2WMIB

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 in complex with the a-trisaccharide blood group antigen.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
582
structure length
571
Chain Sequence
b'VDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTENYWIWANDIENKAADYLKVSAKNGGYFIWAEQNNGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKSKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 212
structure length 571
sequence length 582
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmiB03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmiB01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmiB02
5IHSA 3KZSA 3OZOA 2DIJA 4MNKA 1E6NA 1E4IA 2OYLA 8A3HA 3VDAA 3WQ6A 4AXNA 2UY3A 1HJQA 1L0PA 5A6MA 1VJZA 1LWJA 3U5UA 1GOKA 1FHDA 1LQ0A 1UR8A 1ISZA 2NT1A 3AQUA 1JZ3A 3CZEA 1BVNP 4EE9A 1VF8A 2ZUWA 2ZWZA 1V6YA 1CIUA 3K1DA 4DM2A 1OIFA 4TTGA 4AWEA 4AD3A 3T2PA 1QVBA 2JIEA 1GOMA 5DT7A 1MQPA 1HMUA 2YLLA 1C7TA 2DT3A 4UQAA 1ISXA 3WF3A 5EB8A 1J11A 2FGLA 4MAZA 3VGHA 4W7WA 3W29A 4U2ZA 2HISA 1MW3A 4UFKA 4JKMA 2VOTA 3WD3A 1BLIA 1H11A 4JFWA 1UD6A 2RGMA 2WKLA 3N12A 3T08A 2BFGA 2OSWA 1GOOA 2GFTA 2WANA 4U5IA 3VTRA 1AQMA 3NJ3A 3VNYA 1OGGA 4OIFA 3LPGA 3PZMA 3KEHA 2WMFA 2YL5A 2PWFA 4GKLA 3LPOA 3QHNA 3KL5A 3BAKA 3VDHA 4LYRA 2CKRA 1H3GA 4DUVA 1TVPA 1WB0A 4BA0A 2YDSA 2ZUTA 3BGAA 1BAGA 1QI0A 1JFHA 2F2HA 3GTNA 5C8BB 1D2KA 3OBAA 3SCOA 3VIJA 3WDQA 1H5VA 4ACZA 1PPIA 5GQBA 1XSIA 1CGUA 2E40A 3B8SA 2ZUNA 4AZCB 4W8AA 4HOWA 1UQYA 3SCWA 1N7NA 3E1F1 1VAHA 3ZJKA 3SCQA 3PTMA 1W3LA 3L4UA 4M29A 2WMGA 4PBGA 1RH9A 1NOUA 1QBBA 1PX4A 4UFHA 2D20A 1O6IA 3B9DA 1ECEA 1Y7VA 3DHUA 1VFUA 2HVMA 1DWIM 5GPRA 1SR0A 3AISA 1V3IA 4D6IA 4LYPA 3SCPA 3VIKA 3AS0A 1WPCA 2VZUA 1WZLA 1E15A 3WNPA 2PWEA 2Y2WA 1KR0A 1AQ0A 5DEZA 5EMYA 1JDAA 4GI8A 2EPKX 3NYDA 3AHXA 2YDQA 1KXTA 3TTSA 5JUVA 1XHGA 1UWUA 3CUGA 5A8PA 1HKJA 2MANA 1J0JA 1FFRA 5BRQA 1F1SA 2WC3A 3ARRA 1B30A 1EHNA 2GJXA 4JL2A 2WCGA 4H04A 2GJPA 4JFUA 3RPMA 4FF5A 1QNSA 4UQDA 3L4TA 2UY4A 4JL1A 1FP9A 1PBGA 3WNLA 1TMQA 1B3VA 1XC6A 2XVGA 1QW9A 1J12A 4P8WA 4D72A 4HU0A 2ZICA 4HZ8A 4AZHA 1V0LA 2W66A 3CZKA 3W6LA 1CDGA 4BQ2A 3T09A 3WD0A 1CXKA 2XFFA 2AAAA 3AMDA 5FL1A 4ZE5A 4CN1A 1NM9A 4MNLA 2JEQA 1FH8A 4WSJA 1F4HA 2XM2A 4S3KA 2BRVX 2OSYA 4J7RA 3I3DA 2EPMX 2YBTA 3F4VA 2Q8XA 4YHGA 3BCFA 4NRRA 2DSZA 5ABHA 3OGVA 3SUVA 4J27A 1HVQA 4DM1A 1JF5A 5BRPA 1WDSA 1J10A 4BZYA 4JFVA 5BYWA 1RWCA 3BCDA 4PYSA 6A3HA 1B9ZA 1UH4A 5TD4A 5LA1A 1TFVA 3U57A 3GBDA 2XPKA 2WMHA 1KXQA 4PSPA 3EDKA 3MUIA 3W26A 4ATWA 4HTYA 4EAMA 1UZ4A 3B9AA 3PZVA 1IZJA 1JXJA 4TVUA 5A2CA 1NWRA 1TR1A 3W0KA 4HPHA 3QR3A 5GNXA 4PMZA 1JL8A 2WHJA 2FH6A 2V3DA 3ALGA 3ZJ7A 3KL3A 3BMVA 2W92A 3IK2A 4CVUA 1VB9A 4Z2GA 1JZ6A 3CZLA 1LXMA 2WMIB 3T0AA 4W8BA 3AXHA 2J8FA 3SUUA 1V0MA 3QOKA 3EBVA 1GORA 3RCNA 3OIHA 2AMGA 4CKQA 1PIFA 1WNOA 1EGZA 3UR7A 4QAWA 3W25A 1B3XA 1K9EA 4GQQA 3VMPA 5A2AA 1GVIA 1CXLA 6CGTA 3CHFA 4WF7A 2VR4A 1IZKA 2W63A 3W37A 1W9XA 1MVYA 4X0VA 2OWCA 4ZXLA 3FW6A 4H7VA 1QI3A 3OLEA 5D9NA 3U7BA 1ZBWA 5HPCA 3TTOA 1DWAM 3K8MA 2W5FA 4J3VA 2BY1A 3F5JA 1UWSA 2ZUUA 3EDEA 1VEPA 4B9YA 1JYXA 1E70M 1VFMA 4HOXA 1FFQA 1HKMA 2FHFA 2BS9A 2NT0A 1UR2A 4XX6A 2EJ1A 3WFZA 2WSKA 2XTKA 3ZM8A 3WDHA 1CZ1A 2VRQA 3ZT6A 5JBDA 1CXFA 3FHQA 1MW0A 4OKDA 3CLWA 3M7SA 1ODZA 2X1IA 5A6SA 3GYCA 1BG9A 4JFTA 1V3HA 2VNCA 3PZOA 3VD3A 4AIUA 1EA9C 4J3TA 1DWGM 2UY5A 4HPGA 3WDIA 5KEZA 2BVDA 1CECA 3A3HA 1J0ZA 4AZCA 1HJVA 2D3LA 4N42A 4E4PA 1PZ3A 2V5DA 3FY1A 2CNCA 2ZX9A 4LGXA 4EK7A 3SCSA 1LL7A 1CNVA 1GW1A 2J25A 1LXKA 4TVDA 1BYAA 3WUGA 3NDYA 3ZIZA 3VGFA 1SFSA 1G9HA 3ARYA 3ZT7A 5HXMA 4KH2A 2FHBA 1HL8A 5A94A 2B31A 3CZJA 4DUXA 3BC9A 1NP0A 4W84A 3AHYA 4A3YA 1J18A 2D3NA 1B2YA 4XB3A 3WQVA 2J7GA 1ZJAA 1V6UA 3AS2A 2PBGA 1XCWA 1CXIA 3AIQA 2PWGA 4PMDA 1N82A 1YHTA 4UQCA 1JZ5A 1QNPA 2A3CA 2YIHA 3VVGA 1B3YA 1OD8A 2Y8KA 1UWTA 1KGXA 4B3LA 1RP8A 2DDXA 4PMYA 3ARPA 3AIBA 2WCOA 3BAWA 2F8QA 1BFNA 1OSEA 1V3JA 3RM4A 2DSVA 2J7HA 2J7EA 4P8VA 1TVNA 2BHYA 1UR1A 1W1TA 4FLQA 4BQ5A 3W38A 5M17A 3FXYA 5I6SA 2Z1SA 5ABFB 1HNYA 2J74A 4DWSD 2WM0A 1R7AA 4D6HA 2XVNA 4MDOA 1H49A 4HOZA 3VIIA 5E0FA 5ABGA 1X6LA 1XYFA 3PZUA 4YHEA 5A6BD 3WSUA 3SURA 4J3UA 1HM2A 4NI3A 4QLKA 5CPTA 2PWHA 2BY0A 1V6VA 4XV0A 4KRUA 1V3LA 4IPLA 1HT6A 2BY3A 4UFLA 1HKIA 3WH9A 3AMCA 2PF0A 4NSBA 2CBVA 4IUGA 1LG2A 2BRPA 2D0HA 1W9VA 2XGBA 2VZOA 3GNPA 1KQYA 3AHVA 3BMWA 3NDZA 2EO7A 2IXVA 2BRWA 3SCVA 3PZ9A 2XFYA 3WF4A 3ZQ9A 3VIHA 1W9DM 1JYWA 3IAQA 3OGRA 5DMYA 1WDRA 5I2UA 4H8HA 5CZKA 3AIUA 5A69A 4HU8A 1E1EA 3MU7A 4DWSB 3MUAA 2YDRA 1UG6A 4LQ1A 1QNQA 2DT1A 1CTNA 4U2YA 2CHOA 4MB4A 1DWHM 1KFWA 4AD0A 2VRKA 1W3JA 3WNKA 1XGZA 2O9OA 1B0IA 2Z1KA 4WKFA 2J77A 1WP6A 1ZBVA 1TG7A 1NWTA 3WF2A 3AS3A 1HL9A 4FLSA 1C92A 3AJ7A 5HDRA 1WAWA 3O2LA 5E6YA 2JFEX 3MV11 1BGGA 3CUFA 3RJYA 3MKKA 4AIOA 3AS1A 1E5NA 1RPKA 1QNRA 1W3HA 5CJ5A 1DP0A 3SUTA 3N18A 1BYBA 1GQKA 1XRVA 3BLKA 1XYZA 4PMNA 5D9PA 1OJOA 5GNYA 1H1NA 1FP8A 3G6MA 2XIBA 3B9EA 4AY1A 2Y8VA 3WUFA 4P7RA 1XSJA 2WCAA 4H8UA 1XH0A 4CVWA 1LG1A 1X1JA 2O9PA 2PI6A 1E0WA 2ZUSA 2DSUA 1RWHA 1J0MA 4AMCA 3IJ8A 5D8WA 3UG5A 4TVCA 2E9LA 1UKQA 4CU7A 2XVPA 4BF7A 3WQ5A 5E9AA 1FHLA 3AZTA 1CGYA 3ZO9A 2Y5EA 4PN2A 1XV8A 4PCTA 4EANA 1N7OA 2D23A 5A95A 1JZ4A 3WNMA 2ZWYA 3ECQA 2CBUA 4W87A 2UWFA 3N1AA 4JFSA 1D3CA 5CPSA 5FL0A 3GDBA 2OSXA 3GXDA 2WVVB 5FOOA 4JHZA 5JIWA 2ZXDA 1KCKA 5A6KA 5DF0A 2QLYA 3UERA 5I5RA 3AZRA 4PMUA 3AFBA 1UQZA 1NOFA 1VFOA 3ZJ8A 2CEQA 3EYPA 1JYVA 4OBSA 2G3NA 4RE3A 4AZGA 1RD6A 3L4ZA 1ISWA 1ZBKA 2PBOA 2TAAA 3THDA 5A6JA 1L8NA 3CHEA 1UHVA 4L4PA 1R7OA 3WUEA 4AIEA 3TOPA 3RJXA 5A6AA 3L4XA 1K9DA 4P8XA 1WKYA 5JIPA 3UESA 1GPFA 4IM4A 3MMUA 1OJMA 1GJWA 1W9UA 4GPNA 4HA1A 2ZX8A 3U5YA 3VMOA 1HP5A 3II1A 3ARTA 3GH5A 4GXPA 3WUBA 4B16A 4D1JA 1WZAA 4W5ZA 2PWDA 3VIFA 3EDJA 4GO8A 3CHCA 3K46A 1E6XM 4PRWA 3TONA 3WDRA 2WYSA 5E09A 2WC4A 2EXOA 4LYQA 3FAXA 3A4XA 1JI1A 4UCFA 4M81A 4CD6A 1XD0A 3WH5A 5CSYA 1OGBA 3VOCA 1EOKA 4AZ6A 4W86A 2XHYA 1BSIA 1Z32X 3THCA 3WH8A 3L4VA 4OBRA 3AXXA 2V38A 4QFUA 2F61A 1UKSA 1UWIA 4WKHA 4CCCA 4DUWA 1GCYA 2WZEA 1F9GA 4PMQA 3ARSA 3PBGA 2VX7A 1H2JA 2J79A 2J62A 2DH2A 3S6TA 1M01A 3M46A 1KCLA 1XSKA 3BAIA 4JCLA 1EDGA 5C71A 2WMJA 3A4WA 2QV4A 1EO5A 3OG2A 1QI4A 4UFIA 1JNDA 2GDUA 3WBAA 2QMJA 1OGSA 1V03A 2DSWA 3RM8A 3K4DA 1RP9A 2JF7A 3GXMA 2EQDA 2IXUA 3SUWA 3WKZA 4QCEA 2CESA 1JI2A 5JBFA 5GNZA 1UUQA 4D6FA 3W82A 4DWSA 1BTCA 3POCA 1GQLA 4Z2HA 3WY1A 4H2CA 4MNJA 4CUCA 4MNMA 5LA2A 3GXIA 4R5EA 1LL4A 2ZXAA 4UFJA 4ACYA 5IHRA 1XH2A 3DYPA 5DO8A 2J47A 5A6BA 3PTQA 2E8ZA 3DECA 5A6LA 2ESCA 2VR5A 4CGTA 4QLJA 1DEDA 2WXDM 3ARXA 2G3JA 2GK1B 4ZXOA 3WQ8A 4JKKA 3ZMRA 1VBUA 3CUHA 3RDKA 4FLOA 3GZAA 4TX6A 5CSUA 1E5JA 1EIBA 1V0NA 4AC1X 2JIWA 1UD4A 4UNIA 4P7OA 4QLLA 1PX8A 3ARQA 3NSXA 3U7VA 4MB5A 4TX8A 4P8UA 4PEEA 1UA3A 1ZJBA 4YPJA 1LOHA 4P7NA 2CPUA 3CZ8A 4Z2IA 1G94A 1KGWA 1B3ZA 3ARZA 5CQ1A 1WDPA 4W88A 4J3SA 3CZGA 4FMVA 1MWOA 1Q6CA 1KXHA 4CN4A 4HMEA 1J9YA 2XYLA 4A3HA 3ALFA 1KB3A 3KL0A 2WAGA 1M03A 5BXRA 1GOIA 3WNNA 2XSBA 4AISA 1UH2A 3PTKA 5A8NA 1B31A 3MANA 1S46A 4W7VA 3VIPA 1E0VA 1NP2A 3VGGA 2BV9A 2Q1FA 3MO4A 4U3AA 2XVKA 1UR9A 1J01A 1PZ2A 3OA5A 4D6CA 2DEPA 2J7BA 3EMZA 2E9BA 2ZOXA 4OJYA 2DPEA 3AROA 2VZTA 3ZSTA 3S2CA 1CB8A 3MMWA 4PUDA 1QHZA 2X0YA 1H4PA 3WENA 3O6AA 4M24A 4KRTA 3WEMA 1JAEA 1UR0A 1QI5A 1K9TA 1HJUA 3W4RA 2EPNA 2CBIA 2VL4A 3W28A 3N9KA 1BHGA 4HMDA 4V28A 2E24A 2WMKA 3AIVA 4MADA 3N15A 1VEMA 2WZHA 2FGZA 3ZR5A 1CYGA 3ZT5A 3M6DA 3TTYA 2BVTA 3CUIA 1WO2A 1NQ6A 2WHKA 3CO4A 3M07A 1PAMA 1GQIA 1QBAA 1KQZA 2W67A 4E8CA 3VMNA 4BCEA 1UR4A 1VEOA 2BXZA 4AD2A 3VU2A 2GDVA 1EQPA 2WC7A 4ATLA 2WVSA 1CLVA 1H09A 4L4OA 2X0HA 1BGAA 2VRJA 4AD1A 4P7QA 4UOJA 2D0GA 1V02A 1MFUA 3GNOA 1JXKA 3FAWA 3NSNA 2X09A 4HA3A 4GZIA 3CIVA 1Q6DA 1CXHA 2XSAA 2CITA 4KGLA 2A3BA 4Z2LA 2WWDA 1Q6FA 3JUGA 3DYOA 4PCSA 1CENA 2CIPA 2E4TA 2ZX7A 1OJNA 1EH9A 5I3DA 3WD1A 1JGIA 1EDQA 1GHSA 1W1YA 3AMGA 1HJXA 1QNOA 3SCUA 2CHNA 1C93A 1CEOA 2OYMA 1HJWA 2EPLX 2QPUA 1GNXA 4W85A 1E55A 2G3IA 4WIWA 3CMJA 1BVZA 3CPUA 4JIEA 1W3KA 2XUCA 3BAXA 1EXPA 1QHOA 4D1IA 4AEEA 4TUFA 2AOSA 1E43A 1TCMA 3EDDA 1G0CA 4W93A 2DQXA 2UY2A 1SMDA 4TTUA 2WKGA 3WH7A 4M8UA 1JF6A 2YBUA 4WKAA 5D4YA 1JD9A 3VPLA 3CTTA 2VX5A 3VGBA 2DIEA 2WDAA 1O7AA 1HIZA 3CUJA 3UCQA 3W24A 3NIYA 2D1ZA 4GO9A 2DGAA 1PJ9A 4A4AA 4UR9A 1KBBA 3AXIA 3PN8A 4CD4A 1N7QA 4WLCA 4LPCA 4B9ZA 1M53A 2QPSA 3EMQA 3NCOA 1V3KA 2XG9A 4QP0A 3BAYA 1JFXA 2G41A 1VJSA 3MV01 3VX0A 4LXFA 1R87A 1DWFM 2VTFA 4W8LA 3HU7A 1W91A 4AZIA 3ARUA 3UEQA 5IXEA 1ESWA 3VDBA 1MYRA 4CU6A 3IJ9A 1E73M 3QOMA 2X03A 3LPFA 1IV8A 3VD5A 1LF1A 1ITXA 5AY7A 3POHA 2WWCA 2VT0A 4MJ2A 2YOCA 3AZSA 1BF2A 1E9LA 3BH4A 1W9BM 2WVUA 4XUYA 1OT1A 1KWKA 1ISYA 1Q6GA 3HJEA 1E72M 1EDTA 1FH7A 2W61A 2VVSA 2WBKA 1OINA 4MDPA 2XWEA 2C7FA 1V08A 1GOQA 3OGSA 3GNRA 3WN6A 2WMIA 2DT2A 1E6PA 2VMFA 3T0BA 3OLGA 4XZWA 1BG4A 2YA0A 2GJXB 1W1PA 5FIPA 2VX4A 1UD5A 1NH6A 3VM5A 1HMWA 4D71A 4PMRA 1N7PA 1HVXA 4AZBA 7A3HA 2FDMA 1HN0A 3CGTA 1C3FA 3W81A 1WCGA 5CPQA 5AC5A 3L2MA 4PTVA 1SYTA 4U5KA 3VIGA 3I3EA 1UZ1A 3MUZ1 1OT2A 1HM3A 1W2VA 4E8DA 5A1AA 3AYSA 3VNZA 6TAAA 4UOQA 1V02E 5CLTA 1AMYA 1H41A 4D6JA 3WH6A 2VJXA 4ZE4A 3FN9A 3N04A 2J7CA 2VO5A 4DWSC 1ZL1A 3IJ7A 3OB8A 2G4FA 3W27A 1RW9A 1JNEA 1TE1A 3MUY1 1RWAA 3I3BA 3L4YA 3AIRA 2E0PA 4MB3A 5M3WA 2D0FA 1BYCA 3GXFA 3PZQA 2W4XA 3W6MA 5CLWA 2ZX5A 3VKKA 4JKLA 3DYMA 1QI2A 4MJ4A 4BS0A 2GUYA 1X6NA 3VIMA 1KXVA 1CPUA 3OLIA 3RO8A 1G01A 5I23A 4GQRA 1E1FA 1EOMA 5FKYA 3CBWA 1JZ7A 1W9PA 5CXPA 3HMCA 3N17A 3VM7A 2WPGA 2BXYA 1JZ2A 1A3HA 4TXEA 1W3YA 1UKOA 3MS8A 1GUVA 2WLYA 3O9NA 2WCSA 1X1NA 2BY2A 1RWFA 4GINA 1GQJA 3BAJA 1K6AA 4C7GA 5I77A 3GH4A 3AYRA 2JE8A 4NF7A 1JG9A 1HXJA 2W62A 5I78A 4RE2A 1CGVA 2BNJA 3PZIA 3AIEA 1J0YA 3NSMA 3VO0A 4W7UA 2EPOA 1MFVA 4Z2JA 4CD5A 3WMBA 4UFMA 2D24A 3APGA 2ZIDA 1JIBA 4UZUA 1E56A 2RGLA 4HZ6A 4QCFA 3WMSA 4FLRA 5BCAA 3WF0A 3MSGA 3L4WA 2V3GA 4Q22A 2J78A 1C8YA 2VCAA 2CYGA 2CBJA 1YQ2A 2VURA 3RILA 1N7RA 3VIOA 2VUYA 3GM8A 3WD4A 5F7UA 4UTFA 1UWQA 1JAKA 2A3EA 5E6ZA 5EFDA 3WDPP 5I0DA 5JBEA 2YL6A 5ABFA 4WSKA 4HZ7A 5ABEA 1HJSA 3VUPA 4BQ4A 1ZB5A 3SIMA 2YKKA 4W5UA 4ATDA 1EO7A 1UH3A 3BLPX 4JCMA 1AVAA 3VGDA 4GI9A 5BROA 1E71M 3SUSA 3SCTA 2WB5A 4J3XA 4UOZA 2VZSA 2ZXQA 2JEPA 4HP5A 5M5DA 2Y4SA 4AEFA 4CU8A 1HP4A 1E4NA 2JF6A 2ZUVA 5IFPA 1ISVA 2E22A 1BPLB 5D9MA 4F9DA 1D7FA 3NUKA 5E70A 1QHPA 3RM9A 2G3MA 1UD2A 4PMXA 5BXTA 4JAWA 4NRSA 4AZ7A 4U3CA 2CERA 2A3HA 3WL0A 4BQ3A 1J0IA 4PSRA 3D5HA 1V6XA 1CBGA 4H8VA 4AYSA 2WK2A 1JD7A 1GOWA 5I24A 3MMDA 1C91A 2GJRA 5AC4A 4UQEA 3WFLA 4F9JA 4JHOA 2PC8A 1J0NA 1US2A 3ZOAA 3PHAA 5CG0A 3QGVA 1U33A 1Q4NX 2J75A 4V27A 3UG3A 1KGUA 4JZ5A 2PB1A 1VRXA 2CETA 4OZOA 2W91A 3RMEA 3TA9A 2VCBA 2VI0A 1R8LA 2VX6A 2J4GA 2CKSA 3WDJA 3CH9A 1QW8A 5A8MA 4IISA 1EGUA 2WBGA 2VQUA 5IFTA 1E3ZA 1UD8A 2QHAA 5D9OA 4YN5A 3WMCA 4AZ5A 1MXGA 2YL9A 2WNWA 4OOUA 2OWWA 2C8NA 3UETA 3AMKA 1M7XA 2YL8A 3TTQA 1UWRA 5A8QA 1K9FA 1XCXA 2Y24A 2E8YA 2FH8A 3FHAA 1CGTA 5IDIA 4WJXA 5AYIA 1UYQA 1LWHA 4XZBA 5AYBA 1NWSA 4PTMA 3PZTA 3A4AA 4KMQA 4S3JA 3AIWA 5A2BA 1UKTA 4F8XA 3FNDA 4KGJA 5BXPA 1ZU8A 4B15A 4V2XA 3UR8A 2ZXBA 1CXEA 4PMVA 1TA3B 4RE4A 1OJPA 2E9MA 2DSKA 3QHMA 5BWFA 5KZ6A 2NW0A 5CGMA 1DTUA 1PX3A 1XD1A 4Q7NA 4F79A 1OBAA 2EBNA 2JALA 3PZNA 4UQ9A 4CD7A 3AHTA 1E6SM 1MW1A 2WVVA 4D6GA 2J7DA 2WVTA 3F5KA 2GSJA 2EEXA 1ZBCA 1E40A 4GZJA 1C82A 1H0GA 1R86A 1E6QM 2CCRA 1W1VA 4E2OA 1UD3A 4U31A 3WIJA 1MXDA 1V6WA 4GZEA 3OZPA 1OIMA 2WHMA 1R85A 1WDQA 1JYNA 1UKPA 2WSPA 3N11A 3T2QA 3T2OA 1U30A 2C0HA 3N13A 5A3HA 2WW5A 4HA4A 1E6RA 1GZJA 5HNNA 3D3AA 4B3KA 4CCDA 2XVLA 4CD8A 4ZEPA 2E3ZA 3IAPA 1IT0A 5ECUA 1JDDA 1CWYA 4ZFMA 4EKJA 5HOSA 1BYDA 5E0CA 1C8XA 2XGIA 5M03A 1I1WA 3EMCA 5D8ZA 3KE0A 2XJ7A 1HKKA 5C70A 1C7SA 1GONA 5A8OA 2FHCA 4FK9A 1EQCA 3K8LA 5EBAA 3WEZA 4ML4A 3AI0A 4M1RA 2YA2A 4P7LA 3DHPA 4W89A 2OLHA 1LJYA 1OWQA 5LYRA 3GBEA 2O92A 1E4LA 3SCRA 2O9RA 7CGTA 4AD4A 2ZE0A 1VENA 1HX0A 4RL3A 4ZENA 4OUEA 3WNOA 4Y7EA 4U33A 1PIGA 1GJUA 3F5LA 2G8ZA 1VFFA 4CCEA 2V5CA 3AHZA 2DT0A 5FCZA 1I8QA 9CGTA 2NSXA 1SMAA 4H41A 1AQHA 2QMKA 3K4AA 2VCCA 3SCNA 3WF1A 5DFAA 1V3MA 3LMYA 4PUEA 1H0IA 1LL6A 2YJQA 1G5AA 2A3AA 2BHUA 3K8KA 1UA7A 1VIWA 4X0NA 2O9TA 3OLDA 3ZJ6A 4NZCA 4PMOA 1A47A 1NARA 5FD0A 5I79A 1B90A 3IANA 1XH1A 2XM1A 2BHZA 4PTXA 2V3EA 1NWUA 4D6EA 1ITCA 2VVNA 1X1HA 2J7FA 4MAVA 4F66A 1V0KA 4N0RA 5HBFA 1P6WA 3VILA 2XFRA 3VD7A 5HPOA 2XWDA 3WQWA 4HMCA 3ARVA 1WZMA 1GVYA 1C90A 1HF6A 4ACZB 1KWGA 1OCQA 3W53A 2GK1A 3VX1A 3BSHA 1HN1A 5BXSA 1QOXA 1MQQA 2DH3A 3PZGA 1BQCA 1WZKA 3VINA 4UQBA 3CMGA 3J7HA 3AMLA 3G6LA 5EFFA 1WE5A 1VBRA 3WL1A 4LX4A 4M82A 3KWXA 2X2YA 3T0DA 1F4AA 2D22A 4URIA 1KBKA 4MPKA 3WELA 2X05A 3AICA 2VC9A 2OYKA 1B3WA 1FH9A 1I1XA 4AD5A 1LLOA 4GI6A 3LPPA 2V3FA 4QDMA 4M80A 3WBEA 1OD0A 3VDCA 1EHAA 7TAAA 3GH7A 3L2LA 2IUZA 3WEOA 4MB1A 3VGEA 4TOQA 3TP4A 1M04A 1FOBA 3A6OA 3RIKA 2GVYA 2J8GA 3ZSSA 1MW2A 2ZUMA 2QF8A 4AW7A 4C7FA 4MTVA 3QHOA 2WHLA 1PEZA 2OWXA 1TA3A 1E0XA 1RWGA 1E4MM 1JZ8A 1CGWA 5CGTA 1E6ZA 1ZS2A 1W2PA 4IPNB 4J28A 4M56A 4X9YA 5LA0A 2VQTA 1UOKA 2X8RA 2XIIA 1C8QA 1J0HA 4K68A 3UG4A 1E3XA 3CHDA 1US3A 4WK9A 4D6DA 2WLZA 4CN6A 1NOWA 4PTWA 1DHKA 2BVYA 3WD2A 3A47A 1J0KA 1KR1A 3EDFA 1W32A 3ARWA 3HN3A 1B1YA 2CXGA 3WQ4A 1I75A 1OM0A 2ZX6A 8CGTA 1CLXA 3BXWA 2D2OA 1FA2A 4KWUA 1TUXA 3VD9A 4OOZA 3DC0A 4R27A 2WZIA 1OB0A 1G1YA 4UZSA 5DT5A 2YA1A 4C7DA 1TZ7A 1DWJM 2YLAA 1CGXA 1Q6EA 3BSGA 4GIAA 1QPKA 1MQRA 4Z2KA 1ODUA 1U2YA 3ZR6A 1JDCA 3AOFA 4J3WA 3SEPA 3MSDA 3VD4A 2VZVA 1GHRA 1X1IA
chains in the Genus database with same CATH superfamily
1W5PA 4X2RA 4XD3A 5F4WA 2HK0A 1QUMA 1TWZA 3WBYA 2OYLA 3BK0A 1PKLA 4IT1A 4DN1A 4NG3A 1VJZA 4Q4OA 3FKRA 1LQ0A 1UR8A 4GXWA 1OK4A 2UZ9A 3AQUA 5LNRA 1FDJA 2BB0A 3PSWA 4LC8A 5EMKA 3QPEA 3TR9A 1A53A 4Z1DA 5LIXX 1LZOA 1X6UA 4CQDA 1Z41A 4PR4A 4AWEA 3EPMA 4L9YA 4F0LA 1J4EA 6XIMA 1BTMA 2Y88A 5E1QA 2I14A 3B8DA 4QG6A 4O52A 1J11A 1ZQ5A 1UPMB 1FTXA 4KEMA 3DFYA 4W7WA 3W29A 1X38A 3TSBA 1B54A 3IRSA 4IIFA 3W7CA 1W5QA 1QWKA 2IQDA 4U10A 2OB3A 4UBPC 1H11A 1LT8A 2FQIA 3GG0A 1YDNA 3NXLA 3T08A 4MUZA 7TIMA 4U5IA 3VTRA 1AQMA 3EX2A 3VNYA 1OGGA 3EXRA 1D8WA 2E6AA 3CQ0A 1LLWA 3LGGA 3UWVA 3G1YA 3BAKA 1FCBA 3PAOA 3KZPA 3VDHA 4DUVA 1H3GA 4O13A 4BA0A 2ZUTA 2HJPA 3BGAA 3R89A 1QI0A 1JFHA 3HV9A 5C8BB 4L4LA 3CIXA 3OBAA 2E28A 2QJHA 3FS2A 3SCOA 3MUXA 3TX9A 3WDQA 1OYCA 2C3ZA 4ACZA 3AC0A 3AWNA 3TFCA 3LDVA 1H50A 3A3WA 2PDBA 3B8SA 3MJYA 1K7XA 5I3JA 5JH1A 1GWJA 3ZJKA 1KRAC 1W3LA 4MVAA 1ICPA 2PD9A 4PBGA 4O53A 1QBBA 1Q45A 2GL5A 3HFTA 3LBMA 4H9VA 4XZLX 2VDIA 4AC7C 1A4LA 2CZFA 1F6KA 2HS8A 1F61A 1ZNNA 4MKVA 4ZOEA 4KIRA 1VFUA 1JVNA 4NZ4A 1QK2A 1SJBA 3GIYA 3AISA 2VGFA 4D6IA 1JCLA 3W7DA 3NL2A 2R1PA 3O7UA 3AS0A 2VZUA 4C1NB 1E15A 1OQFA 3WNPA 2Y2WA 2ZYFA 2QIIA 2EPKX 2YDQA 5JUVA 1XHGA 2WJEA 3CUGA 2F6UA 4B2DD 5A8PA 3DHDA 3R8RA 5HWJA 5BRQA 1J79A 1AZ2A 1YNPA 2PRMA 1VHCA 3WJZA 2V2DA 4JFUA 4UC5A 3RPMA 4FF5A 4O0QA 4UQDA 2PTYA 1R3SA 1FP9A 4XSMA 4GUGA 1TMQA 1XC4A 1XC6A 3QPYA 4CQAA 1XLKA 1RPXA 4FPSA 1NTHA 4HU0A 3H54A 2POZA 2W66A 4H19A 3CZKA 5AC8A 5JU6A 4BQ2A 3T09A 4C91A 2AAAA 1UBSA 1NM9A 4MNLA 4PCPA 1U5JA 3EWWA 4WSJA 4JTRA 5DY3A 4S3KA 1YXYA 4AAJA 1WXZA 4YHGA 3S6OA 5ABHA 1HVQA 3VNIA 4CNUA 1WDSA 1L2UA 3KRZA 3BCDA 1ONEA 3N19B 1F2JA 5TD4A 5LA1A 4IMDA 4LB4A 3GBDA 2XPKA 2MNRA 2PRLA 1KXQA 4PSPA 3MUIA 2CZEA 3W26A 2YSWA 4HTYA 4ATWA 1UZ4A 4EAMA 4NZFA 4F3HA 3BWWA 3DENA 3P8IA 4IP4A 3MHGA 1TR1A 1NF7A 1ME8A 3QR3A 5GNXA 3CB3A 4PMZA 1JL8A 2PDMA 2V3DA 1W1IE 2Y62A 4KCTA 3ZJ7A 3H2EA 1Z42A 3KL3A 1SJDA 1WKEA 4FALA 3P80A 3FDKA 2OLSA 1DJWA 3IJQA 4JBRA 4R3UA 3QOKA 4IIDA 4CQBA 4CKQA 2I7GA 4I90A 1SR9A 3M5XA 1WNOA 3UWEA 3W25A 1P43A 4JNMA 3W1TA 3CHFA 3GVWA 1UJPA 4LS2A 4X0VA 4US5A 4H7VA 2ISWA 1QI3A 4ZQPA 4EXQA 1XG3A 1SZFA 4EX4A 3K8MA 2GGHA 4D8ZA 5I3FA 1UWSA 4MFEA 1VEPA 1VFMA 1FFQA 2B7OA 3LM7A 1OFDA 1HKMA 4FOJA 2ATMA 1EJVC 6REQB 3ZM8A 2QF7A 4M1BA 4ZTXA 2VRQA 4JY8A 4QSFA 1CXFA 4MYXA 3G5EA 4KCUA 1B4KA 4I7UA 4UR7A 3CJPA 2AL2A 1XIBA 2Z1XA 4JIPA 3GHSA 3PZOA 3WQGA 2Z7KA 4OBTA 1R3RA 4J3TA 4YU1A 1XG4A 4GVFA 1DWGM 2UY5A 1LWIA 1J0ZA 1HJVA 1XLDA 2D3LA 5CJMA 4E4PA 1ZP3A 3FY1A 3P0WA 4EK7A 4NU7A 1NDYA 4XKYB 3GVGA 1LL7A 1CNVA 3QGAC 2J25A 4K1WA 3VGFA 1G9HA 4YTQA 1O94A 3HF3A 4XAFA 2Z2BA 4DUXA 3G3DA 1MNSA 5D03A 1XGDA 4A3YA 3I68A 4XD4A 4YCPA 1JRCA 5PTDA 1V6UA 1VR6A 1H1YA 4AIBA 4PMDA 3LHVA 3ABSA 3KBNA 3VVGA 3P84A 1KRBC 2Y8KA 1UWTA 2QCCA 4B3LA 2OT1A 3ARPA 3AIBA 2WCOA 4M7SA 2Q02A 4JIRA 4F2UA 1BFNA 7ENLA 3ZLHA 1V3JA 3RM4A 2Z6IA 4LWWA 2DSVA 4P8VA 3U2OA 3RPDA 3SFKA 3GD6A 4EPDC 4WY0A 1K8YA 1QRQA 3H6OA 5F2MA 3W38A 3FXYA 2NX3A 5I6SA 1HNYA 2WM0A 2FTPA 4MDOA 4AXKA 1DJQA 4TU1A 3W7JA 3G3MA 3G0UA 4AEOA 3E0LA 1P4CA 4ICNA 7REQA 3VIIA 1TVLA 3O8AA 1KFJA 4LBRA 2VEMA 2PLCA 1I0BA 4UTMA 1O0SA 1I9CB 1HM2A 2FPVA 3B9OA 1OY0A 1J93A 1GPWA 4KRUA 1RY0A 4A6GA 1QAPA 1D8CA 1GOXA 1HT6A 2QJMA 2BY3A 3TYEA 4UFLA 3UYIA 3EZ4A 3W22A 2OGJA 3VOHA 3W72A 5CCZA 1UW9A 3WH9A 2NV9A 4NSBA 3QPZA 1K7FA 3NURA 4LAUA 2D0HA 2Q71A 3O16A 1KQYA 3AHVA 4GQBA 2BRWA 3SCVA 1R38A 1VFHA 4RV3A 3SIZA 3ZQ9A 3VIHA 1JYWA 4IPPA 3MWCA 4N6FA 4GNKB 4LVAA 5A69A 1A5UA 2YDRA 1UG6A 4DJFC 1CTNA 4U2YA 2CHOA 4MB4A 5G2IA 3NA8A 4H9TA 1W3JA 2O9OA 1D9EA 3EAUA 4WKFA 4F48A 5CC7A 4HZMA 2TPSA 1ZBVA 1QATA 3KOWA 4BF5A 3A22A 1GK8A 3SN0A 5GVJA 3WJWA 4IWWA 4OFCA 3PVFA 5HDRA 4JX6A 5D37A 3O2LA 4WEVX 5E6YA 3F1QA 3AS1A 2ZA1A 1RPKA 1QNRA 1I45A 1W3HA 3VNMA 1EJWC 4MPQA 1DP0A 3LUTA 3SUTA 1BYBA 4KFPA 4D8OA 3BVJA 1XYZA 1ZAHA 1FP8A 4F2BA 3B9EA 7XIMA 4RKAA 1E0WA 2NLYA 4I9JA 4PODA 4IG2B 1RLDA 3NM1A 4AMCA 3IJ8A 2VC6A 5D8WA 1K03A 2H3BA 5ABTA 4CU7A 2XVPA 4BF7A 5B7ZA 3AZTA 5HK4A 3SO7A 1BXBA 3URBA 3DFQA 2QGYA 3P82A 3PBVA 2Z1VA 4IMEA 3T4CA 2ALDA 4W87A 1F6YA 2QCDB 4BHYA 2ZZ7A 1RAKA 2VZKD 5FOOA 3NQ2A 1YDVA 2ZXDA 3BLOA 5DF0A 2PAJA 2QLYA 5TNVA 3UERA 3MDUA 3H2NA 4PMUA 4QG9A 3DI1A 3EYPA 2GUUA 3URNA 1JYVA 3G1RA 3NQAA 4AZGA 1ZBKA 5A6JA 4RZBA 2BGQA 1R7OA 3MA8A 5AYZA 3KVKA 5AZ0A 3RJXA 3L4XA 4UUIA 3LB0A 3GR7A 5C5YA 3TIMA 4B5XA 4OHQA 3UESA 3SY5A 1GPFA 2NUYA 2R94A 4IM4A 4HA1A 3VMOA 2WSRA 4YVXA 4GYKA 4Q32A 3UQNA 2HSAA 1Y65A 4Z1CA 2A79A 3KXQA 4L6HA 3EDJA 3S2JA 2BASA 4GO8A 4AQLA 2CZVA 3CHCA 1E6XM 2A5HA 4L61A 4PRWA 3U6WA 2WYSA 2C91A 5E09A 2VZKB 4LYQA 4NZ3A 4DZIA 2PDWA 2ZCGA 4M81A 4DJFA 1W37A 3WH5A 2DU2A 3OYZA 5F2IA 1EOKA 4AZ6A 3LCXA 3FK4A 3THCA 3FFSA 4OBRA 3AXXA 5IM51 1WOBA 2Y89A 5C9XA 3IEBA 4DUWA 4WKHA 4PUNA 1GCYA 4HYVA 2QUNA 4GGHA 4RV8A 3P2VA 2VX7A 1GVQA 2J79A 3LCFA 1KCLA 3W1MA 3IUHA 3GLCA 5C71A 2WMJA 2ZC8A 1RZMA 1EO5A 5DBUA 1XF0A 4I3GA 2ATSA 3MC5A 2CLKA 2Q3OA 3HG5A 5C54A 1L6SA 1KCXA 3CWHA 5BWAA 2DW7A 2CESA 3WK3A 3R6IA 1IGSA 1EC7A 3R5EA 4WXZA 3PPFA 4OE7A 1OFPA 4DWSA 5T9CE 4Q7BA 4WVXA 4Z2HA 4FX8A 2Y7EA 5DELA 4US6A 1NEYA 4ZQMA 1LL4A 3KOFA 1PKMA 3OYXA 5F1UA 5A6BA 5A6LA 1OFOA 4BEQA 2GQ9A 4HBKA 4O1AA 2I56A 3WQ8A 4B92A 3FXGA 2NQJA 1JEZA 3TN4A 3KDOA 5BMXA 1P48A 1WKDA 4CEXC 1V0NA 2J9YA 2JIWA 5CZTA 3FEQA 4ZBCA 2XN2A 4WHBA 4LRTA 1YPXA 3TDFA 4MB5A 4P8UA 4PEEA 3Q65A 4HCHA 4P7NA 3RHGA 4Z2IA 1E9ZB 1B3ZA 4IQLA 1SVDA 1WDPA 3NFUA 4J3SA 3QSRA 1Q6CA 1KXHA 4CN4A 4MJZA 2B7PA 3QN3A 3S1VA 1RBLA 2C1IA 1KB3A 3AXKA 1ME9A 2D2GA 3ITXA 4ADSA 5BXRA 1GOIA 5FF2A 1GVSA 2YCKX 3IPWA 3PTKA 1B31A 4QDPA 1BWLA 4MYAA 3NGFA 3T07A 3U9IA 3VIPA 1E0VA 3LQGA 3MMTA 3MO4A 2VKZG 4EPBC 1A0EA 1UR9A 4TR9A 3E02A 3QW4B 4D6CA 2E9BA 4ONVA 3VNKA 3AROA 2F2KA 3MMWA 1QHZA 3O6AA 3I6RA 3H8AA 2X7VA 3WEMA 1JAEA 2I57A 1K9TA 3M0VA 3W4RA 2EPNA 2DZSA 4QJ1A 3W28A 4IQDA 1TPFA 2HE5A 3AIVA 1UZHA 4NI8A 5LSMA 2WZHA 4DLQA 4IPIA 4OV9A 1B4EA 1CYGA 3ZT5A 4BKNA 1YDOA 1PAMA 2O55A 5CSRA 4QEEA 2BXZA 4YTTA 1S2UA 1XCFA 3Q45A 3VU2A 2GDVA 2FVMA 3UPMA 2VOMA 4JTFA 1LDCA 1TTQA 2BOEX 2QAFA 1ECQA 4UOJA 2QQ6A 1FX6A 2G5WA 1MFUA 1DOSA 1JXKA 3FAWA 3GY1A 4GZIA 3CIVA 1Q6DA 4Q8NA 2F6KA 4PTNA 1QXLA 2WWDA 2GDQA 3S8HA 1VH7A 1DQUA 3GFYA 1FWSA 3I4KA 3WD1A 1JGIA 1LUCA 3PTDA 1I4NA 2CHNA 4O4WA 3SCUA 1H1ZA 1EF3A 1E55A 4WIWA 5FAJA 3CMJA 3KS6A 1DIOA 2BXVA 4D1IA 2ZDSA 4AEEA 3MT1A 2AOSA 1TCMA 2YCJA 2PDIA 3IGSA 4W93A 2PDKA 1W1A1 4G56A 1IYXA 3VCRA 3UZJA 4IJCA 1JF6A 3W88A 3U2CA 5D4YA 4PUUA 4OU1A 3LU2A 4HKPA 4ZO8A 4KQNA 1PCWA 3VGBA 2DIEA 1AD1A 1HIZA 3UCQA 3W24A 3NIYA 3VOIA 1D3GA 4XKMA 1I2PA 1PJ9A 3QGKC 4GE8A 4A4AA 3M43A 1KBBA 1U1UA 3PN8A 3T6CA 3EX4A 4CD4A 2WJFA 4WLCA 4IXXA 5GJPA 2XIQA 3NZGA 4B9ZA 3PANA 3IIZA 1QO5A 1V3KA 3TMQA 3BAYA 5CC6A 4K37A 3UCDA 2ZRVA 3DCPA 4F0MA 3ZVHB 4AZIA 3UEQA 3TYBA 4CU6A 1R46A 1O1ZA 3LGDA 3TQVA 3LPFA 4LOCA 4AVOA 4LAZA 5AY7A 2NQ5A 2W79A 1BRLB 3WQEA 3POHA 4HSHA 1VBHA 3UXKA 5I09A 3TMLA 3PP7A 3MYPA 3QH2A 4MOZA 1XBVA 3B8VA 2VEKA 1Q6GA 3O3RA 4A2SA 1EDTA 5AYYA 2PDQA 3C5QA 5C0QA 4MDPA 1I2RA 4B4HA 1V08A 1TUFA 2C1GA 3OGSA 3WN6A 3DFPA 2DT2A 5FEXA 2D2HA 3MHFA 2GOUA 2NV1A 2ADAA 3MWAA 1EX1A 1QFEA 1H7WA 2YXXA 5H8PA 2ZA3A 4PMRA 3FV9A 3RCYA 2FDMA 1TZZA 3WBWA 2XU2A 1R9XA 3W81A 3NPXA 2AGTA 3EPOA 1P0NA 5AC5A 3SQMA 3VA8A 3E5PA 2JKPA 4O50A 3N34A 5CBBA 3DFOA 5A1AA 2YW3A 3IWPA 6TAAA 5D02A 1V02E 3M0MA 4D6JA 3FSTA 3WH6A 4AF0B 1OZMA 2J7CA 3WYZA 3WCZA 3GVVA 3OB8A 1TE1A 2NWSA 1RWAA 4EOUA 3L4YA 3AIRA 5B80A 2RJHA 4AY7A 3PZQA 2W4XA 5AVNA 3H21A 5CLWA 4LCRA 1NIUA 3VKKA 5C2XA 3TYAA 1QW7A 1HL2A 1X6NA 4E2BA 2CLEA 1KXVA 3OLIA 5G4EA 1G01A 2EGZA 1I0DA 1VQTA 5AC6A 1E1FA 3NZPA 3CAWA 4KT2A 3CBWA 1W9PA 3TSMA 3VM7A 3WZ0E 1UR3M 2WPGA 1SFLA 2BXYA 3MKCA 4K7YA 2ZVRA 4L1GA 4DBWA 5HJXA 4ZQRA 3TQKA 1GUVA 3R10A 4GWEA 2FZ9A 4X3ZA 2DVXA 3O9NA 1FWIC 2BY2A 3KRSA 1RWFA 3GH4A 2P88A 1YTDA 2P1FA 1JCNA 2P10A 3FOKA 3GU9A 3EA3A 3APGA 5AFDA 5DCEA 2W3ZA 3WMSA 3WF0A 2FZMA 5CH9A 4Q22A 4S2CA 2J78A 3V4BA 1UZDA 2CBJA 1N7RA 3VIOA 2VUYA 3WD4A 4C1KA 2PDLA 1SM9A 1O1HA 3LENA 3EB3A 5E6ZA 5I0DA 1WOAA 1ZAJA 4Z0JA 4ZZ9A 4GYPC 3I65A 1SO5A 1WUEA 2Z00A 3SIMA 3W7GA 4ATDA 2NSOA 2RFGA 1EO7A 1TO3A 3ELFA 1RV8A 3M0XA 1E71M 3M5ZA 4PBEA 4PUMA 3W7PA 4QAIA 1SSDA 4J3XA 4QNEA 1PDYA 1XPGA 4S3EA 3UR2A 2GZXA 4IX2A 3A24A 2QPXA 1MNZA 3WLRA 3MPGA 1BPLB 1VLIA 3AYTA 1XDLA 1XYAA 4G7FA 1D7FA 3NUKA 5EKYA 1MZRA 3OU8A 3N4FA 4NYYA 3RM9A 2G3MA 4U3CA 4A3RA 1TTIA 3W2UA 2A3HA 4GJJA 3LCLA 3ZLFA 4LCSA 4OV4A 2WK2A 5EL1A 4TMCA 1RK5A 4YTUA 5D09A 3H4GA 3UFYA 4F9JA 1ENUA 2PC8A 3KVJA 1ALDA 3LGEA 3PHAA 5CG0A 4C6JA 2CETA 3CH0A 2W91A 1BXNA 3TA9A 2VI0A 1R8LA 1XR2A 2J4GA 4E4FA 3CH9A 4HNCA 2KX9A 3ZS4A 4DAIA 1EGUA 3F7JA 4O15A 3ABOA 2V81A 5D9OA 4YN5A 3WMCA 2PTZA 3C61A 1GZ1A 4GCXA 1YTEA 4OOUA 2C8NA 3KOXA 4XBSA 5G4HC 4B5TA 3CASA 3COTA 5U4NA 2YL8A 2WM1A 1K9FA 4PFHA 1XCXA 4M0XA 2Y24A 4GX8A 1GVOA 2FH8A 3GIQA 4DF0A 4UMBA 2GOKA 1LWHA 1S3HA 3CEPA 4XZBA 5AYBA 1NWSA 2I9UA 4PTMA 3NZ1A 1JQXA 4PMJA 3PZTA 4KMQA 3A4AA 3C56A 3P5YA 3AIWA 3P93A 5A2BA 2PGRA 3PF3A 1PHWA 4XQ6A 2QJGA 3P7YA 1ELSA 3P61A 1TA3B 5KZ6A 2NW0A 4DYEA 5CGMA 3AU6A 3LY0A 1XD1A 4Q7NA 4HHPA 1QASA 4JQAA 1K3UA 2EBNA 3WQPA 1DKWA 3TC7A 4UQ9A 4MWAB 1MO0A 3GQYA 4O1FA 2YFOA 3GFXA 3F5KA 1LRQA 3E0IA 4L5ZA 1FUYA 1YBQA 4GYPA 4AFYA 2EEXA 2V5KA 1C82A 3A21A 3WMLA 4L6OA 2QVHA 1E6QM 2CCRA 1GQNA 3TUUA 4U31A 5CZJA 5AOUA 4FI4A 4MZYA 1MXDA 4GZEA 3FDGA 3H7UA 1EJSC 2WHMA 1WDQA 5FAGA 4IMFA 3T2QA 2Q01A 2C0HA 4HA4A 1E6RA 1GZJA 4W4QA 5HNNA 3D3AA 4B3KA 3HQ1A 3E0FA 3CO8A 2E67A 3W73A 1U22A 5HAOA 3QF0A 5ECUA 1JDDA 1YPFA 3HM7A 2FYMA 4Q4RA 4WQ6A 1IWPA 4UNKA 3UPBA 3W76A 1UWAA 3KE0A 1C7SA 1V51A 4FK9A 1E51A 1EQCA 4PBFA 3K8LA 5EBAA 4BJHA 4ML4A 2ACRA 3UW6A 3AI0A 1AK5A 2HPIA 1UC4A 3KBJA 4F0HA 4Q8VA 2O92A 4NP7A 1HX0A 4RL3A 3IV3A 3DI0A 2F38A 5LNUA 2IKIA 4L80A 4HN8A 4CCEA 1OK6A 5HWNA 1XISA 4LF2A 4NJIA 3EPNA 3AHZA 9CGTA 2IKJA 5I3HA 2ALRA 2FJKA 1J8VA 1TPVA 3W70A 3WF1A 1XYBA 1QWGA 3CK5A 1J5TA 3LMYA 3PJUA 1DJYA 4LUYA 3UXAA 4FIRA 4X63A 2Y5SA 4R34A 1VIWA 1O66A 1H7OA 1MI3A 3OLDA 4REQA 5REQA 4XBKA 3GZ3A 1B90A 2I5GA 3NZQA 4RDWA 2XM1A 2NQ9A 4NQ1A 2BHZA 4DBDA 1H51A 3TR2A 2CLLA 2A85A 2V3EA 4YYFA 1NWUA 3ITOA 1X1HA 3ITYA 2J7FA 3LI0A 2B0MA 5HBFA 1P6WA 3VD7A 1XL9A 3DOPA 1KLZA 1WZMA 1GVYA 4A22A 4ACZB 2Z1BA 4QR6A 1J2WA 2YXGA 5E5CA 1HN1A 3EB2A 4PL1A 3NQGA 3VKCA 3E3HA 3C0JA 3N2XA 3BCJA 3J7HA 2ICSA 1A4MA 5EFFA 2QCNA 3O05A 3WL1A 4M82A 1IEVA 1GTHA 5KETA 2OYKA 1IIHA 1RK6A 5K2ZA 1NJJA 2V3FA 1OFAA 5FJJA 7TAAA 2IUZA 2R9RA 1Y5WA 2J8GA 3KVMA 2ZUMA 4KEZA 4C7FA 2NXIA 3BE7A 3FA5A 1JZ8A 5CGTA 1P7TA 1ZS2A 4LVGA 3WG6A 1AW5A 1KKRA 4PUKA 1FVPA 3H7RA 2YDAA 2G95A 5FACA 1E3XA 3CHDA 4DNMA 4AX6A 4CNNA 3KM8A 5J5DA 4MY9A 2BG5A 4YVPA 1J0KA 1W32A 2J9XA 4NZJA 1R30A 3W2JA 3IVTA 4Y6GA 5EBUA 3OQ8A 1UCWA 4ROQA 3LS9A 2ZX6A 3BXWA 1FA2A 4E8GA 2YBVA 4KWUA 3DC0A 1QPOA 1G1YA 2XN0A 3TNOA 2YA1A 4C7DA 5FJTA 1VC4A 5CPLA 3WJXA 3BSGA 3GO2A 4US5D 4GIAA 4KESA 1QPKA 3R0UA 1KBLA 3N9RA 3VD4A 2ON3A 4YIWA 3ANUA 3VDGA 6TIMA 4LUTA 3OZOA 3C0QA 3LXBA 1W6TA 3FJLA 1LOLA 2Z2UA 1E4IA 5DRIA 4JR5A 3I7SA 2UY3A 3QC0A 4EPEC 5A6MA 4GC4A 1GOKA 1ISZA 2NT1A 3E96A 4Z0SA 2FFCA 4Q8TA 3HPAA 3CZEA 3TC3A 1BVNP 3OVRA 1GG1A 4IX0A 3BUVA 2ZWZA 1V6YA 1CIUA 4TTGA 1TB3A 4AD3A 5A8GA 1QVBA 4B5SA 2JIEA 5CC3A 3B3DA 1MQPA 2YLLA 4L1XA 3AXMA 4UTUA 1XRFA 2DT3A 4UQAA 1B5TA 1R3QA 1S5MA 3UWUA 1ISXA 2DJLA 1WYIA 3NPUA 3BARA 3OEXA 1AD4A 3R2GA 4U2ZA 1XKYA 1FWFC 2HISA 2JKEA 4A35A 4JKMA 2BX7A 2VOTA 1NVMA 1A5CA 5JH2A 2DFAA 5FESA 4JFWA 4KWVA 1KM3A 2YCLB 3BG5A 1OX6A 2BFGA 1GOOA 3D6NA 3M9YA 3GDRA 4G2DA 5K9DA 4JTSA 3SM0A 2ZRWA 4P61A 2YL5A 4GKLA 1TV8A 2AL2B 4K8HA 3QHNA 2Z29A 3KL5A 1EJXC 3LV5A 1WB0A 3GTNA 1D2KA 5GQBA 1CGUA 4V1YA 2E40A 3TQPA 4IGHA 4W8AA 4HOWA 4Q7IA 3GC5A 3E1F1 4JIHA 4IP5A 2QCEA 2DV0A 1XIHA 1PWMA 4ERIA 2QULA 3L4UA 4JN8A 3WLMA 8RUCA 3IVUA 1PX4A 4UFHA 2D20A 3DKLA 1O6IA 4B3ZA 2BBFA 4HHMA 1KTCA 2HVMA 2P8CA 3GXTA 4Y9AA 1V3IA 3C8NA 1GKRA 2NVAA 3S1UA 1WPCA 3QR1A 4DF2A 5DEZA 5EMYA 4GI8A 4XIMA 3TTSA 1UWUA 1FFRA 1S2CA 4QX4A 1B30A 1EHNA 3TYZA 5DANA 4NT0A 2GJXA 3MJMA 4JL2A 5AZ1A 2WCGA 4H04A 3LHZA 2GJPA 4D8AA 4RR4A 2PS2A 3IARA 4QJ3B 1QNSA 3OO2A 3MKVA 4JL1A 3IJDA 1PBGA 5HUPA 2R1KA 2ONEA 5HMSA 1A0CA 4A8RA 2ZRUA 4DAFA 1QW9A 1O12A 4L65A 4P8WA 2ZICA 1S38A 1CDGA 2VFFA 4BI6A 1CXKA 3AMDA 4ZE5A 4CN1A 3SQSA 1IIGA 4F0SA 3IVSA 1FH8A 2JGQA 3CWOX 1GT8A 2XM2A 5T8GA 2BRVX 3I3DA 1KV8A 2V5LA 3F4VA 3H70A 3TC6A 3BCFA 2DSZA 4J27A 4DM1A 1JF5A 4GG9A 3M44A 5D04C 5BRPA 4PYSA 1S3TC 1FXQA 3TW6A 3UWQA 3U57A 1N8FA 3GFZA 4XAGA 1AUSL 1Q8AA 2V5BA 4HPHA 1SZRA 1A5MC 1ZJIA 3QW3A 2NQZA 2FH6A 3C2RA 3GKFA 3HGOA 1JZ6A 4Z17A 4C60A 1LXMA 3T0AA 4W8BA 2QDHA 3R79A 3SUUA 1V0MA 2GGEA 3OIHA 2AMGA 3TV8A 1EGZA 1YEYA 1K9EA 3LK6A 4WOQA 3VMPA 2R1MA 1CXLA 1PIIA 4NILA 2OEMA 5JQ9A 3DXIA 1ZLPA 4A21A 2J6XA 4ZXLA 3PC0A 4GY0A 1TRDA 3C2FA 1JCMP 3OLEA 5D9NA 2QCLA 1OF6A 3TTOA 2W5FA 2BY1A 3F5JA 1FWWA 3EDEA 1JYXA 4B9YA 1E70M 3KBWA 3IIXA 4HOXA 1OYAA 4C6QA 1ZCOA 2BS9A 2NT0A 1UR2A 2XIJA 4XX6A 2XTKA 2XH2A 3NQDA 4AWSA 3UJRA 3WDHA 3ITVA 5C6MA 4XZMX 3BW3A 5JBDA 1MW0A 1KM4A 1V7AA 1XJBA 3Q58A 4LEQA 2WKJA 4MLRA 2X1IA 5A6SA 4CNSA 1BG9A 3C8FA 1V3HA 2VNCA 3EKZA 4JFTA 4EACA 2OELA 4CQCA 3ICJA 1EA9C 4CNTA 3G1HA 3W1NA 3QZ6A 3TJLA 3ABXA 1W17A 4PB5A 4AZCA 4N42A 1ADDA 1G4TA 4RDYA 2CNCA 4JTKA 2B7QA 2ZZ1A 1KCZA 4DJFD 4PZVA 4PFMA 2V30A 4GABA 2PDCA 4G1KA 4TVDA 1W31A 2ODOA 4NNCA 3NDYA 3ZIZA 4RUBA 1UIPA 4E3TA 2WNQA 1UBPC 2GGJA 2XZ9A 1Q3NA 5HXMA 2FHBA 3QTPA 3LYEA 4HPXA 2PFHA 1NP0A 2HS6A 4W84A 5HJYA 1TWSA 4XB3A 4Y9NA 1ZJAA 2WSQA 4RNIA 1HTIA 4DBUA 1EEXA 2J88A 3AIQA 4HIBA 4UCGA 1PCKA 2CZ5A 4UQCA 1JZ5A 3TCSA 4H8NA 1Z7AA 1Q8JA 2H90A 3H55A 4H00A 2J7HA 4K6AA 1FDYA 1TVNA 2H3DA 1H7XA 1TJPA 4FLQA 5ENLA 4ALDA 4BQ5A 3NQMA 4YL2A 2Z1SA 2NQHA 5ABFB 1TQJA 1TX2A 2J74A 4DWSD 3AALA 1F8IA 1CX9A 1J2BA 3NNTA 4OT7A 4WDUA 1KM1A 4L7ZA 5E0FA 4QTGA 2FB3A 2REQA 5FEZA 2X40A 4NY2A 4XUGA 5A6BD 3SURA 4J3UA 2ACUA 3CAKA 2BODX 4NI3A 1T6MA 2DZAA 4NAFA 2BY0A 1CLKA 1DJGA 3VOFA 2BLEA 4CQ9A 1REQA 2D2JA 3CC1A 4H7CA 3NQFA 1IF2A 1HKIA 4XO6A 1OC7A 2X1SA 1SZNA 2J66A 3L7RA 3GNPA 3BMWA 2KAUC 2WJZA 5D2TA 1OFBA 1YKWA 3WF4A 3IAQA 1WDRA 3VK5A 3REQA 5CZKA 3R25A 1XLMA 4DWSB 3TZNA 1DTNA 2DT1A 2NZLA 4PL2A 2PZNA 2DVTA 1VRDA 1KFWA 3A9BA 2F84A 2VRKA 3WNKA 1XGZA 1B0IA 1FXPA 1SW7A 3NYZA 1TWDA 2J77A 4YNGA 1W3TA 5DMNA 2IKGA 5XINA 5HMEA 1O60A 4O18A 3NL6A 3JZUA 3JR2A 2A7PA 3HMJG 1TRIA 6ALDA 4UMAA 3B05A 3DU0A 4KFNA 4ROPA 3MV11 3CUFA 3BQ5A 1E5NA 4AB4A 5CJ5A 4DQWA 3BJSA 4PMNA 1OJOA 5GNYA 1F9CA 3HG2A 1W3IA 3G6MA 1DHPA 2XIBA 1C9WA 3W23A 1H61A 2QDGA 2JBMA 4P7RA 3WFAA 1L6WA 4H8UA 5I3IA 2KZHA 1F74A 2QCMA 4LAOA 4Y8FA 1NSJA 4FOUA 2ZVIA 2ANUA 5E9AA 1FWRA 2Y5EA 2ZZ6A 4PN2A 1F73A 1N7OA 4DBSA 1S2VA 3SADA 5A95A 4LT9A 3ECQA 3GKAA 1D3CA 5JMUA 4A2RA 4GX9A 2WVVB 4WX2A 2PD5A 3NG3A 1V77A 4GUFA 2BSLA 3AZRA 4D2JA 3AFBA 1VFOA 2PDNA 5I00A 2CEQA 2YB4A 3PAJA 4OBSA 2A7RA 3M0YA 1RD6A 1X8FA 2E6FA 2TAAA 1L8NA 2ZE3A 5AHNA 5ECVA 4P8XA 3BLDA 1W9UA 3ZZ1A 4GXPA 2W27A 3NPWA 3M0JA 4UTHA 5HJLA 4D1JA 1WZAA 4W5ZA 1ZJHA 5KZEA 4IGNA 2H9AB 2O4MA 3UD2A 3SAZA 3VNDA 4GUIA 2WC4A 4RDVA 2QIWA 1YDYA 3GR4A 2QCHA 1XYCA 3CL7A 1JI1A 4EPKA 2CLPA 3G1SA 5IBXC 2DUXA 4W86A 2XHYA 4UXDA 1G67A 3G0SA 2J27A 1UROA 1PYMA 1LUCB 4Y8EA 1F9GA 4PMQA 2VFEA 3EA2A 3G77A 4RZ6A 3S6TA 1M01A 2GPTA 3W7RA 3WQFA 3C3UA 1A5BA 1EJRC 4WGHA 3T8LA 2QV4A 5J04A 2AKZA 3BLIA 1QI4A 2ZADA 3TVAA 1TZ9A 3W6YA 3M0LA 1JNDA 4P2VA 3WBAA 2QMJA 2DSWA 2VD9A 3TSDA 1LORA 2Z1WA 3MTWA 4DO4A 3B0PA 1I6NA 3SUWA 3SZ8A 2BOGX 3BGGA 4QCEA 3DDMA 3S4TA 4MSSA 5CSSA 4H9MA 5MKGA 4QRNA 1K8XA 4GUHA 5AKQA 3UJFA 4AG0A 3GW0A 1BTCA 3KTXA 1RA0A 4H2CA 3WY1A 4CUCA 1NQKA 3GXIA 4R5EA 2FB2A 4CNOA 2ZXAA 1FWBC 4IFKB 3PFMA 4ACYA 5IHRA 1EC8A 3TYDA 1FCUA 1HQTA 4FX6M 5DO8A 3T7VA 2VR5A 4CGTA 3IUDA 4QLJA 1DEDA 4G7EA 1Q2SA 2GK1B 3HB9A 4JKKA 2OTDA 4ADUA 4UTLA 3TFXA 2FJUB 1J96A 2E77A 1VBUA 3RDKA 1BWVA 2OZ3A 2PP1A 2QAPA 4E5TA 4TX6A 1E5JA 1EIBA 2G96A 3K4WA 1UD4A 4N6EA 3PNUA 4P7OA 1PX8A 4H9UA 3NSXA 9XIAA 2Q8LA 1JCYA 4TX8A 1TPH1 1OFEA 2QT3A 5EMLA 1PO9A 1LT7A 1LOHA 4YPJA 2RH9A 5CQ1A 1KGWA 1DJZA 3UZ5A 1M7OA 2R1LA 1XGEA 4FMVA 1MWOA 3P60A 2Z28A 1J9YA 3PWIA 1CI1A 3ALFA 1MRAA 5EGRA 2WAGA 4C5YA 3RR1A 3R58A 3EOOA 1Q65A 3A9IA 1F5ZA 3GW3A 4AISA 5C9RA 2R14A 1XP3A 3MANA 1VCFA 3C2YA 2VELA 3KTSA 4LAMA 4MZ8A 2Q1FA 4U3AA 2C15A 4OGZA 3QR0A 1QJWA 2BZNA 3GHRA 3L5MA 3QYSA 1PZ2A 2YPIA 3OA5A 2X7WA 4XO7A 1KFKA 3I4EA 2ZOXA 4IIHA 1ITQA 5IBXA 4RNHA 2OVLA 2X0YA 4QISA 3WENA 2DZPA 3L0GA 4KRTA 1UR0A 3NEVA 3S2LA 4OUIA 1BHGA 4V28A 3TLQA 4KFOA 3N9SA 4MADA 3IIPA 3U4FA 3N15A 1ONRA 2TMDA 3NO3A 2FGZA 4MJMA 1QOPA 2WJDA 4Z42C 2BVTA 1WO2A 5HANA 2WHKA 2AMXA 1DXIA 1DIEA 1GQIA 2W67A 3BLFA 3VC5A 3VMNA 4NAEB 4GNVA 4BCEA 1UR4A 2OEJA 4MY1A 3NL3A 1GEQA 3LD5A 1UP2A 5BOOA 4GIEA 2WC7A 4ATLA 1CLVA 1JDEA 3TK7A 5EMJA 2V69A 3GNOA 2X09A 4HA3A 1CXHA 4J2MA 4KGLA 4O16A 4Z2LA 3H4WA 3DYOA 3KBMA 3M6YA 4JTQA 3T9PA 3RLVA 2RDTA 1EJTC 5I3DA 3NOYA 1EDQA 1GHSA 3RX4A 3AMGA 1HJXA 1QNOA 1CEOA 2VXNA 4DYKA 2QPUA 2ZRZA 1GNXA 1XQLA 2WSYA 1PE1A 3BDKA 1BVZA 4M6VA 3L65A 1Z48A 5LHFA 1EXPA 4FOKA 1C29A 1NDWA 4JYEA 3BPWA 1LQ2A 4C6LA 4TUFA 1E43A 2WOQA 4ZO7A 4Q4SA 3SRDA 1CT5A 5XIAA 5J5RA 2P53A 2UY2A 1SMDA 3W1RA 2ACSA 5T9BG 2YBUA 2QCFA 1X8CA 1DBTA 1TV3A 4Q6JA 3TTEA 1JD9A 3VPLA 4WDWA 3MP4A 1OFQA 3MP5A 2D1ZA 2DGAA 1C9DA 1FHUA 3QFEA 1XYLA 4KF1A 1NFBA 3H2OA 3KP1A 5G1MA 4LPCA 4N9CA 4IXHA 2X41A 1M53A 3EMQA 5EU9A 3UZZA 4C90A 1R3VA 4E3VA 4IGSA 5G4WA 4HPNA 4QROA 3MV01 3VX0A 5MF5A 4HMNA 1ZFJA 4DNHA 1I2QA 3HU7A 4CQ8A 3ARUA 1OG0A 4WUIA 4HU3A 3GHTA 4AWUA 1NF0A 2VGIA 1A49A 1BVWA 1IV8A 1RALA 3RX3A 1LF1A 3VD5A 5LZLA 2RJGA 3V18A 4QG8A 2VT0A 1Q6RA 2GWGA 3AZSA 5LHEA 4MG4A 1BF2A 1E9LA 1JGMA 1JDFA 3MSYA 2I9EA 4R7OA 2WVUA 1OT1A 1E72M 1QPRA 3MI6A 2ABAA 1L6GA 2XWEA 2C7FA 2UBPC 2JK2A 1XIGA 3GNRA 2VMFA 2YA0A 4GC3A 4BFAA 4GXMA 4HHLA 5K3VA 3VM5A 3S5YA 4D71A 3GIPA 1HVXA 7A3HA 2GJLA 2OZ0A 3LXCA 3SRKA 3CGTA 4K3ZA 3BV7A 1W8GA 1EIXA 4GRSA 1GKPA 1YXDA 3VIGA 3I3EA 4XZNX 3KP0A 3MUZ1 3H2MA 1OT2A 2OGYA 3N6QA 4DO7A 1LLZA 1W2VA 3OIXA 1W0MA 1DV7A 2YEPF 4JTAA 4LFYA 3FJ6A 3T44A 1AH0A 3OOQA 5AECA 4ZE4A 6REQA 3FN9A 5SWUA 1IE7C 3MI3A 3AJXA 3B06A 1T7LA 2VO5A 4ZB5A 4FO4A 3XISA 4DPPA 1TE6A 4IPJA 4NXSA 4AYGA 3W27A 1RW9A 1JNEA 4EP8C 3MUY1 1UPPA 1SPQA 3DZ1A 4MB3A 4FAMA 5M3WA 1BYCA 2GJNA 2ZX5A 3DYMA 5FSDC 3TOYA 3STFA 3QKEA 1CPUA 3LHYA 1SO3A 5FKYA 5DMLA 4M6QA 1JZ7A 4GY1A 4KETA 1YBQB 3P74A 3CB8A 3QEZA 5IRPA 3W2LA 1A3HA 1VPXA 4TXEA 1UKOA 4GA8A 4O0ZA 3NQCA 3BV4A 4FNUA 4L9ZA 4GYFA 1GQJA 3BAJA 5I77A 4N9DA 3L0KA 2JE8A 2YZRA 4TQTA 4BY3A 1CGVA 1PL9A 2BNJA 3PZIA 4C6NA 1J0YA 4C6OA 1Z3NA 1JQVA 2EPOA 4CD5A 2RDXA 3B97A 4HT3A 1KC7A 2ZIDA 1JIBA 3IIOA 3R1ZA 1FWJC 2PSNA 2RGLA 2Y85A 1XW8A 2AQOA 1IR1A 3M5VA 3TWAA 3GDMA 1HW6A 3VYLA 1ZSXA 2VCAA 4BK9A 5H8UA 3GNXA 3NR0A 2PWVA 4DJDD 4E6MA 4JQ4A 1LTDA 3PUDA 3MZNA 3NM3A 4QJ4B 1CB2A 1UWQA 1G69A 3IRDA 5JBEA 3T78A 5CKSA 3A23A 3ZWSA 1WX0A 2FZ8A 2HDJA 4HZ7A 3CXOA 2JKAA 3IGHX 1HJSA 2ZRYA 1ZB5A 4HJFA 3WLHA 5LXXA 2OR2A 4JN7A 1OADA 4W5UA 4PEKA 1K02A 1EBHA 3ITCA 3BLPX 3E12A 4JCMA 1XICA 3VGDA 3V5FA 2AGKA 3NOEA 3UZWA 3G24A 2C14A 3SCTA 3LLDA 2WB5A 1P6BA 2X0SA 2ZXQA 2PUZA 4HP5A 5M5DA 4CU8A 4IFOA 4XWUA 2Y0FA 5CZ0A 2JF6A 1QDSA 5D9MA 4TO8A 2A4AA 5EMUA 1YLVA 4RXFA 3PJXA 1XLAA 4GQ0A 4FIQA 4ZR8A 1EYWA 3R7MA 3B8WA 1N8IA 3S1XA 3O6CA 2HE8A 4AZ7A 5REQB 4JEQA 1K7EA 1GG0A 1J0IA 2FTYA 4MHBA 1CBGA 4XD6A 4AYSA 2XGZA 1I60A 3G1DA 2WO5A 8XIAA 1JD7A 4I9TA 3MMDA 1C91A 4ERGA 1US2A 3OQEA 3S3GA 1U83A 4Q4QA 3G8EA 1XBYA 2PB1A 4OZOA 2R91A 3RMEA 2PMQA 3WDJA 1QW8A 5A8MA 3UVAA 5F2GA 4CCZA 2PZ0A 4S39A 3LM3A 3IUIA 1W8SA 4XIAA 4J3ZA 3W2MA 4FHAA 4V15A 3URAA 2OWWA 3R13A 4R7WA 2KXRA 3UNTA 3AMKA 1OABA 1M7XA 3TLLA 4WRHA 1UWRA 1XLFA 5A8QA 3CS2A 1J6PA 3GK0A 3FHAA 1CGTA 2YYTA 1UYQA 1PKYA 4IG2A 4CNPA 4S3JA 5CC5A 2G3FA 4KGJA 5BXPA 1ZU8A 4RK8A 1SO4A 1XFBA 4RE4A 3PB2A 2DSKA 5AHLA 3QHMA 1TTPA 3VCNA 3QYQA 4JTEA 1OCBA 1B3OA 5HUOA 4MFDA 3UWYA 5BU6A 1ICQA 3DFNA 1AH3A 1ML1A 1OBAA 1PYFA 5CPOA 4ZB0A 3FLUA 3QZAA 5L9FA 2MUCA 4D6GA 3KFTA 2J7DA 4LRSA 3EWZA 3ZXWA 3LRMA 3RLUA 2VHLA 4O12A 5FSEC 1K8ZA 1W1VA 1M7JA 3WIJA 4Y96A 4HVXA 4YTSA 1WBHA 1JYNA 5AYXA 2X1RA 1Q85A 3WK2A 2WW5A 4RCXA 3H4XA 3E2RA 3JU2A 4CCDA 2XVLA 4DJED 4CD8A 4ZEPA 2G4JA 2OT0A 1IT0A 4GVIA 4LUSA 2A21A 1CWYA 2FGBA 1CCWB 5HOSA 3H2AA 5E0CA 1C8XA 1SW0A 1I1WA 4RXGA 5D8ZA 1Q2RA 1Y5VA 2HV5A 5C70A 1DJXA 1KFEA 3BICA 2FHCA 1A0DA 5LGXA 3ZFHA 4M1RA 1EYEA 2OLHA 5MHBA 1OWQA 3GS6A 4JY9A 4GJ1A 5TIMA 4ZENA 2PDYA 4OUEA 2I5QA 1JPMA 4U33A 1XLEA 1GJUA 3F5LA 4B5UA 4XZIA 1PWLA 4R88A 5FCZA 2NSXA 3WK0A 3LX9A 2QMKA 3K4AA 2VCCA 1QPNA 4H6KA 1EWDA 3CWNA 1V3MA 4PUEA 3GR8A 3VNJA 3W7HA 3PUEA 3QBUA 1H0IA 1XINA 2L5HA 4A8IA 3LRLA 3O06A 2RDWA 2NXHA 2PDHA 4FNTA 5H1WA 2WQPA 2ZKMX 1UA7A 1A5OC 4X0NA 3OHMB 4NZCA 4PMOA 2YCIX 4NJJA 3IJ6A 4Y9PA 4PTXA 3PPCA 4D6EA 1EPXA 2VVNA 1TKKA 5I02A 3ZYZA 4F66A 1NELA 4E2VA 3CYJA 2XFRA 4Q8PA 2OQLA 1YIXA 4I7WA 3USZA 3WQWA 4HMCA 1EGMA 3GG1A 1E0TA 1R3YA 3W7KA 1HF6A 2INZA 4NX0A 1R3WA 2QJJA 1KWGA 3M41A 3N2CA 1M7PA 1SQ7A 1VBGA 3BO9A 1MQQA 5CBIA 1WAUA 3LNMA 1BQCA 1WZKA 2CLMA 1IEWA 3LZ5A 4X9SA 2PLKA 3G6LA 1VBRA 4N4PA 4LX4A 3KWXA 1W1ZA 5EY5A 1A5SA 4S3AA 3EB4A 2D22A 5BZAA 4IH3A 2PDUA 1S2AA 4DX3A 4JNZA 2VC9A 1FH9A 3GUWA 2PRHA 1XIFA 4NKCA 4GI6A 2YB1A 3VDCA 3SRHA 1KA9F 3GH7A 3L2LA 4ZOCA 3WEOA 4MB1A 3GAYA 3VGEA 4TOQA 1LP6A 3A6OA 3ZSSA 4O11A 2RKXA 1MW2A 4G1NA 2QF8A 3UXDA 3B0XA 1B57A 2A6NA 2OG9A 4K36A 3UVIA 1E0XA 1E4MM 1E6ZA 4LVDA 1W2PA 4J28A 5LA0A 3RPTA 1AW2A 5LGZA 1J0HA 3UG4A 3GU1A 1KLYA 4H4IA 2DZUA 3QZEA 3CQHA 3W3OA 1US3A 4WK9A 3TU9A 4D6DA 1BEUA 2G97A 1XX1A 2BVYA 4YLWA 1THFD 1W5OA 4AVFA 1FRBA 3WD2A 2D73A 4S3FA 3EDFA 4I5UA 3HN3A 4M5PA 4OQVA 1EA0A 2RUSA 3PWGA 3WQ4A 3W2KA 1Z6KA 3GTHA 2DZWA 1OM0A 1JCTA 3PSVA 5I03A 1W5NA 1EKOA 1IWBA 4R27A 1TV4A 3ONBA 4DWDA 4C6BA 4PRRA 3KVLA 3E74A 2YLAA 3EOUA 1IEXA 1Q6EA 1MEIA 2QXWA 1KTNA 4M19A 3WLOA 1IEIA 1TV7A 1MMFA 1MQRA 1U2YA 1JDCA 5LNSA 3AOFA 3O15A 2EKGA 3SEPA 3MSDA 3BJTA 1X1IA 2JGYA 5HR7A 4XK2A 3CT7A 1LQAA 1XQKA 2DIJA 4MNKA 1E6NA 5T91A 4EWJA 2V5JA 3BOLA 2OPJA 3WQ6A 4AXNA 1HJQA 1LWJA 3U5UA 2XIMA 2Z26A 1O4UA 3DFHA 2QUTA 1AL8A 1JZ3A 4EF8A 1WXYA 4LH8A 3FSUA 3MB9A 5DT7A 1HMUA 2HROA 2O7QA 3IT6B 3RN6A 4I9AA 1P1MA 5EB8A 3M47A 3UY7A 1E0UA 3VGHA 4S3BA 1MW3A 1BLIA 2ZA2A 3VXGA 3CUXA 1UASA 4I8DA 1DQXA 1XLBA 1FY6A 3PR2A 3N12A 3U48A 2OSWA 2GFTA 1RCXB 3GVRA 2WANA 3L68A 2XH4A 1XFCA 1JUBA 3MI2A 3NJ3A 4XAPA 1A5NC 2BGNE 3PZMA 4XAZA 3KEHA 4D9PA 2WMFA 2PWFA 4G5DA 2QYGA 3THAA 4FZIA 3CAVA 3GG8A 3OJGA 1TVPA 4JDYA 4WDTA 2AQWA 3BLEA 1BAGA 3VIJA 3G0XA 1PPIA 1XSIA 3GC4A 1GEHA 2ZUNA 4AZCB 3B8TA 1UQYA 3SCWA 2R6OA 1UC5A 3ZVHA 4FEZA 4M29A 2WMGA 3MCNA 1NOUA 3WLIA 4FX7A 1FQ0A 4ZO9A 3U3HA 1Y0EA 4MWAE 5D38A 2CHRA 3QY8A 3LCHA 1BRLA 1Y7VA 3NGJA 3DHUA 1XLCA 4JTLA 1DWIM 2Y7GA 4GGBA 3PG9A 4LYPA 4NUWA 1XLHA 3VIKA 3NAVA 4H83A 3FYYA 1AQ0A 2FFIA 3E2VA 1VPYA 3NYDA 1HG3A 2HRWA 2WV8A 3H26A 2Z4GA 2QGHA 1J0JA 3Q37A 2WC3A 2E5BA 3LA4A 1P6CA 1YNQA 5HWMA 2C79A 4NJKA 1OFRA 2BTMA 3P0XA 3ATZA 2UY4A 3F4WA 3WNLA 2DIKA 1DORA 2XVGA 4NIRA 3PY2A 3CYVA 1J12A 4LY4A 4D72A 1S39A 4HZ8A 1T8XA 1XBXA 4AZHA 1V0LA 3EWYA 1SFTA 4UTTC 3W6LA 2Z25A 3WD0A 3NO1A 2XFFA 5FL1A 2B4GA 2JEQA 1F4HA 4GI4A 4J7RA 2EPMX 2PTWA 4NAFB 1A80A 1RY8A 2YBTA 4G9PA 4NRRA 3B8UA 3QRHA 3SUVA 2ISSA 3ZWTA 4WY0F 5LIWX 1REQB 2KXSA 3N29A 4AF0A 2GQ3A 1J10A 3MVTA 2I17A 2ZZ4A 3BSMA 1FWTA 3N2OA 1TFVA 4ZTYA 4K38A 1X7FA 3LLXA 4C6EA 3B9AA 3PZVA 4LVFA 4PB3A 1JXJA 3HG4A 1R3TA 4TVUA 1NWRA 1H7PA 3W1XA 3ITLA 4JX4A 1H60A 4E2DA 3V0UA 2WHJA 4X60A 3S5OA 3W1AA 1V93A 1GVEA 2W92A 3IK2A 4CVUA 4Z2GA 3CZLA 2HQAA 2VC5A 1TJRA 2VC7A 2WMIB 3AXHA 2PCEA 2XH7A 4ZSTA 4HGXA 3EBVA 5DRCA 4PC8A 5F2LA 3VZXA 3HZ3A 5HNTA 3UR7A 3U8GA 1B3XA 5A2AA 3UYCA 6CGTA 5L6UA 1FWDC 2Z2AA 2W63A 3W37A 1W9XA 4KBXA 2YR1A 2HXTA 4R7JA 5HPCA 1RCOB 4UWMA 3KBSA 4GBDA 3KLLA 2ZUUA 4ZO6A 1PZ1A 1OVDA 3MYOA 1XS2A 4FXFA 3PQIA 2EJ1A 3WFZA 2WSKA 1TPUA 4QEHA 3ZT6A 4MWAC 2OOGA 3FHQA 3OA3A 3CLWA 1HUVA 3NQEA 4LU0A 4AHQA 1UB3A 4B5VA 2G50A 5AHEA 1PKNA 4AIUA 1O5RA 4N7QA 1MDRA 4QNWA 3V1PA 2Y5JA 1CECA 3W71A 2WZTA 4GIYA 3O6YX 4MKSA 3UGVA 1BD0A 4DXVA 1A3XA 1ZALA 1LXKA 3QTGA 3EXSA 1BYAA 3WUGA 4N9EA 4UTTA 3W83A 5D2XA 3CQKA 3F4CA 3ZT7A 1DIDA 5BOEA 4I9MA 1KM0A 2FZNA 2GWNA 4ASTA 3TYCA 2B31A 3ES7A 4NZ1A 3BC9A 4GCAA 2D3NA 3WQVA 2J7GA 1V4YA 5D32A 1Z44A 4H01A 2PBGA 1XCWA 2V9DA 2ZC1A 1Q6LA 2E1WA 2YIHA 3G2GA 2E1DA 1OD8A 3OHIA 3WLTA 1KGXA 1RJRA 3GNNA 1RP8A 4PMYA 4DXKA 2VEIA 1F3WA 3BAWA 3QLDA 2F8QA 3U0HA 3V75A 1OSEA 2OKTA 3LERA 2J7EA 4KIEA 2YCEA 2BHYA 1IXPA 1M5WA 1UR1A 3GTIA 1W1TA 1R7AA 2XVNA 3VI2A 4IIGA 1XDJA 2VD8A 5ABGA 1SJAA 4GNJA 1XYFA 3PZUA 2GVJA 3S5SA 4YHEA 3WSUA 1T40A 5TBOA 3HPXA 4QLKA 4MF4A 5CPTA 2PWHA 1V6VA 2QUUA 3UXIA 3Q4DA 3QFWA 1V3LA 3BZGA 4IPLA 4HHHA 1IR2A 1DQWA 1EX5A 3UA4A 3P67A 3AMCA 4K2SA 4LUJA 1XIIA 2XGBA 1EP2A 3QM3A 4M51A 4OTKA 5G5IA 4GZ7A 2EO7A 3DHFA 2X16A 3W7LA 1WQ5A 1WUFA 1W9DM 1IGWA 5C2GA 3OGRA 5MKGB 3AIUA 1XLIA 1E1EA 3MU7A 3MBFA 3MUAA 4MWAA 4LANA 1RVGA 2YW4A 4O8RA 4DXXA 1DWHM 1TR9A 1PDZA 1OYBA 3LXAA 3QMRA 5EYWA 2YEPB 3FEMA 1EC9A 1TG7A 3M5YA 3APTA 4W9TA 1NWTA 1O5XA 3WF2A 3AS3A 3T40A 1HL9A 4FLSA 1C92A 3GHUA 2CWNA 4KEVA 4G7EB 2PTDA 3WLKX 1GVRA 5DQPA 3D3FA 3JVAA 1E9IA 1KRMA 1WAWA 4JX5A 5KSWA 3T8QA 3RJYA 1K6WA 1UMLA 3NWRA 3NQ6A 4NL1A 3IJIA 4I7VA 3BLLA 4J5NA 1GQKA 4WCJA 1XRVA 4GQGA 1ZCCA 5D9PA 1P1XA 4S2BA 2POTA 3L0NA 4AY1A 3WUFA 5E0KA 5EMMA 2WCAA 4LSBA 1XH0A 1LG1A 1X1JA 3SGGA 2ZUSA 2PE4A 3HURA 4AX7A 2IPWA 5FA5A 1J0MA 4YTRA 1R5YA 3UG5A 4TVCA 4HN4A 5FJRA 2E9LA 1UKQA 1FHLA 3GTXA 3CM4A 4FA3A 4PCTA 1Q4WA 3NPVA 1LBFA 5XIMA 3RRXA 3UPWA 4EANA 1L9WA 1VLWA 2VGBA 1ADSA 2VFHA 4ORMA 3SW6A 1JZ4A 3DERA 3WNMA 2ZWYA 4GUJA 3UR5A 3N1AA 4JFSA 4XSLA 3GDBA 2OSXA 4JHZA 5JIWA 3N25A 5A6KA 4Z1BA 5I5RA 3N73A 1U1HA 2B7NA 2V0TA 1UQZA 1VYPX 3P81A 4QBXA 4O57A 2QV5A 3L4ZA 1FKWA 1ISWA 2PBOA 3PPGA 3THDA 3CHEA 1UHVA 4JXCA 3WUEA 4AIEA 1ZPTA 5A6AA 1M1BA 3PM6A 1WKYA 4M7TA 3CV6A 2VFGA 4ZSUA 1RHCA 4DZAA 1OJMA 4GPNA 2ZX8A 1WBJA 3GH5A 4WD0A 1XYMA 3TWBA 1X96A 4B16A 1C8VA 2PWDA 2UV8G 4WJ8A 2X30A 2V6AA 5CPMA 3PS7A 4XVEA 2FDSA 1A3WA 1FWEC 3VIFA 3RG6A 3KS5A 1IXQA 4ORIA 5CZSA 3K46A 4F0KA 3FJ4A 4MY8A 2INEA 2EXOA 4FXRA 4B5NA 3A4XA 4LEFA 1OG6A 4UCFA 4HNLA 4CD6A 2Y6ZA 1DPMA 3PULA 1OGBA 2NX1A 5T26A 3VOCA 4C6MA 4O17A 5K9XA 1BSIA 3WH8A 2OZ8A 2NUXA 1FHVA 1TSIA 3DC8A 4AHPA 4RW3A 2CW6A 3GAKA 3RCMA 3K5XA 3PBGA 2PP3A 3HGRA 4DPQA 4UNLA 3M46A 4JCLA 1EDGA 3KTCA 4Q6XA 2CLIA 4HYRA 8TIMA 4WDXA 4UTWC 1WKFA 2E7FA 4LY8A 1IWAA 3LBCA 4D8LA 4QDWA 3SDOA 1OGSA 1V03A 2J6VA 5E93A 1RP9A 3WQOA 3GXMA 2IXUA 3W1LA 3TROA 3WKZA 1JI2A 5JBFA 5GNZA 1UUQA 4Q3MA 3GU2A 2V4IB 4PTDA 4N9BA 3POCA 4Z1YA 5LNWA 1KV5A 1Q7MA 2XN1A 1L6FA 3DH7A 3PJWA 2Q09A 4GVHA 4MNMA 3ID7A 1TCDA 4JGDA 4IIEA 1ZENA 4UFJA 2CU0A 1XH2A 3DYPA 2J47A 5DLCA 3CL8A 3W7QA 3TAOA 3GDTA 4WR3A 2ESCA 4C6PA 2WXDM 3HPFA 1EXBA 2G3JA 2OQYA 4ZXOA 3Q2DA 3HJZA 3E0WA 1V5XA 4FLOA 3GZAA 4L9XA 4AC1X 4GD0A 4H3DA 1U1JA 3F4DA 1TMHA 5G2WA 4ZA0A 2OODA 4MGGA 3HQPA 5CG7A 1HKWA 1KRCC 4IP7A 1XUUA 1ZJBA 2CPUA 3CZ8A 2A6LA 5DCDA 1TPB1 3C2VA 4W88A 3CZGA 3NQ8A 1X1OA 1UOZA 4HMEA 4IMAA 4O0KA 2XYLA 5HR6A 3KDNA 4A3HA 1UP3A 5TQLA 3WNNA 1EP1A 4U4MA 3BW2A 4LV4A 4DUOA 1UH2A 4NVTA 4K1GA 1LRTA 1S46A 3W00A 2R82A 3D46A