA 4S3AA 3PUEA 1E4IA 4R33A 3A5VA 3GTXA 3FKRA 2QCMA 1A5CA 4GBDA 4S3JA 2HS6A 2OG9A 4JIRA 4JZ5A 3ES7A 2VWSA 2HZGA 4LF2A 4JAWA 2PUZA 3T42A 2J7DA 1TE1A 3THAA 4UQDA 4W8LA 3FXGA 1YKWA 5GPRA 3RJYA 4H04A 4WY0A 4AW7A 1HXJA 4W8BA 3T8QA 1J10A 2H9AB 1E55A 3MWAA 5A95A 1FUYA 3ALFA 3M64A 1HQTA 1BWKA 4O8AA 3ZQ9A 2OO0A 3DI1A 2X1IA 3L21A 4XAFA 2DZBA 3KDNA 4C6LA 3WNNA 4JQ1A 3REQA 4GIYA 1F07A 1U5JA 3G2GA 8CGTA 4PTNA 1WNOA 4KETA 3N11A 1UD8A 1OGBA 4YMZA 3W7QA 1W6TA 3OZMA 3VTRA 4IL2A 3IV3A 4YIWA 2YSWA 1ISVA 3FCPA 1TZZA 2V3FA 2XU2A 3LA4A 1O1ZA 1EJ7L 2CETA 2X42A 1XLBA 2VZKD 4LRSA 4ZZ9A 2PFHA 2BGSA 2EQDA 3GZ3A 3QY8A 2Z1BA 3GDLA 1W9BM 1O7AA 1B30A 4NZ4A 4YVPA 1C29A 4GI9A 2E0PA 3NQAA 1MEWA 4P7OA 3VDGA 5LSMA 1XLHA 3UA4A 3TW9A 2C3ZA 3THQA 3UCQA 3RG6A 1AW1A 4WRHA 3DFOA 1CXKA 3NIYA 2WJEA 2PDBA 2XVLA 1UOKA 1B3XA 4XZLX 3WLPA 4M7TA 2D2JA 4IQLA 4GJJA 2X1SA 4IIEA 4DJEC 5C2GA 3U3HA 4PMNA 2XGBA 3TXZA 1BRLB 4TV6A 2FMNA 2D3LA 4NKCA 3E0IA 3HQ1A 4XD3A 3UYIA 3MDWA 1RLDA 2WZIA 1SW7A 3WNKA 3S2MA 3OZPA 3TN4A 4WGHA 4CNPA 4CCZA 1N7NA 6A3HA 4UMAA 1Q45A 4NAEB 3USZA 4ZEPA 3FA3A 3BCFA 1EGVA 3TTYA 1WUFA 4YNGA 1EF2A 2X7VA 3M44A 6ALDA 2OU4A 3APYA 3GFZA 3QV9A 5E6ZA 1H4PA 5C0QA 3DHUA 2D24A 4J9JA 3KRBA 4V15A 2GGEA 4DO7A 2Z28A 2CU0A 3VIPA 1XWYA 3LBOA 5MHBA 2J47A 3HJZA 3EDDA 4J28A 1RJQA 3ALGA 1NP0A 2GVGA 1XYAA 2OYKA 1EYEA 2GUYA 3FA5A 3KVKA 3AROA 4UNLA 2PF0A 5C5YA 4HNNA 3U8GA 2FB2A 2PWFA 3FA4A 2SFPA 4KCWA 4KESA 3V0UA 1XDLA 3SRDA 3VD3A 4AIBA 3AYSA 4XKYB 5LIKX 1OFAA 2C8NA 1YHTA 1SVDA 2PP1A 3I3DA 1MEIA 2WMJA 3U7BA 4JPGA 1JDEA 1H1ZA 4GFIA 4DF0A 3QFWA 1T96A 3MBDA 4P7NA 1Q6FA 1BYCA 1RP9A 2DT1A 2WSRA 5A6MA 1I75A 5AB3A 5HAOA 3NJ3A 4Q6JA 2J7HA 1D8CA 1O0SA 3NDZA 1XIJA 2DEPA 3RDKA 1E6PA 3LYEA 2PB1A 1FWFC 1KFJA 3TSDA 3VOJA 1ML1A 1TCMA 2Y6ZA 3EB2A 3I6RA 3TWAA 3FW6A 4JTGA 3SIMA 5I06A 3T9PA 2XJ7A 2VJXA 4DZAA 2Q02A 3EYPA 2BVYA 2WNZA 1HKWA 4MLRA 1L6SA 4NNBA 1TTQA 3GIPA 3LPOA 1SFSA 5HR6A 1A5UA 4NJGA 1H60A 1V02A 2OZ8A 1EJSC 1P43A 2OWWA 5I24A 1Q6LA 1YNPA 1M7XA 3FLUA 3QR3A 1QASA 4Q8UA 4LNYA 3TQVA 3CZJA 2I9EA 1AD4A 4NRSA 3WK1A 2DVUA 4ZVJA 4S3CA 4OECA 4UQEA 4KEUA 1SO3A 5CGQA 1KFCA 1V51A 1IZKA 4GVFA 1PZ0A 1UKTA 2Q6ZA 1XC4A 2VEIA 5CPOA 4F9DA 3SGZA 4D2JA 1VFFA 1F8MA 1PZ2A 2X16A 3B04A 3NFUA 1WA3A 3M6DA 1V6YA 4YJ5A 3MKCA 5F2GA 1UQYA 3QYQA 3UYCA 1OB0A 4MNKA 5LGXA 1P6CA 2XSBA 1TR9A 1KNWA 4H6RA 4C60A 1E0VA 3URQA 2GUUA 3E2RA 3MSGA 3VKBA 4LBSA 5JU6A 3VCCA 4LAMA 1GK8A 4WOQA 4XVEA 2E25A 5I3HA 2VP8A 3IAQA 4XD6A 4PFHA 5ABTA 5AC8A 2ZC1A 4HQVA 3VGDA 5JQ9A 2QCGA 5K9CA 2JKPA 1GG0A 2QLYA 4MDPA 5CZJA 2WK2A 4AWTA 3A9IA 2TMDA 4N7QA 3UZXA 5CC5A 2VDGA 3CC1A 3LCIA 5CSSA 4IM4A 5A8MA 1Q6QA 3UXKA 3WJXA 3R8GA 5F7UA 3P6LA 4A21A 5HNTA 4KFPA 2HMCA 2ZTJA 3PANA 1AH3A 4XTIA 1A4LA 2WM0A 3VD4A 3UA3A 3BOXA 5LIYX 3WKZA 3RM4A 3EA1A 5LNUA 1GOMA 1TELA 1NF7A 5C9UA 4OBSA 3GC5A 1ZCCA 3T55A 1R87A 4GZ7A 2DZAA 4R3UA 1XLIA 4OE7A 3CV6A 6CGTA 2GGIA 5M5DA 3FVDA 1P1XA 3GVVA 2VCCA 4ZE4A 3IK4A 3WD4A 1IWPA 3AMCA 3I4KA 3MUIA 5HDRA 3VNIA 4XAZA 3NNTA 4XBSA 1DJZA 2FVKA 1REQA 4RCXA 4JN8A 5HR7A 2QJIA 1SSDA 3W1PA 3RR4A 4W84A 5FA5A 3LU2A 5HQEA 5G1TA 3O6DA 4WDXA 3LZ5A 1VC4A 4B91A 4UB9A 4H7CA 4ZENA 2E68A 4O15A 4C1LA 2FGLA 2PDJA 3B4YA 1B3VA 1C91A 3THCA 4AEFA 5AVNA 5CPTA 2W4XA 5D9PA 4B3KA 2ZYFA 1MZRA 1LLZA 3CUHA 3T4CA 4FXSA 4K3ZA 3C0QA 4NT0A 4E4UA 2OR2A 1KXVA 2QUTA 4WLCA 4KWUA 3W2JA 1EP3A 4E5TA 4O0QA 5A8GA 4IPLA 4PBEA 2DT3A 4HPNA 3U7VA 1DIEA 1NOUA 3O6AA 2DGAA 1IT7A 2A85A 5FF3A 2XVGA 3S5NA 4PCTA 1UWTA 3LB0A 3C2FA 2W27A 4RK8A 1TB3A 2A7PA 1M68A 2F7FA 1HM3A 4IGMA 5HANA 1KXHA 2ZX5A 4TOQA 1E4MM 3TJXA 5A5WA 1BYBA 2WZTA 3QTGA 3C61A 1W1B1 4LNCA 1JZ7A 3AOFA 4O16A 3VPLA 5I77A 1KRCC 3WLHA 3TYBA 4RDZA 2CLOA 3D6NA 2WKGA 1VR6A 2X1TA 3CZLA 3OA5A 1BWLA 3AYRA 4GYKA 3T0TA 1OJMA 1EX5A 3OGVA 3VGGA 3HBLA 3IJIA 3TK7A 3BVJA 2X41A 1WZMA 2C14A 3LRLA 4DEFA 1ONXA 3BW2A 4D8OA 3H6OA 3K4AA 5C7HA 4AZCB 1NTHA 4XKYA 1C9DA 3EWXA 1EZ2A 5B7ZA 4HMDA 5LIUX 4DZ5A 2XISA 2VZKB 4NJKA 4CLMA 4C6FA 1O4UA 1OD0A 1GQKA 5C55A 2OWCA 3AHZA 1ICPA 5A6LA 1O1HA 5HOSA 3NTYA 4IH3A 2O7QA 3G18A 4I9TA 3UEQA 3QY6A 1H7NA 3GY1A 2ADAA 4GYJA 2WSQA 2DZSA 3EB4A 4Z17A 1PIGA 1OGGA 4LUTA 1W9XA 4H6QA 3PUGA 1LQAA 4KBXA 2VD9A 3D3AA 2W67A 4GWEA 1U2YA 3PZVA 4C7GA 3PY2A 1X1OA 3NQBA 4QE4A 4NF7A 3EOUA 2B0MA 3S42A 4PN2A 1RBLA 4MG4A 4ZSUA 1V6VA 1NY1A 2Y8VA 3C52A 1TV5A 2XYLA 4H7VA 4D6FA 3GW0A 3TW6A 3QV8A 1JCLA 1Z3NA 3LNPA 4FI4A 4ZQMA 2OQHA 3AICA 3SCOA 2QUMA 2F84A 1P7TA 4MJZA 3QSTA 3F7JA 2VZSA 3MI2A 1J93A 3E0LA 1ELSA 2KXRA 3Q45A 3ANVA 1GOIA 1PB0A 5HQMA 1B5TA 2V2CA 3LD5A 2QIWA 2ZZ3A 3MW7A 3P67A 4W7VA 5D2XA 4FNPA 5LNSA 5BROA 1VBHA 3WY1A 1QI2A 3QR0A 4EACA 3R11A 3W85A 3HQPA 3PBMA 4HU8A 2G41A 3KZSA 5FIPA 4QE5A 5EBAA 5JBFA 3W1UA 4WJ8A 1XBZA 4IG2B 2WWCA 2O9TA 2PC8A 1HJVA 2VGGA 4INFA 1ADSA 1MUWA 2BMBA 1FCBA 4BEQA 1V79A 2VZTA 1NWSA 3F1QA 2DJXA 5FL1A 3NQVA 5I3KA 3WUFA 1MW1A 1Z42A 1YW1A 3DYMA 3GXMA 1A80A 4EKJA 4DI9A 5A8OA 1MQQA 3TX9A 2PDFA 4HHHA 1QATA 2BY0A 3AIVA 4Q6XA 1JDDA 4XISA 4FXFA 5BNKA 5C54A 2PDUA 1TKKA 1UD6A 3E9AA 5FSEC 3TJ4A 5AKQA 3RIKA 2VZVA 1GKQA 3Q58A 1WPCA 5CLWA 4E2OA 3SSJA 2GJPA 1Y65A 2AKZA 3QKEA 4PB5A 4QDWA 1I45A 2OSWA 1AQFA 1W8GA 2D22A 4Q3MA 5EMKA 2H9AA 4K7YA 5FJUA 4Q8PA 1I2RA 3DZ1A 4IFOA 3CAKA 3W84A 3H7RA 3IIOA 3FOKA 1QI0A 2ZBTA 1W8SA 1IXQA 3M07A 4GC3A 3U2EA 3B0VC 4IFKA 4JX6A 3A4JA 2BOGX 1LUCB 1MXGA 4P7QA 3LLXA 2CC0A 5FACA 1KA9F 1UKOA 4A35A 4U28A 4IQEA 1V7AA 3SUSA 5I6SA 1TRDA 4PE8A 3VKCA 2YB1A 2DSVA 4JHZA 2DH3A 4GD0A 1LWIA 2V67A 1VIWA 3K5XA 3HZ3A 2ZC8A 3APTA 2F61A 4JFVA 1JNEA 3QVQA 3V75A 1R9XA 3SJ3A 1TV8A 3BAXA 4QSFA 3CZKA 3KL5A 2P1FA 3P93A 1LRQA 4UOQA 4OIFA 3GAKA 3L5AA 5HBFA 2Y2WA 3P74A 3W1AA 1DQWA 2WSKA 3UWVA 1B9ZA 1ZGDA 3UJEA 5FSDC 4BR1A 1OD8A 3VM7A 3W1TA 1UC4A 2YFNA 3P84A 3GFYA 2CERA 1JQVA 1RJRA 3U48A 3UWEA 1WKFA 3WUGA 2Z25A 5AVHA 1S1RA 3RCMA 1C8XA 3LCXA 2QVNA 2NXIA 4MKSA 3QPEA 1F73A 4NU7A 4YVVA 3YPIA 1Y5VA 4YTSA 4JFTA 1XBYA 1UKPA 5EL1A 3IIZA 4PGLA 1CT5A 1Q2SA 2FMOA 2RDUA 2D20A 1HO4A 1PV8A 2FTYA 2Y24A 3W2MA 5T91A 3ES8A 4NJIA 2IQTA 4NZ1A 1CPUA 1RH9A 2V3GA 3E0VA 3N29A 1LZOA 5EY5A 1YIXA 2RGLA 1ITQA 4YCOA 1RY0A 3MMUA 4JIIX 2YLAA 4JFSA 4Z2IA 3KX6A 4RV3A 4Q33A 4XD4A 3ITCA 2ZZ7A 3AUJA 1QO2A 1PIIA 1E40A 1FWGC 3TQKA 3B0XA 8XIAA 4AUBA 2BGNE 2R1KA 4LFYA 1D3CA 4M5PA 5IDIA 5JBEA 3RN6A 4TVUA 3W6MA 3WQDA 4UFLA 1XRSA 3UF9A 4RE0A 1HKMA 4FOUA 4NY2A 2XSXA 1QUMA 3AS2A 5JMUA 1M41A 1H51A 3QHNA 1YPIA 3TN3A 4J3VA 1NFPA 3CZ8A 1FWIC 3AS0A 3T0CA 1JCXA 4N02A 1PHQA 2HPIA 3N3TA 4G7EB 1NFBA 3O63A 1Q6EA 4TX8A 2XIOA 2VD8A 2ZUNA 2BV9A 4AC7C 3FEMA 3O07A 3AXIA 5A6TC 3TQ0A 3W07A 1MW0A 4HA4A 2C0AA 5DANA 3R13A 1B0IA 3MVTA 4MNLA 4J1OA 3FFSA 3HG2A 3NPWA 3B0YA 4BFAA 8RUCA 3CHDA 4MB1A 2ZDRA 1XYCA 3C0LA 4LQ1A 3KL3A 4KFOA 3ZS4A 4PZVA 2XIMA 4N4PA 4EPDC 2ONEA 4QEHA 2Y0FA 3PUOA 1K9FA 3GWQA 3R0DA 5E9XA 2A3EA 3CQ0A 5I09A 5HNUA 1UASA 1JRCA 2H90A 4DBDA 1XIHA 3LCLA 1R3WA 4LVFA 2YDSA 4HJWA 2PF8A 1SJDA 1C3FA 1EP2A 1JEZA 3AZTA 1GYMA 1KRAC 3G1AA 1RVKA 4HT3A 4CNSA 2PEVA 4RZ4A 1RHCA 1G7UA 4ZXOA 2XN1A 4DAFA 5CJ5A 1PAMA 4ZL1A 3W7PA 2X1RA 4GIAA 1LWJA 3U2ZA 2ESCA 2R6OA 3AXMA 4S3BA 4EXBA 1UC5A 1V3JA 3MUCA 4H9MA 2E8YA 1XH1A 4FB7A 1VBRA 1ESWA 3LNMA 3T0DA 4XZMX 1I4NA 3RJXA 3BV7A 1Q4NX 2OT1A 1BTCA 3C5QA 2ZX9A 4Y7EA 3RO6A 4CNTA 1LOQA 5CLTA 1C8YA 3DFTA 1XCWA 1XLKA 4QR6A 1HP4A 4XUGA 4B5WA 5LIXX 2VR5A 1E1EA 3SN1A 4FR6A 4GX9A 5M03A 2NWRA 5BRQA 4EWJA 3OGRA 1G4TA 1HT6A 4WUIA 1R3TA 4DI8A 4KEVA 1VBJA 2QXWA 1W31A 2VC5A 1IR1A 4S3EA 3QZEA 3KTSA 3VMOA 3BWWA 1UR9A 3DC8A 1N2VA 4MIMA 2GVLA 2X09A 5LXEA 2QPSA 2FDSA 1ZAIA 3WBWA 5JIWA 3VAVA 2QJNA 1S3TC 3BICA 4HPGA 2KAUC 2BXVA 2PCEA 4GISA 2X40A 2IUZA 2G3IA 4GUIA 3GHUA 2FIQA 3N2BA 2BG5A 3HOJA 5AZ0A 5DMYA 3EX4A 5A6JA 1OQFA 3AHYA 2ZZ2A 3XIMA 2FQIA 2WHLA 5AN7A 1JR1A 3W7MA 3DFNA 2J77A 3WQ8A 3DOPA 4QDPA 5G1YA 3R0UA 5F2IA 2I9UA 3NOEA 5D2YA 3NUKA 1ZBVA 3AUOA 4M1RA 1O5RA 3CAVA 3RPTA 3HPZA 4PCFA 1PO9A 1EHAA 3VZZA 3PG8A 2FPVA 1Y8BA 1OK4A 3KCOA 4WY0B 4GZJA 4DN1A 1RWAA 1XQKA 2BODX 2EPLX 2FFIA 5C9WA 5I07A 1LF1A 4LOCA 4ZOBA 3WLRA 3IJ8A 4NNAA 2A1YA 3V5CA 4BK9A 1FHUA 3P2VA 5C7VA 1KM3A 2Y62A 4JCLA 1YADA 3L0NA 3UXLA 5FJPA 4RNHA 4PMXA 3M7SA 3H2MA 3QPYA 4UQ9A 4M6UA 3G8RA 4E3VA 4UQCA 4A4AA 4XD5A 4B5VA 4GVGA 1ICSA 1UKQA 2OEMA 1ONWA 1UUQA 3H21A 1IT0A 3VGBA 4Z1CA 1QOPA 4AWEA 4NQ1A 1W5MA 1Q7MA 4J3XA 4PEKA 4BI5A 3C4UA 1KWGA 1RXOB 3V1PA 3DX5A 3QW4B 3TR9A 1OX4B 1W2VA 3CWNA 5JH2A 3MP4A 4J7RA 4LBRA 1FQ0A 3ABSA 3SCUA 4MGGA 3VIMA 2W63A 1U5HA 3OIHA 3ZWTA 4MHBA 2PDGA 1F6KA 2Z1XA 4DZHA 3E38A 1RWCA 1FDYA 2BRWA 4Q4PA 2QW5A 3TJLA 3OOQA 4EXAA 3IT4B 5HATA 4P2VA 2XTKA 3GUWA 4OQVA 3ZMRA 3TE9A 1EEPA 2OOGA 1G6CA 3HGRA 2ON3A 4J3TA 4ATDA 2I14A 3PNUA 3NVDA 3UGRA 4B4HA 2XWDA 1XGZA 3UZWA 1XBXA 3L12A 4P8UA 1V08A 1UR1A 4CQAA 5JVLA 3VC6A 4FSAA 4R9XA 4UCGA 1L2UA 3CB3A 1IV8A 4MFEA 1TJ2A 3P5ZA 2TAAA 4Y8FA 1NF0A 4M8UA 1ISWA 4BA0A 4REQB 1FWTA 1VRDA 3ITVA 4GZEA 2AQVA 1Q2RA 3MSYA 4Y9NA 1CYGA 1M01A 1G1YA 4L1GA 1VRXA 1JPKA 3LDVA 1YTEA 3NSNA 3S2JA 2ZUWA 2Q71A 4RDVA 4NI3A 4UTWC 5JH1A 1P0EA 1YXCA 4IWWA 2BY2A 1OBAA 2Z2BA 4DXKA 3DFSA 5FEZA 1AZ2A 3WD1A 4B5UA 2ICSA 2YCIX 4IICA 1FH8A 1C7TA 1FWNA 1WAUA 2NV1A 1Q8JA 2GGGA 4HCLA 4JX5A 3AMKA 4FIQA 1KTNA 7ODCA 3KRZA 4H9XA 2F8QA 1E51A 4U31A 5I5RA 3PBVA 3OJGA 4PEEA 1J5SA 4GINA 4NSBA 1J96A 2YEPF 4PMDA 2E5BA 2JE8A 4FK9A 1AVAA 1K8CA 2PSNA 4AYGA 8A3HA 4CEUC 4YCPA 1FCQA 3CPRA 2IS7A 3FJ4A 4HSNA 3W2LA 5KSWA 1OT1A 4LB4A 4EOUA 5D32A 3LM7A 1F74A 3EX3A 4GRSA 2X2YA 5FEXA 1KGXA 2ATSA 3KLKA 2WKJA 4RJEA 4Q4RA 2R1NA 2DW6A 3NQ2A 1E43A 3CJPA 3T6CA 3D5HA 1TRIA 1LRTA 3H2AA 4IT1A 1GJPA 4LY4A 1CI1A 1FBAA 2Z24A 3BJSA 3PR2A 4QISA 4GCXA 1NDWA 3H23A 4HHPA 1O94A 2BRVX 4S3DA 3WO8A 4PBFA 3OLEA 4KCTA 4B5XA 4JQ4A 4HPHA 1BYDA 3C3NA 4H2CA 4IL0A 3Q2DA 3LN3A 1VCVA 3CUGA 3KVMA 1EXBA 1GOQA 4ALDA 4D8AA 2J13A 5ECUA 2VEPA 4FXJA 4IGSA 4HCDA 3IJ7A 2AQWA 2VFHA 2BY3A 1T8XA 3W7GA 3MCMA 4JYFA 1LCOA 2XM1A 4KCVA 3N1AA 3UZZA 1A5AA 2ASHA 3B8UA 4K37A 3Q37A 4DJFD 1M53A 1PHWA 4AG0A 4ONVA 5G5IA 4U3CA 4WEVX 4GYPC 4L80A 5C6MA 1N82A 3E02A 4UTLA 4Z1DA 3KLLA 3RMJA 1O60A 3GE7A 5FD0A 3WMBA 3TVAA 1WCGA 4TTGA 2WVVA 5DN1A 2Z6JA 4AC1X 3TH6A 4MZ1A 3W7KA 1YTDA 1E6QM 4TTUA 2NUXA 4PCPA 3QY7A 3VIJA 3G1VA 4QP0A 2IPJA 2GJXB 3PTKA 1VP5A 2DSUA 3CQJA 3BH4A 3K13A 3EX6A 3F4CA 3GIQA 3WLJA 3U0HA 1C93A 1DJNA 3WEZA 3TZFA 3OLDA 5M3WA 1W9VA 4GQRA 3LLDA 2X0SA 1SPQA 1XFBA 1TQJA 4X22A 1AJ2A 4H4IA 1SFTA 1LG2A 3FSTA 1AA1B 3EPOA 3G1FA 4AHOA 4IXXA 5G4EA 2E1WA 1XLAA 4I7VA 1DV7A 2VM8A 4P8VA 4Q22A 1ZCOA 4E8CA 4F0KA 1OFPA 2W91A 3CEUA 4C6QA 1S2UA 5CQ1A 1DJIA 4JYEA 3ID7A 2E5DA 1XIGA 3MKKA 3T08A 3LI1A 4DRSA 3GG8A 3GHSA 4HMNA 3GTFA 3TP4A 1VYSX 2YEPB 3HG3A 3A4XA 3UD1A 3U9IA 1KCXA 4MSSA 4JQAA 1SZGA 3KVLA 2HVOA 4LUSA 3VDBA 2REQB 4TMCA 1OINA 3WG6A 3ZSSA 3DKJA 1JXJA 4S2BA 3WF3A 4O57A 1TMLA 3N14A 3FAWA 2UWFA 4QBXA 3OLIA 4XVDA 4A2SA 3NQFA 1MFUA 4O4WA 3UGVA 1EXPA 1NOFA 5IBXA 2R94A 3D47A 3WENA 1QNSA 3M0KA 2CHRA 3FJLA 4OGZA 4ZMGA 2NX3A 5FF0A 1VENA 5FOOA 1VS1A 3C2YA 1XXXA 4L1WA 2UY5A 1RR2A 5CXPA 1HL9A 3S83A 5CSRA 5MKGB 3QW3A 2QMKA 3H4XA 2OKTA 3RRAA 1E1CA 2VUYA 4GJ1A 2RDTA 1DWHM 4M6PA 4D6JA 4UTJA 3FNDA 3AMDA 2J78A 2CLMA 1V6XA 1DJWA 4ZQNA 1SJAA 4NASA 1JFXA 3FHAA 4PTWA 1GOKA 1EDGA 1P4CA 4PCSA 2V5LA 4CU8A 4S1FA 3F4WA 3WDQA 3TN5A 2P88A 4KWSA 1C8QA 2C1HA 2A3CA 3EDJA 3LTYA 4LT9A 2F6UA 3RITA 3OW1A 4WKFA 4IMCA 1IT8A 2G50A 3BDKA 4BWLC 3PWIA 2WCAA 4NXKA 1VQTA 3W75A 2G3NA 2DIKA 4ES4A 3SCVA 4IP4A 3WMCA 2CITA 1DPMA 2A0NA 4NXSA 1S5NA 4XZIA 2NWSA 1W3JA 4OV9A 3RX4A 1FHLA 3AWOA 1V03A 1SZEA 3PPFA 1JPHA 1SW3A 5KMYA 4WKAA 5DRIA 1J0MA 4J2PA 4BCEA 2ZA3A 5BXSA 2V2DA 4M56A 3CQKA 3NG3A 2E4TA 3MKVA 1UWQA 1S2CA 3UETA 1RW9A 3CUIA 4HA3A 4IPJA 1HX0A 2HBXA 3TLQA 4Q32A 3RYSA 2R1LA 4Z2HA 3WLKX 3GHRA 1HKVA 3LV6A 4IMAA 4U5KA 4IZGA 3RU6A 2Y7EA 1WDDA 1CGXA 4MZYA 3CYVA 5AHFA 1EPVA 4PB4A 2PGWA 2WC7A 4OU1A 2CPUA 3GO2A 4FNSA 2V63A 3ZJ7A 4AZBA 4H9TA 1V6UA 4FNQA 4X3ZA 3K46A 3S9IA 3QEZA 1ZS2A 3RRXA 3GK0A 4Z2JA 4JOMA 3K1DA 3I4EA 1TZ9A 1FFQA 1RCOB 3U2OA 4TVCA 1CWYA 1QK0A 3W22A 3JS3A 5GVJA 5B80A 3RUBL 4F9JA 5FJOA 1H7PA 3OVGA 1ZUAX 1K03A 5AYIA 5K4ZA 4ZFMA 4I5UA 4W87A 1ZFJA 3QZAA 1CB8A 4LV9A 3UWYA 3P14A 3B8IA 5G2IA 2ZA1A 3GAYA 4AHQA 1V3IA 3ARPA 3UNTA 1VHCA 2JKAA 4RE3A 2ZIDA 4AY8A 4XV0A 4H83A 3DESA 3DYOA 4GY7A 1FY6A 2C18A 1JPIA 2IKGA 4JDYA 2GZXA 4CQDA 4GZIA 2WMKA 3RLUA 2FTWA 1DIKA 2QNEA 4HVXA 2HK0A 1JZ2A 3WBXA 1JDCA 1XCFA 3QQ1A 1W3NA 2BVWA 3M5VA 2PMQA 3GVGA 5A1AA 1XIIA 3WNMA 3HFYA 2OFJA 1ITCA 2J25A 4G9PA 3N4EA 1J79A 3U57A 1CB2A 1PX4A 4PULA 5A3HA 4GUGA 2WQDA 4QS6A 3PJTA 1S2AA 4IMEA 3GH7A 1E56A 3KUMA 1TPH1 3E96A 4DWSD 1PVNA 5C70A 3IT6B 2V8ZA 2JQXA 4GPNA 4AF0A 2J6VA 5HPCA 4R7WA 2J9XA 3MA8A 1L9WA 1WBJA 3P0WA 2J8FA 5TAOA 2XGZA 3R2GA 5GJNA 2FJUB 3MV11 5CPSA 3N2TA 4FNTA 5H91A 1VEPA 3BLIA 3CT7A 3UG8A 4O10A 2DZPA 4NILA 3H2NA 1E3ZA 4DELA 1KKOA 4IIGA 9XIAA 4AIEA 2IKJA 4QCFA 3WH5A 3JRKA 4DM2A 3WZ0E 4EK7A 1CENA 5IHSA 1JI1A 2DSWA 4FIRA 4IP7A 1O68A 1DBTA 3LCGA 1R0MA 3OBKA 4GH1A 4N9BA 1EQPA 3PJXA 4A05A 1KFEA 5K3VA 4AFYA 3FJ6A 2WJDA 1OGSA 2YA1A 3L7RA 4EPKA 1N8IA 3V5FA 1A49A 4CN6A 1R6WA 3EB3A 4RZ6A 5AC7A 2WHJA 3G1XA 1US3A 4GYFA 5FEWA 5AHMA 4DUWA 2B81A 4A3QA 1JDFA 2C13A 4WK9A 4LS2A 4O17A 3QJAA 3D0CA 3CT2A 4IQDA 1VPXA 2YOCA 4LY8A 4Z1BA 5A6AA 1OWQA 1EJTC 1M6JA 4HB7A 3MI3A 3TMLA 3QR8A 3E49A 4Z2LA 3LUTA 3QSRA 1LOSA 4XZNX 1TG7A 4WJEA 1KM2A 4TQTA 2YXGA 3NQ8A 4KRUA 1X7IA 1HP5A 4G56A 1TPEA 3AFBA 5H8PA 3O3RA 3OGSA 1UR8A 1OSEA 1S3HA 3VIIA 4AMAA 3VMNA 4X2PA 3H26A 4Q7NA 2W79A 4LANA 1AODA 3VABA 4KMQA 5KEZA 2DVXA 5J5RA 4GI4A 4WOZA 1XDMA 1E0UA 4E6MA 3BSGA 5J5DA 2VQUA 4BZYA 1W1ZA 3VIGA 2HCVA 3HM7A 2EPOA 5C71A 4X61A 4XWUA 2D0FA 4RXFA 4JNMA 4M29A 1UJPA 1ZNNA 2J7FA 3ZXWA 4PMZA 1QNOA 1EO5A 4M6QA 2NUWA 1M3UA 1ODZA 2POTA 5E9AA 3LXAA 3VZXA 1US2A 4HGXA 1KV5A 2JEPA 4HJFA 4LVBA 3T78A 3UG5A 3SCWA 2ZFAA 3NL6A 4O52A 4F8XA 2NW0A 4PUJA 1W1A1 2HWGA 3M0ZA 5DCEA 1GYLA 3STCA 3M6YA 3FYOA 1LUCA 1VPQA 3A22A 1R7AA 2G4FA 3P62A 3L5MA 3EWDA 3BLEA 1C7SA 2Z1VA 1PYMA 3H55A 4Z0SA 3ZSTA 2G4JA 3LPGA 5AHLA 4GKTA 1XYMA 1FCUA 4GQ0A 3IACA 1W32A 4UWMA 1TJ1A 1OADA 2TRSA 5IDZA 3LY0A 5DQPA 2DDXA 1QW9A 2EO7A 1UPPA 1UA3A 1XSIA 1EC7A 4HNOA 4M6VA 2VC6A 3L4VA 3EOEA 3EXRA 1GZ1A 3UR5A 3F2CA 4ZOAA 1K7FA 3GTHA 4Y8EA 3S9YA 3QM3A 4CVUA 2LLEA 3N9SA 4GGBA 1PCWA 5ABFB 3TJIA 1P6BA 1UH4A 7CGTA 3DAQA 1I8QA 4IMGA 3B05A 3ARSA 3W86A 2V9DA 4ICCX 2OODA 4C5ZA 3L68A 2P0IA 4AH7A 3GS6A 2V82A 5A2BA 3QMSA 3W7HA 1GVOA 4R5EA 1S2WA 3CQIA 1QO5A 3HN3A 3TLLA 3CWOX 3SY8A 4LCQA 4RE2A 1QXLA 3DDMA 1AH4A 4G1KA 1GWJA 2CZEA 1EA0A 4HPXA 4ZTYA 3MUXA 1XLFA 6TAAA 2YCKX 2YGYA 3RU8X 1V02E 3W29A 2ZVIA 4JN6A 4LUTB 4RPQA 4L64A 4KRZA 3OLGA 3IJ9A 4OOUA 2HE8A 4UFIA 4O1AA 4FX7A 3SGUA 4NAFA 2DSKA 4EP8C 3HG5A 4K1WA 2YW4A 3MP5A 1MUMA 3AMGA 2VGFA 5BRPA 4C91A 4AD3A 4QJ4B 5AFDA 4BWLA 2GQ9A 1R3QA 1WQ5A 2O9RA 3SUUA 4ZO9A 4OVXA 3WF4A 3S1XA 2I16A 3HPSA 4FX8A 3TYCA 1UH3A 4LAZA 1XG4A 3ME3A 2GDUA 1GTEA 4CN1A 1R2RA 2XH4A 2YL5A 1VBUA 1QNRA 2XZ9A 4BS0A 1J2BA 1RPXA 3CMFA 4ZB5A 3U5YA 2HNEA 4E38A 3UP8A 2WM1A 3K30A 4MWAB 5D9OA 5BOFA 3BMXA 3F4NA 4WF7A 3HV8A 3GQYA 4US5D 1D3GA 3GZAA 4WZHA 2OEJA 1NQ6A 2W66A 4EAMA 2JALA 1ECQA 3CEPA 4JY9A 5KZMA 1GJWA 2J74A 3SBFA 1YYAA 3B8VA 2YCLA 4PUDA 1TV2A 3M0IA 3WNPA 1FX6A 3RX2A 1B2YA 3SRFA 3ABZA 2C19A 1UJQA 1H50A 9XIMA 1NSJA 2PDWA 2JGQA 3EDEA 3BUVA 3KZPA 1BEUA 1Z48A 1FWJC 1RAKA 2VOTA 1A5OC 2EG6A 2WCGA 3AXXA 4KKXA 2VX5A 1XBVA 3BLLA 1E1FA 1NDZA 3G77A 2OSYA 1OJNA 5B7YA 5TNVA 3T7VA 2PDYA 4WDUA 4OJYA 3WUBA 4PUNA 2Z7KA 5F4WA 2D0GA 3CH9A 3M0JA 5CJNA 4PTMA 2ODOA 1CXFA 3S5SA 1ZY9A 2CIPA 5CZSA 4J3ZA 4ASTA 3WQ4A 5ABFA 3BCJA 5MKGA 2D0HA 2G0WA 4K39A 5CPNA 5TQLA 1SMDA 1VFSA 2ZA2A 1EJUC 2PS2A 3BURA 4M81A 4A22A 1PX3A 2A7NA 3VIHA 5F4XA 5DCBA 2NVCA 3VM5A 3CPGA 5D04C 1MVYA 4JKLA 3ITYA 4UTFA 1EGMA 3U6WA 4JHMA 5BOEA 3G1RA 4US5A 3TDFA 1RWGA 5HNNA 2WPGA 3ATZA 5GJPA 5HWMA 2NV9A 3WLNA 4HHMA 1E6ZA 1SMAA 4AZIA 3W28A 3EAUA 3F59A 3ZIZA 3HGJA 2ATMA 3AIUA 3KBWA 3KBSA 5CZ0A 4DYEA 1KB3A 3WBAA 1QT1A 4XO7A 3RMEA 3CK5A 3H54A 4UXDA 4HZMA 3KCLA 4UFMA 4E2DA 3DG6A 3T09A 4ICMA 4UMCA 3CHVA 4DNMA 4NG3A 2NZLA 4GQQA 4XZBA 4CN4A 2L5HA 1F7BA 2GJLA 2QZRA 2V5DA 1A5NC 4KIRA 4KGLA 3M0YA 1OJXA 3ZVHA 2WJFA 2QCFA 2Z26A 3KDOA 2EJ1A 4NNCA 3O0FA 3QFEA 4DLOA 2JGYA 3HMCA 2WZMA 1W1PA 1UW9A 3DHPA 3IIVA 4L56A 4HNUA 1RCQA 2RFGA 2X1UA 4F2UA 4LU0A 1JL8A 1Y5WA 1PIFA 2VHLA 3NQMA 2PP0A 5KITA 1J01A 1Q7QA 4AIOA 5FJRA 1E9IA 2ZWZA 3KWSA 2V4IB 4YTUA 1OCBA 1TPVA 4NRRA 3GBDA 4Q8MA 1W1TA 3S0CA 3UVAA 1YEYA 4J3SA 1KFLA 3AZRA 1K9DA 4ADSA 3I7SA 4UR9A 1TTJA 1C82A 3DECA 2TYSA 3LBMA 3A5FA 1XR2A 2XN2A 4U2ZA 5FAJA 2F2KA 3KS6A 2WANA 5E0CA 4I9MA 4CNNA 3F4DA 1K6AA 1GVYA 1QPKA 3VKDA 3LCFA 3B9EA 1NFGA 1AMYA 3CMGA 2WMFA 4AXNA 5BW6A 2QGHA 4MWAD 5H2ZA 1LL7A 3DEQA 3WF0A 3CBWA 1X96A 1X6LA 3SB0A 4PUEA 3TC6A 1EOKA 3VDHA 1X8FA 3WLSA 4H9YA 2PGEA 4EXQA 5T8GA 2NQJA 2OB3A 1F9CA 2QCNA 1TR1A 4L7ZA 3I6TA 1TA3B 1P6WA 2O4MA 3BARA 2A6NA 3VDCA 4JDBA 3A4AA 4X0VA 2P50A 1YLVA 3OVPA 4WQ6A 5IRPA 3CGTA 3BSMA 5BWAA 1SZRA 1R3SA 4CQ9A 1YNQA 4R88A <