2WMIB

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 in complex with the a-trisaccharide blood group antigen.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
582
structure length
571
Chain Sequence
VDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTENYWIWANDIENKAADYLKVSAKNGGYFIWAEQNNGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKSKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords FUCOLECTIN-RELATED PROTEIN
total genus 212
structure length 571
sequence length 582
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmiB03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmiB01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmiB02
1X1NA 1JD9A 3QOMA 2VX7A 3OLIA 1CTNA 2GDUA 2X0HA 3AHXA 1X6NA 3SCVA 1XV8A 3DYMA 1XH0A 2E0PA 5DFAA 3APGA 1CBGA 2CBVA 2WMFA 2WLZA 4HA1A 3CZ8A 1HJWA 2DQXA 1J0JA 4PMYA 1E70M 6A3HA 2QMJA 2EPOA 4V27A 3WF0A 4D6DA 2WMGA 4CU8A 1BF2A 3ZOAA 4AZCA 2BHUA 1OWQA 4J3SA 4UFHA 1HJVA 1R87A 3VILA 4JCMA 4PMOA 1HJXA 1QNSA 2O9RA 2V5DA 2VT0A 1J11A 2FH8A 1OGGA 1GOOA 4WJXA 3TA9A 1EDQA 4MAZA 4H8HA 1G0CA 3W82A 3N15A 3AS0A 3ZJ7A 1E6NA 1JYVA 5DEZA 4UCFA 1U33A 2VQTA 4W8BA 2V3FA 2FGZA 1W3JA 1OGBA 4Z2KA 2BY2A 1JI2A 2VO5A 2J7HA 2WLYA 3VIKA 4B9ZA 4H04A 4M8UA 1GQJA 1LXMA 1B3WA 4ACZA 4PMNA 3SUUA 3D3AA 2YA2A 1EQCA 4CN6A 3VX0A 3A4AA 3BXWA 3BCDA 1GUVA 4N42A 2CPUA 2QLYA 2ZX7A 1E9LA 2XPKA 1UR8A 1W2VA 4MDPA 3VIFA 3B8SA 4JFTA 4IUGA 4K68A 4ATLA 1K9FA 3AFBA 4HU0A 2OYLA 5A6LA 1NOUA 4A3HA 5BRQA 1OB0A 2GJXB 1B3XA 1VEMA 1OINA 3AXXA 3A47A 1SFSA 3SCTA 3UR8A 1WPCA 3AHTA 1JF6A 1C92A 3WQWA 7CGTA 4D72A 1NP0A 4HOWA 1QI5A 4AC1X 1TCMA 1E72M 3FHAA 3ZJ8A 3CH9A 1W9UA 3GBEA 1E73M 3FW6A 4PMXA 3GTNA 1VF8A 3NSMA 1EIBA 4D71A 4GZJA 2XUCA 1UR9A 1UKPA 2VURA 1WDRA 3AICA 1DWFM 4DWSC 2DSWA 4PMRA 1RWGA 2YL5A 2BXZA 4NRRA 1M7XA 1BPLB 2NSXA 1OD8A 3FHQA 4GI8A 4PCSA 5A6KA 3MO4A 2WCSA 1E5JA 2BV9A 2DSVA 4CD7A 1BVNP 3UCQA 2BRVX 4MTVA 3W27A 3SUTA 1DWJM 1US2A 2W61A 2TAAA 4MB1A 3BAXA 2X05A 5CZKA 2YLLA 3EMZA 1XD1A 3WD0A 1PX3A 4CCEA 1GW1A 3CHCA 4KWUA 2BVDA 3WDPP 1B0IA 1O7AA 1Q6EA 3K46A 4TVCA 4AIEA 1M04A 1JXJA 3DHPA 2GJRA 5E9AA 3D5HA 4U2YA 3VM5A 2CETA 5IFTA 1QBAA 3POCA 5GNXA 1Q6DA 2WCAA 1PBGA 1MWOA 1C90A 1UA3A 2WKLA 4PMDA 1XD0A 3KE0A 3ZJ6A 3WNMA 1UQZA 4D1JA 3AHYA 5JBDA 3IAPA 1TVNA 3CHFA 3PTMA 3T2OA 3WDHA 4RL3A 3A6OA 3VIHA 2EPMX 3OB8A 4P8VA 4X0VA 3VGEA 1HL9A 3N1AA 2VZOA 3I3DA 2W92A 1EA9C 4QLKA 2CYGA 2BHYA 3RDKA 4F66A 3FNDA 1R7AA 1MVYA 4Q7NA 4AD0A 1VAHA 2F8QA 4W84A 1HP4A 1RD6A 4W85A 4U3CA 1K6AA 3ARZA 2XVKA 3VMPA 2UY2A 2QF8A 4GPNA 2VCAA 3KWXA 3IJ7A 2VNCA 1H0IA 1QHPA 2ZXBA 4EKJA 5CQ1A 5I24A 1GOMA 4H7VA 4V28A 2Y5EA 2CCRA 4M56A 2YLAA 1U30A 2J7EA 2V3EA 4OIFA 3OLEA 1CWYA 3UEQA 1FHDA 4B16A 1LOHA 1J01A 1W1VA 1IZJA 3PZ9A 4DM2A 1WNOA 2WZHA 3ARSA 3MUY1 5D9OA 5TD4A 3OGRA 1EGZA 1VFFA 4HZ8A 4CCDA 1TZ7A 3BMVA 2XGBA 4LX4A 2ZUWA 3W25A 3M6DA 2CHNA 5A94A 1I8QA 3CHEA 4P8UA 4YHGA 2B31A 3CZKA 4J3XA 1RW9A 3WFZA 3RCNA 4URIA 2VRQA 4XUYA 2G3IA 2ZICA 4NZCA 3ZJKA 2A3HA 4ML4A 2GJPA 3VU2A 1E3ZA 2VX5A 2IXUA 2VCBA 3VD7A 5HBFA 2PF0A 1LL6A 1HM2A 3ZO9A 4E8DA 2NW0A 3MMDA 1QI2A 1NWSA 3HU7A 1MQPA 5F7UA 1UD4A 2OSWA 4TX6A 3MMUA 5E0FA 4W88A 2WVVA 2G3NA 4AZBA 5BROA 3AMKA 5IHSA 1UD2A 3VGFA 4UOQA 3II1A 1CDGA 4D6JA 2CHOA 3W28A 1BYDA 2XFYA 3HMCA 1QNPA 5DMYA 1ISWA 4JFWA 1VJZA 3GYCA 2XIIA 4F9JA 1UWRA 1H4PA 3VTRA 4AD5A 4UOZA 3VD9A 5GQBA 2OWXA 2VL4A 2PWEA 1BYBA 1KCKA 3KL5A 4GZIA 1RWFA 2E8ZA 3ZR5A 5ABGA 2DT0A 1GORA 1HJSA 2CXGA 2FGLA 3K8LA 2G3JA 1R8LA 1KXQA 1CXIA 3LPPA 1UWTA 4GXPA 1H2JA 4DWSD 2WWDA 4HU8A 3K8KA 2GJXA 1XC6A 1D2KA 3TTSA 1NWTA 4AWEA 1EOMA 2W66A 1UH4A 3ZT5A 1XH1A 1HX0A 3EMQA 4R5EA 4GQQA 1ISZA 5HNNA 4HZ6A 1BAGA 1WB0A 3AQUA 3WUGA 3PZIA 1PZ3A 2CKSA 3VIPA 2WVSA 3PBGA 5D8WA 1GQLA 4PTXA 4H2CA 4TX8A 1PEZA 2A3AA 1KWGA 5I3DA 3RJXA 3I3BA 2WCOA 3B9DA 1HN1A 3RMEA 1OCQA 5D9NA 3N12A 2JEQA 4OBRA 1G1YA 3WSUA 1VFUA 3B9EA 3EDEA 3WEMA 2WDAA 2J7CA 4DWSB 1ZBCA 4W8LA 1WE5A 3U7VA 4M1RA 1J0NA 1EH9A 4LPCA 4X0NA 2AMGA 2EEXA 9CGTA 1B9ZA 3OLDA 1HF6A 3CZLA 5A6SA 3FN9A 3GH5A 4TXEA 1XHGA 1JZ4A 1XCXA 2BRWA 3SCPA 2J77A 1XSKA 4UR9A 1W3LA 1ZU8A 1W9DM 5JIWA 4CN4A 1FP8A 3WQ4A 3L4WA 1BSIA 1KBBA 3N11A 2JF6A 2IUZA 3OIHA 2NT0A 5JBEA 3K8MA 3POHA 4L4PA 1B3ZA 2E9MA 4PMUA 1KCLA 1JI1A 5HDRA 5ABHA 1FA2A 1MW0A 3MUZ1 1B2YA 1V3IA 1DWHM 2Q1FA 2UY3A 3IJ9A 2WMIA 1ZJAA 4EAMA 3E1F1 1UWUA 3AZRA 1LWJA 1J18A 5A1AA 1E71M 1GJWA 4P7RA 2E40A 4PMZA 1ECEA 1H09A 3N04A 1V6VA 2YBUA 4Q22A 1W32A 4U33A 3WNNA 3AYSA 1GOKA 2OWWA 4WSJA 1CIUA 1VBRA 3DHUA 2XSBA 2PWDA 3UG3A 1UR0A 3U5UA 2FHBA 3F5KA 2F61A 4U31A 1B90A 4WIWA 1I1WA 1JZ3A 2OSYA 3SIMA 4ATWA 4JKKA 3RPMA 4JAWA 2Y4SA 3MSGA 3F5JA 2ESCA 4TVDA 3UETA 4MPKA 3ECQA 5I77A 1LWHA 1ITXA 4D6EA 2FHFA 3EDJA 5M5DA 2WW5A 4QCFA 4BZYA 1NWUA 4RE4A 4FF5A 2UY4A 2ZX5A 3WD1A 2DSUA 1AMYA 5CPQA 1V08A 1S46A 1OM0A 2X1IA 1KGUA 2YDRA 5A2CA 2VVSA 2OWCA 1XGZA 4KRUA 4J3TA 1JZ2A 4MDOA 4IPLA 1OIMA 1FH8A 2ZOXA 3CTTA 3WDRA 2GDVA 3N9KA 1CGUA 1HKKA 3ARQA 1PAMA 3ZQ9A 4P8XA 1ZS2A 1MYRA 1IT0A 3EMCA 1ITCA 3PZVA 1KXTA 2E3ZA 1GONA 4OOUA 3CUJA 5BYWA 4JFVA 1NOWA 3CMJA 4C7DA 2HVMA 4ZFMA 2WKGA 3MS8A 4W86A 1FH7A 1UKQA 1J0ZA 1D3CA 3SCSA 2G3MA 2XVNA 2Y8VA 1WZMA 3NSXA 3LMYA 4W7VA 3UG4A 1RP9A 3W37A 2DSKA 2WSKA 4MNJA 1UWSA 4F9DA 3ZT7A 2V3DA 2WMKA 2W62A 3J7HA 4DUXA 1YHTA 5FKYA 3SUVA 1VFOA 4LYQA 3QR3A 1B3YA 4BA0A 4AD3A 3CBWA 1NWRA 1XYFA 1E6ZA 4MJ2A 1AVAA 1E6XM 3EDFA 3VIIA 5EB8A 4J3VA 1D7FA 1WCGA 2WAGA 5ABFA 5AC5A 2PBOA 3KZSA 2D23A 1MXGA 1UZ1A 5GPRA 2J8FA 4FK9A 1KQZA 2FH6A 4OKDA 3WNPA 1KR0A 4KH2A 3CPUA 1E4LA 4AIOA 3VOCA 4PRWA 2WYSA 5FIPA 3L4VA 1OT1A 3NDYA 1BVZA 3SCWA 5M3WA 5KZ6A 2UWFA 2W91A 5LA1A 3WL0A 2WC7A 3AOFA 2GK1A 1HP5A 2ZUMA 1QI0A 5AYBA 3K1DA 2J7DA 2OSXA 3EYPA 1E4MM 4OBSA 2XVPA 1LG1A 2BY3A 2DIEA 1HVXA 4PTWA 5C70A 1X1IA 4N0RA 5EFFA 5IFPA 1HJUA 1TFVA 1W3YA 2YA1A 5IXEA 2YA0A 3PHAA 3BMWA 3RJYA 1QW8A 5A6AA 2BY0A 2FHCA 5FOOA 1UG6A 4TOQA 1EOKA 3MKKA 4UFMA 1F4AA 1MQRA 1OSEA 3QGVA 4M80A 1MQQA 1A47A 3SUWA 1J0KA 3KL3A 1A3HA 2VR5A 5CLTA 4NSBA 1HM3A 4C7FA 1TR1A 3BAYA 2Y8KA 1WDPA 4V2XA 2YBTA 3ALFA 1V3MA 1W1PA 1E40A 1UQYA 3L2MA 4E4PA 1UA7A 4A3YA 4KRTA 3BLPX 1C7TA 4WKAA 1JYXA 4Z2HA 3L4TA 5LA0A 4CD6A 1QBBA 4PCTA 4EANA 3WF1A 4WK9A 1GHSA 3WIJA 3WF3A 1JFXA 3VNZA 3SEPA 3U57A 1DWGM 1GOIA 3QHNA 4W7UA 4GIAA 1ZBVA 1V02E 2PC8A 2W63A 3L4ZA 4AISA 4UFKA 4P8WA 3GM8A 1CENA 3WBAA 3GXFA 1E5NA 1CGTA 3I3EA 1Q6GA 3AZSA 3W4RA 4JL2A 4XV0A 1EHAA 3W53A 3WMSA 1C82A 1ISXA 3NYDA 5EFDA 1OJNA 2RGMA 1K9EA 3PZGA 1TVPA 1GJUA 4AEFA 3WF4A 4CVUA 4GO8A 1DWAM 3AMGA 3VMOA 5FL0A 3GNPA 1J0HA 3SURA 2WSPA 1MXDA 1RH9A 3QHMA 1V02A 1N7RA 4BQ2A 2ZUNA 4CCCA 4A4AA 4P7OA 4UFIA 4CN1A 1RWCA 4TVUA 1KFWA 3WMBA 3OA5A 4AD1A 3OGSA 1O6IA 5D4YA 4H8VA 2YL6A 2CBIA 1FHLA 4HPHA 3ZT6A 2DPEA 2WPGA 2DDXA 3O2LA 3L4YA 1FFRA 6CGTA 3ZM8A 1ESWA 4CGTA 2CBUA 1E55A 4BQ4A 1V3LA 3GXDA 2ZUTA 1H41A 1H11A 4J7RA 2X8RA 3WH9A 2WZEA 1X1JA 3PZNA 3VO0A 1H0GA 4UQAA 4ACZB 1JZ8A 3WKZA 2D3LA 1N7QA 4S3JA 2O9TA 2XFRA 3OG2A 1W9XA 4B3KA 2XFFA 2VUYA 1JZ5A 1KB3A 1M03A 2ZXQA 2E8YA 4UTFA 1V03A 1CGWA 1V6UA 1VRXA 1OJPA 1LLOA 3PZUA 1Q4NX 5BXTA 2DH2A 1JF5A 5I5RA 4MNLA 5D9PA 5JBFA 5I79A 5FD0A 2XM2A 3AS1A 1FP9A 2YKKA 1QOXA 4NRSA 3VGBA 1JNDA 3K4AA 1V0KA 2WMIB 2XYLA 2E4TA 2VQUA 4PUEA 2UY5A 1Q6CA 1MFUA 2DT2A 1IZKA 2D0GA 2QV4A 4AIUA 1V0MA 4DUWA 1BFNA 3ZSTA 5FL1A 1H5VA 3MUAA 1RWHA 1ISYA 1NQ6A 3RILA 2O92A 2CESA 3MU7A 4QP0A 1W9BM 1P6WA 2J75A 2X03A 4S3KA 2DSZA 2FDMA 5CGMA 1DWIM 1UD6A 2D3NA 2Z1KA 3U5YA 5CLWA 3T2PA 1HMUA 1DTUA 2V38A 2DH3A 3UESA 2WHLA 5CSUA 4P7QA 1VIWA 3FY1A 3WF2A 3CIVA 2WB5A 1B3VA 4JCLA 1KQYA 3LPGA 1OJMA 3W38A 2C7FA 2J8GA 2E22A 1C8YA 4BQ5A 1E6QM 3BAWA 4W7WA 4PMQA 5A8MA 1UHVA 1E56A 1HKMA 1QHOA 3WH7A 3CUGA 3N13A 1E6RA 1VFMA 1WDSA 3SCQA 4D6CA 1BQCA 1R7OA 1I75A 2AAAA 3O6AA 3EDDA 1VEOA 2CEQA 2WZIA 4AW7A 1CXFA 2PWFA 3WDIA 3ZSSA 3VKKA 2J62A 1QW9A 1X6LA 3SUSA 3DYPA 5LA2A 5A8QA 3CUHA 3WD2A 3WQ8A 4BS0A 1PX8A 1IV8A 1H1NA 4AZGA 3ALGA 4L4OA 2DT1A 4UQCA 1BYCA 3IANA 5DT7A 1GVIA 4KGJA 4QFUA 2VZTA 4IPNB 3WMCA 4J27A 2VJXA 4C7GA 5A6MA 1CGYA 1VBUA 5C71A 3N17A 4LXFA 3AS2A 4AD2A 4AZ5A 3AXIA 1SMAA 4PTMA 5A8NA 2WXDM 4HTYA 1C3FA 4B15A 2X2YA 2VR4A 3WQ5A 5I2UA 1XCWA 1Y7VA 3GNOA 1NM9A 2HISA 4D1IA 1J12A 3WNLA 2V5CA 1EQPA 3SCOA 4D6GA 3TONA 1G5AA 2XTKA 1V0NA 4F8XA 2EBNA 1JD7A 2WHJA 3VDCA 5ABFB 1F9GA 3T0AA 2BHZA 4W89A 4QLLA 2WHKA 3AJ7A 5HPOA 4HA4A 3ARPA 3VNYA 1E4NA 3BAKA 3IAQA 3MV01 2X0YA 1ODUA 5I78A 3QOKA 3WH8A 5BCAA 1BHGA 2WK2A 3L4XA 2VZUA 1EHNA 3OZPA 3W6LA 3TOPA 3WEZA 1PJ9A 4UNIA 2XGIA 3WN6A 1WP6A 2WWCA 1QPKA 4UFJA 4GI6A 1MW3A 4AZIA 1GVYA 4M24A 5AYIA 2VVNA 1PPIA 4DM1A 4FLQA 1EO5A 1JFHA 2J78A 1L8NA 2GVYA 1JNEA 2BFGA 3ARVA 5IDIA 1OD0A 1BYAA 3ARTA 3MANA 3PZOA 1GCYA 3AIRA 4NF7A 3FXYA 4IM4A 2W5FA 4J3UA 3DYOA 5A8OA 3THDA 3WQVA 3EDKA 1ODZA 1E6SM 3HJEA 4HP5A 4Y7EA 4UFLA 1UD8A 3JUGA 1MFVA 2ZWZA 1SYTA 1TMQA 4B9YA 2WMHA 1UR4A 2EQDA 3CZGA 1J0IA 4QAWA 5ECUA 4XB3A 1BTCA 2CKRA 1F1SA 1G94A 1GPFA 1PX4A 2WHMA 1BLIA 3AIQA 4MNKA 1CXKA 1MW2A 3WFLA 3ARYA 3B9AA 5JUVA 5BXPA 2J25A 2EXOA 2XG9A 3DECA 1CZ1A 2A3BA 4TTGA 2XHYA 1HT6A 1W1YA 1RP8A 4BQ3A 2G41A 3WUEA 4ZE5A 4MB4A 1ZBKA 1PIGA 1ZB5A 4UZSA 2WMJA 2YL9A 1UH2A 1HJQA 3T2QA 1CLVA 5A3HA 4JKLA 3AIBA 1I1XA 3AIVA 1E0VA 1GHRA 3BH4A 3GZAA 4HPGA 1K9DA 5A2AA 3VDAA 4WKHA 3UERA 2J4GA 3MMWA 1JZ6A 4JL1A 3AI0A 4DUVA 1U2YA 3PZTA 1CNVA 5KEZA 3GDBA 1JYNA 5DO8A 2D22A 5D9MA 3ARRA 3TTOA 1TUXA 1W91A 1Z32X 2YDQA 3AYRA 5DT5A 1UH3A 3VUPA 1C91A 2WC4A 4QLJA 1E0WA 3WD3A 4HA3A 1PIFA 1E0XA 1CB8A 1OIFA 3GH7A 1C8XA 1EDGA 2W67A 4MB5A 1UR2A 3CZJA 1JXKA 3AIEA 4RE2A 1UR1A 5JIPA 4JHOA 5BXSA 3RM9A 4TTUA 3S2CA 5CSYA 4YPJA 2D0HA 4ZEPA 3AISA 1XH2A 4MNMA 2F2HA 1UKOA 3SCUA 2JF7A 3W81A 3A4XA 3TP4A 3VD5A 4ZE4A 2XVLA 3BAIA 4X9YA 3WUBA 2J47A 3PZMA 4U5KA 5CXPA 1QI4A 1HMWA 1US3A 4HZ7A 1NARA 1LJYA 2CBJA 1KXHA 3SCRA 4P7NA 1TA3A 2NT1A 4XX6A 4PMVA 3AHVA 4QCEA 2VX6A 4CVWA 1W9PA 2VRJA 1JYWA 1VJSA 4U3AA 5I23A 4XZWA 2BVYA 1AQMA 3F4VA 2VX4A 2XSAA 4GI9A 1OJOA 1SR0A 1RWAA 3VINA 1BGAA 1CXEA 3AROA 3NUKA 4JKMA 3VIOA 1LL4A 1WZKA 2ZWYA 5DF0A 4JFUA 2D2OA 1JDDA 1FFQA 2JIEA 3DC0A 1W1TA 3VIMA 1UZ4A 3CHDA 4CD5A 3GNRA 1ZJBA 5GNZA 4XZBA 4M81A 2PWGA 4CKQA 4H41A 4J28A 1GZJA 2EPLX 2WC3A 4UOJA 1OT2A 2ZX8A 2W4XA 3ARWA 3BGAA 4PSPA 4HOZA 2VZVA 2YL8A 5AY7A 2V3GA 3PTKA 1XRVA 1KGWA 2XWEA 2EPKX 3BAJA 4AZHA 4W8AA 3MV11 4LYPA 2D1ZA 1E4IA 1V0LA 3CUIA 3VD4A 4D6IA 1C8QA 1WDQA 5CJ5A 2ZX6A 1GOQA 2XIBA 1QNRA 2RGLA 4ACYA 3WL1A 1WO2A 1BG9A 3BCFA 5A8PA 1V6YA 3NCOA 3KL0A 4WSKA 1CYGA 3VM7A 2EO7A 3PTQA 3TTYA 4H8UA 5HOSA 5HXMA 1QI3A 3ZIZA 1B1YA 4PBGA 3AMCA 4U5IA 2YOCA 4MAVA 4AZ6A 1HNYA 1HL8A 2VRKA 3GXMA 3VIGA 1E3XA 1E43A 1DHKA 4LQ1A 4Z2IA 2Q8XA 4UZUA 2PB1A 1V3JA 6TAAA 3AS3A 1CECA 1M01A 1N7OA 5A6JA 3WH6A 2BRPA 1RPKA 4HMEA 1E6PA 1UKTA 3AIWA 2JFEX 3MSDA 5C8BB 4UQ9A 2D0FA 1QNQA 4KMQA 1UKSA 2WVVB 3AMDA 3VGDA 4QDMA 4J3WA 3NSNA 4GINA 5E0CA 5M17A 1W9VA 1EXPA 3WDJA 3WBEA 3BSGA 1JGIA 1DP0A 4P7LA 1E15A 5GNYA 2WANA 3ARUA 5IHRA 3NIYA 1HXJA 3GBDA 3N18A 3AMLA 2WBKA 2Y2WA 4M29A 1H49A 4OOZA 1CPUA 5E09A 4AY1A 2DGAA 2BS9A 1KGXA 2GK1B 2ZXDA 3W26A 4LYRA 3S6TA 1CXLA 1X1HA 2GFTA 2IXVA 7TAAA 5CPTA 4ZXOA 3NJ3A 3AIUA 3VIJA 4JHZA 3ZR6A 1JAEA 2E9LA 3G6MA 4OJYA 5EMYA 2BVTA 3WEOA 3WUFA 4Z2GA 1MW1A 3ZMRA 2VCCA 1JG9A 2ZIDA 4BF7A 1H3GA 4HOXA 1CGXA 1UUQA 2C0HA 2QMKA 1E1EA 4E2OA 4OZOA 1V6WA 4PUDA 1K9TA 1WZAA 2CIPA 2VOTA 2YDSA 1JL8A 1R86A 1WAWA 4FMVA 4U2ZA 4Z2LA 2E24A 3WH5A 2XJ7A 3G6LA 2DIJA 1JAKA 1G01A 2JEPA 3WDQA 3EBVA 4WKFA 1V6XA 2CITA 8CGTA 5BWFA 4JFSA 1EO7A 4UQBA 3W24A 2AOSA 3WQ6A 4PTVA 5A6BA 1AQHA 1OGSA 4W93A 3W0KA 5CPSA 3WY1A 5I6SA 3CUFA 3WELA 1FH9A 5A2BA 4UQDA 3VX1A 1VB9A 4DWSA 2VTFA 1ZL1A 1UOKA 3CGTA 1ISVA 3AZTA 1GQKA 4W5ZA 3F5LA 1NP2A 2JE8A 1W3KA 2OYKA 1HIZA 4MB3A 3LPFA 3FAXA 4HMCA 3PZQA 5FCZA 3IJ8A 4GO9A 1UYQA 1YQ2A 2CERA 1DEDA 1VEPA 3K4DA 1NH6A 4PEEA 4AZCB 3L2LA 2VZSA 1XSJA 3HN3A 4YN5A 2G4FA 2ZUUA 3VPLA 1M53A 4B3LA 2A3EA 3VDHA 3QHOA 3W6MA 3AXHA 4ZXLA 2WBGA 1JDAA 3T0DA 1UD5A 4R27A 4CD8A 2PBGA 1GNXA 5HPCA 5E6ZA 2ZXAA 2XWDA 3WNOA 1TA3B 3OLGA 1W3HA 1J9YA 5BRPA 2J7FA 1QVBA 3TTQA 2QHAA 3NDZA 3T09A 1ZBWA 1XYZA 4ATDA 4CU7A 1J10A 4MJ4A 1F4HA 5LYRA 4AMCA 4M82A 1J0MA 3AHZA 1LQ0A 5I0DA 5A95A 3VMNA 3PN8A 1VENA 3BSHA 1BGGA 1KBKA 1WKYA 2DT3A 1V3KA 1JIBA 3MUIA 7A3HA 3VDBA 2GUYA 4AZ7A 2J79A 2YIHA 2WVTA 2J74A 3L4UA 2XM1A 2C8NA 3CMGA 4WLCA 4EE9A 3GH4A 4W87A 2EJ1A 1LL7A 1EGUA 4BCEA 2VMFA 2WM0A 3CLWA 4WF7A 5AC4A 3OZOA 3THCA 4JZ5A 1WZLA 4AEEA 1QNOA 3KEHA 3UG5A 5BXRA 1UD3A 5CG0A 5CGTA 4RE3A 2WVUA 2CNCA 1L0PA 1GOWA 2BXYA 2G8ZA 2ZX9A 4OUEA 3VD3A 2D20A 2O9PA 4ZENA 4CD4A 1B31A 3OBAA 3O9NA 1AQ0A 2PWHA 5EBAA 2O9OA 5E6YA 2JALA 4D6HA 1G9HA 4GQRA 4LGXA 2ZUVA 5A69A 2MANA 2GSJA 1N82A 4F79A 2OYMA 4IISA 5A6BD 4YHEA 4FLSA 1SMDA 1UWIA 1PZ2A 4W5UA 4AD4A 3M07A 2QPSA 2VI0A 1EDTA 1J0YA 5E70A 1TE1A 1KR1A 1E1FA 2ZE0A 4CU6A 5D8ZA 1HVQA 1R85A 2A3CA 3T0BA 4NI3A 4D6FA 2BNJA 4TUFA 4HMDA 3M7SA 1LXKA 1GQIA 4MADA 2DEPA 1NOFA 4AXNA 3BLKA 3FAWA 3GXIA 3ARXA 1HKJA 2WNWA 3SCNA 1TG7A 1HN0A 1UWQA 3BC9A 2YJQA 2J7GA 3WD4A 4KGLA 4Z2JA 3UR7A 1XSIA 8A3HA 2OLHA 1CXHA 2XVGA 3W29A 4AYSA 2EPNA 2BY1A 3U7BA 1LG2A 4EK7A 5ABEA 2Z1SA 1KXVA 1OBAA 1C7SA 4GZEA 3A4WA 4CUCA 3IK2A 4UQEA 1N7PA 2JIWA 1W2PA 2VC9A 1C93A 4PN2A 1CEOA 5M03A 4E8CA 3LPOA 3VVGA 1KWKA 1JZ7A 1BG4A 3T08A 3RM8A 2PI6A 1V3HA 1CGVA 2Y24A 3A3HA 3VGGA 4JIEA 1Q6FA 2J7BA 4PSRA 3WNKA 3CZEA 3VGHA 1CLXA 2X09A 1LF1A 1N7NA 3RM4A 1QHZA 2QPUA 4PYSA 1HKIA 1FOBA 3WENA 4GKLA 3RO8A 1JDCA 3CO4A 3RIKA 2E9BA 4FLOA 1B30A 4FLRA 2WCGA 2ZUSA 3OGVA 2D24A 3M46A
chains in the Genus database with same CATH superfamily
1JD9A 5DMNA 2QGHA 3OLIA 1TV8A 3CIXA 1X6NA 3DYMA 2E0PA 1VP5A 2QVNA 1CBGA 1NQKA 2CBVA 2WLZA 1AL8A 3CZ8A 3ITCA 4LF2A 1QCWA 2QMJA 3N6JA 4V27A 3WF0A 1EX1A 4CU8A 3M47A 3HA1A 3ZOAA 3OHIA 4HCHA 3MTWA 1HJVA 1R87A 4JCMA 4PMOA 1QNSA 2O9RA 5EPDA 2E67A 4QS6A 2ZBTA 3GVVA 3AALA 2EKCA 1EDQA 1G0CA 1REQB 4UCFA 2X7WA 3TLLA 3UD1A 3WLKX 4F2BA 4PB3A 2RFGA 2J9XA 4EF8A 1S3HA 4Z2KA 2BY2A 2WJZA 1Z6KA 3VIKA 3DFSA 4H04A 2NWSA 1LXMA 5HK4A 3Q65A 1UMLA 4CN6A 2V81A 2HDJA 3VX0A 5C55A 5C54A 1V6TA 4Z1CA 1EJWC 1GUVA 1P0DA 3UYCA 2NV9A 1W8GA 1E9LA 2XPKA 1F6YA 2H6RA 4ZQRA 3KVJA 4KW2A 4MDPA 4UTIA 2YYTA 4UWMA 1U1HA 3L5LA 4XD5A 5KTLA 1K9FA 4HU0A 2OT0A 3GR8A 2YCEA 1KTBA 3BO9A 4FP1A 1A3XA 1OB0A 2GJXB 2BGSA 1V79A 3TNOA 5IBXC 1TV5A 4H01A 3QY7A 3UR8A 3AHTA 3TCEA 1JF6A 3DFPA 4D72A 3NQ7A 3HM7A 4HOWA 1PKLA 4YNGA 4LAZA 2VZKB 4HMNA 4WDUA 1E73M 3IGHX 5PTDA 1U1JA 1RALA 4Z08A 5LIXX 1RSCA 4DZHA 5CCZA 2XUCA 1M7JA 3PS7A 1UKPA 2VURA 3KTCA 3AICA 3FYOA 4DWSC 4NRRA 1FCVA 1E9ZB 1OD8A 3UR2A 3FHQA 4GI8A 4PCSA 1M7OA 3MO4A 5H6HA 4F48A 3E0WA 3SUTA 1US2A 2EJAA 1F3XA 2TAAA 3Q37A 2ZQ0A 4MB1A 4GYPA 4FXRA 4XZ9A 1XD1A 3M1ZA 3AYVA 4DO4A 3WDPP 2CZVA 5T9CE 4YS1A 2PDBA 1TRIA 1PTDA 4AIEA 2HEJA 5FI8A 1QBAA 4E3VA 5GNXA 3M64A 3W85A 4E5TA 1Q6DA 2KZHA 4ZQMA 1C90A 2GUBA 1W37A 1G4EA 1MXSA 3KE0A 3WNMA 3TA6A 4NXKA 4D1JA 4AVFA 5JBDA 1TVNA 1AD4A 1R3VA 2ZZ6A 1V5XA 3PSVA 3VIHA 4UMAA 2EPMX 1SZRA 2OO6A 4GI4A 1TTIA 5J5RA 5D2TA 3R43A 1TR9A 4F66A 1QK2A 4W84A 1RD6A 1ITUA 4FF7A 4W85A 3S2NA 3EX3A 2XVKA 3VMPA 5CC7A 1WBHA 4DZAA 1P43A 5IDZA 2ZXBA 3HPFA 3DCPA 3M5XA 2ZDRA 5CQ1A 5I24A 4G1NA 2EG7A 2V3EA 1FHDA 4B16A 4WVXA 4LVDA 4UR8A 2VFDA 2H9AA 3DFOA 3GC2A 3OGRA 3M0LA 1EGZA 1TZ7A 3BMVA 4S2BA 2Y88A 3W25A 3M6DA 1A0EA 4C6KA 2CHNA 1PKYA 4P8UA 3NQGA 4J3XA 4JQ1A 5EY5A 3WFZA 3IJDA 2POTA 4URIA 1EUAA 3GG8A 4NZCA 2A3HA 3VU2A 2GJPA 3IUDA 3E3HA 4K8HA 4WZHA 2IXUA 2VCBA 2NX1A 3TWAA 2PF0A 4B2DD 4H6RA 3DOPA 4EX4A 4MY9A 3MMDA 3UU0A 3GC5A 3IS4A 2PGWA 2UZ9A 2IQTA 1GYMA 4GE8A 4LTSA 4R88A 3L65A 4ROQA 1GG1A 1X8FA 4LWWA 2I7GA 2HE5A 3RLUA 4OTKA 4PUKA 2P3ZA 1UD2A 4UOQA 4JQ2A 3II1A 3EX4A 3OO2A 5DMYA 4JFWA 1VJZA 4IMAA 4GYJA 5GVJA 1Y8BA 4F9JA 3FK4A 3W2UA 1H4PA 3C2YA 4AD5A 1B57A 4RZ5A 4NUWA 3T0CA 4ZTYA 3OYXA 2AL1A 2VL4A 1BYBA 1KCKA 3AXKA 4PZVA 3F1QA 1L2QA 4GZIA 2ZTJA 2DT0A 3NVDA 1GORA 1HJSA 2G3JA 3PF3A 4TV6A 1KXQA 4IX2A 1UWTA 1H2JA 4PR4A 1MSSA 2QJJA 3CYJA 2GJXA 1S5WA 2JKAA 3KTSA 1T41A 1NWTA 4AMAA 2W66A 1BQGA 5K9XA 2DZXA 5HNNA 4HZ6A 3APTA 1H63A 1WB0A 3AQUA 3VKJA 3WUGA 1PZ3A 4IG2A 2QCDB 1Q6OA 2BZNA 4RUBA 2TMDA 1XLEA 5HMEA 4JGDA 2RDUA 2A3AA 3UNTA 1OFEA 3W86A 3OZMA 3RMEA 1US0A 5D9NA 2JEQA 1RY8A 4UR7A 8XIAA 1VFUA 3TN4A 2WDAA 5I06A 3BURA 1EGVA 2VGFA 1N8IA 1ZBCA 1UJQA 2B81A 2QZRA 1J0NA 4UTHA 4RE0A 2HNHA 1B9ZA 1RCXB 3THQA 2Y85A 1HF6A 2JK2A 3CZLA 4H00A 1T5AA 5E5CA 4IMDA 2MUCA 5EBUA 3I7SA 3TU9A 3SJNA 1X98A 1W3LA 3WQ4A 4I7WA 2B7QA 1XLHA 5AB3A 1JJKA 2X7VA 5JBEA 3S2LA 1B3ZA 1P1XA 3NQFA 1KCLA 4GZ7A 4NG3A 4PBEA 3MUZ1 2Q1FA 4YWIA 1XLCA 4EAMA 3E1F1 1LWJA 1Q45A 2DZPA 5A1AA 3NEHA 1GOXA 4HU3A 2E40A 1ECEA 4NAFA 4O8AA 4DX3A 3OZYA 4FIRA 5AVHA 3GK0A 2YSWA 4Y8FA 3AYSA 3EXTA 1GOKA 3K1GA 1WOBA 1UZHA 4NAEA 1LDCA 3P67A 2PWDA 3U5UA 4O57A 5HANA 1JZ3A 2OSYA 2QYGA 4LUSA 1PHQA 4DBDA 3QZ6A 1XYAA 2I5GA 3MSGA 2GDQA 1ONWA 2ESCA 2IW0A 4ZA0A 5C0QA 4TVDA 4ORIA 1RQEA 1LWHA 3CL7A 5M5DA 2WW5A 3ZVHB 2ZX5A 3WD1A 1LT7A 4YTQA 3DBNA 1V08A 4L1WA 1S46A 4HQVA 5A2CA 1KFEA 4NX5A 4QDPA 3JRKA 4J3TA 2VFIA 3NZGA 2Z7GA 1XLIA 3P80A 4GNKB 2GDVA 4CQBA 3RFAA 3R8GA 5H8UA 2ISFA 3INPA 4K38A 3MDWA 1BD0A 1Q6LA 2G97A 4A3QA 1ITCA 1KFJA 3N2MA 1Q8JA 1ME7A 4DJEC 4O1BA 1NOWA 4FB7A 3CMJA 2HVMA 3NL6A 4FI4A 4W86A 4B90A 4FAMA 3QW3A 2YW4A 3WG6A 1WZMA 3MUXA 4Y90A 4UUIA 3KM8A 4W7VA 2OG9A 4MNJA 3BOXA 2V3DA 3LB0A 1PXGA 3DC8A 3SUVA 2ZA1A 4FNUA 4LYQA 3L9CA 4GUJA 1Q5MA 4GOAA 3S1GA 3CBWA 3DHFA 1Y65A 3C3UA 4MJ2A 3VIIA 3QYSA 4N4PA 1D7FA 3NEVA 3ABSA 2PBOA 4RNJA 3KZSA 1SO4A 5CC5A 1W1A1 3ITYA 4PCPA 2FH6A 3HQNA 3PAJA 1E4LA 2E5CA 2WYSA 4FPSA 2PEVA 3WL0A 3BLEA 1AJ0A 3GIQA 4ZOCA 2ZUMA 1ONEA 5AYBA 2QT3A 2J7DA 2VC6A 1KTNA 3EYPA 4Z0JA 3VK5A 2XVPA 1HVXA 5BU9A 4PCNA 1XIGA 4UTJA 3T0TA 3MYOA 2NVDA 2R1NA 4N0RA 4JTIA 1TFVA 3OA3A 1K3UA 1EXBA 3CQHA 2YA1A 3TV8A 5A6AA 5FSEC 3TN5A 2BY0A 5TQLA 4E38A 1UZDA 4TOQA 3LU2A 1EOKA 4O28A 2NQ5A 3ID7A 3QGVA 4KEZA 3ZLHA 4IXXA 2PDQA 4UNKA 1Q63A 1J0KA 3UCDA 3KL3A 4FO4A 4RJEA 3VZZA 2W6RA 4NZ4A 4NSBA 5CLTA 1WBJA 4ZO7A 2Y8KA 1U22A 2A2IA 3ALFA 1JCLA 2J6XA 3N6HA 1V3MA 3QY8A 4E4PA 1UA7A 3GFYA 4I9TA 1C7TA 1UP2A 4GUHA 4BR1A 3L4TA 1UIOA 1QBBA 1TPEA 4FR6A 3UY8A 1ZFJA 3IUIA 5AOUA 3WF3A 1EYWA 1A5KC 3S2MA 3VCCA 2QJMA 4WGXA 3JW7A 3QHNA 4W7UA 4GIAA 3E96A 4DXVA 3BG9A 2PC8A 4DJFC 2WJDA 3LCIA 4UFKA 4AISA 4P8WA 4H6QA 3SADA 1SFJA 3I3EA 3G1FA 1EKOA 4B91A 2I16A 2OPJA 4JEQA 4NZFA 3WMSA 2IKJA 5J04A 3T8QA 1O95A 1OJNA 2E68A 1YYAA 3CHVA 3CAWA 4AEOA 4YTTA 3DFHA 3WK1A 4AEFA 4CVUA 3R0UA 3CEPA 4GO8A 1K4HA 2O0TA 3RR1A 2I17A 1JR1A 3DX5A 3RLVA 3BOFA 4DLOA 1XDMA 2ZRXA 2WO5A 1OC5A 1Z7AA 3GNPA 4MHBA 6TIMA 4MKVA 3SURA 2WSPA 2HVOA 5D30A 1ICSA 3LM3A 2Z28A 1I2QA 3W07A 4I9JA 2ZUNA 3H55A 1DIKA 1BWKA 2DZBA 3W1LA 3HBLA 3WMBA 3OA5A 4A8LA 3ITXA 4HPHA 3ZT6A 1QATA 2DPEA 3LXBA 2WPGA 3EB3A 3L4YA 1FFRA 6CGTA 3TIMA 2CBUA 1H11A 2X8RA 3EKZA 4F0LA 1NAL1 4GQ0A 3P81A 2DQWA 1SO3A 1BSLA 1KNWA 5D2YA 3PJXA 1H0GA 4UQAA 1MEWA 1O0SA 3GUWA 1IIHA 1O94A 1M6JA 4JNYA 5HNTA 3ES8A 3WBWA 4XISA 1OFBA 2PLCA 4DZ5A 2XFFA 1JQXA 2D2JA 3AUOA 1M03A 4Q4OA 3C0LA 4C6NA 1V6UA 5CSRA 1S39A 1VRXA 1OJPA 1LLOA 5BXTA 3DFTA 4GK8A 2YXXA 4MNLA 2A79A 5I79A 3QFEA 3Q94A 3UWYA 8XIMA 2XIQA 1SO5A 4ZOEA 3TEVA 3JS3A 2TPSA 4HSNA 4LUTA 2BASA 2WMIB 5AZ0A 4KWOA 1Q6CA 2D0GA 3LCGA 2YBVA 3LEPA 5G4WA 4AIUA 3GU9A 1DQWA 3B8VA 1BFNA 4DUWA 2Y7EA 4H9MA 5D03A 3R89A 3MUAA 3UXAA 1RWHA 1D7KA 3GB6A 2PP0A 2CESA 1P6WA 1GG0A 2ACRA 2X03A 5U7SA 2I9EA 3M5ZA 1UD6A 2D3NA 2Z1KA 4J40A 3G1RA 5HMFA 1NFGA 2V38A 2DH3A 2IMRA 3NPVA 4R34A 3FY1A 2ZRUA 3GIYA 1W5MA 5F1UA 1JCYA 5I3KA 2J8GA 4GIYA 3W7NA 4W7WA 4PMQA 3MSRA 2RH9A 1HKMA 4R85A 3CUGA 2YB1A 1VBGA 2CEQA 3VZXA 1FUYA 3VKKA 5LA2A 3EPOA 1PX8A 1IV8A 1H1NA 1OC7A 4AZGA 3ALGA 4L4OA 1GVIA 1JVNA 2INFA 4HYRA 4J27A 3UW6A 5EMUA 3CV1A 4C7GA 2GQAA 5A6MA 3L68A 2OGJA 3N17A 3HG5A 4PTMA 5A8NA 2Y7FA 1C3FA 4TV5A 3O0KA 4JOMA 3GDMA 2VR4A 1GVQA 2PDGA 4AB4A 3FYPA 4G5DA 1IIGA 3UYIA 3W75A 3Q4DA 3UJ2A 5CPOA 1R30A 2V5CA 4D6GA 2ZVRA 1V0NA 1OYAA 1GYNA 2R1KA 3T78A 3VDCA 4Q8OA 1K02A 4W89A 2WHKA 1B54A 3ANYA 3MCNA 4AVNA 3CQ0A 3TJXA 2KAUC 5HQEA 1E4NA 3BAKA 3EOSA 1BHGA 4LS2A 3A4JA 1W6TA 2IKHA 1WP6A 3WN6A 2WWCA 3H2AA 4UFJA 4A2RA 3ZLGA 4M24A 5AYIA 3GC4A 3HGJA 2FFIA 4Y6GA 4DAFA 4JTQA 1L8NA 2BFGA 2PAJA 3AU6A 3URQA 1Z44A 1ME8A 1E0UA 2ZCGA 2Z2BA 3CV7A 2PDXA 4GJIA 4ZGYA 4EXAA 2W5FA 4J3UA 3DYOA 2INEA 3O0FA 3NG3A 1ODZA 2RUSA 2ZFAA 4Y7EA 1TV2A 4UFLA 1UD8A 1UP0A 5HUPA 1EBGA 4B9YA 1UR4A 1XYBA 2EQDA 3VI2A 3CZGA 1J0IA 3G1SA 4J9JA 3AIQA 4H9XA 4XTIA 2GWGA 4DELA 3WFLA 3PK7A 4PB5A 3DECA 3HZ3A 4TTGA 3KTXA 4NI8A 4ZSUA 5I3HA 5HINA 4NQ1A 1O5RA 3E02A 1PIGA 1OZQA 2A21A 3PJWA 3KS6A 3MA8A 4LVAA 4FXJA 3RG6A 2FDSA 4Q3MA 3CH0A 5A3HA 3PJTA 5D2XA 3SQSA 1I1XA 3AIVA 1GHRA 1LCOA 5A2AA 2PLKA 3S6DA 4WKHA 4N7QA 4C1NA 1U2YA 3PZTA 5KEZA 3M16A 1JYNA 1R9ZA 5DXXA 5EMLA 2PDYA 4I6KA 1P6CA 4HB7A 1Z32X 3LV5A 4UTWC 1C91A 1XQLA 3WD3A 1E0WA 4HA3A 4ML9A 5BOFA 1U1UA 1EDGA 1UR2A 1SJAA 4RE2A 3MKCA 3WLSA 1IXOA 3WJWA 3WMLA 4MNMA 2F2HA 3K5XA 4LJ3A 3SCUA 1BTMA 2Z1WA 4QE5A 1E0TA 2GOUA 4X9YA 3UD2A 1HTIA 3O06A 1KXHA 4P7NA 2NT1A 3WLOA 1Q66A 3MVIA 4CVWA 1V51A 1KV5A 1JYWA 2AQVA 2GQ3A 2D73A 5I23A 3TC7A 4G2DA 4LB4A 1RWAA 4UTTA 3UPBA 1LOLA 2X41A 4JKMA 2OQHA 3FOKA 1TX2A 2E77A 5XINA 3E49A 4JFUA 2D2OA 3TAKA 3MHUA 3UVAA 4NHVA 1UZ4A 1UUOA 2PWGA 1F9CA 1GZJA 4UOJA 4AH7A 4IQEA 2ZX8A 3VNDA 3MCMA 1MNSA 2G50A 5LSMA 2VZVA 1DORA 1O1ZA 4Y9OA 1UJPA 1M9HA 4W8AA 1DJXA 5EU9A 1IGWA 1E4IA 3MQTA 4FOUA 3CUIA 2ZX6A 1MUWA 4V1YA 2R14A 2CW6A 1QNRA 4NJIA 1WO2A 3NCOA 4XUGA 2QUTA 4G7EA 2QCFA 5H8PA 2A6LA 4LSBA 3PTQA 5HOSA 3R2GA 1LORA 2Y61A 4PBGA 3O16A 1K03A 2V4IB 3OW1A 2PMQA 4UZUA 3T44A 4XD4A 5JU6A 3TYUA 2QGYA 4A8NA 1CECA 3EWDA 1N7OA 4HMEA 4EPEC 3QQ0A 2JFEX 1BVWA 1VFTA 3V0SA 3W22A 1J6OA 2XISA 4RK8A 1UKSA 4QSFA 1VPXA 3VGDA 4GINA 5M17A 1WKFA 3NURA 3WLLA 1EP3A 4P7LA 1OFAA 3SGUA 3SB0A 1AL7A 5IHRA 3NIYA 3OIXA 3R58A 3TQKA 1H49A 1QWKA 4JDBA 1CPUA 3DG6A 5AC7A 1KGXA 2ZXDA 3W26A 4MPQA 2IXVA 1XLGA 3PJUA 2HE8A 3NJ3A 3DEQA 3AIUA 2HXTA 3RCMA 3ZWTA 3HGSA 5L6UA 4DO5A 3VOIA 3U2ZA 2ZIDA 4S39A 1BWLA 2PDKA 3BVJA 2QMKA 3DFNA 4MUZA 4LB3A 4FOJA 4CQ9A 1V6WA 4HNNA 1K9TA 2VOTA 3VCRA 4L1GA 1R86A 1SZNA 3C3NA 3NQVA 2CLKA 4UXDA 1DJWA 2NLIA 4G7FA 2E24A 3WK0A 4HCDA 1KTCA 1UP3A 2ACQA 1JUBA 2JEPA 1TV7A 3EOUA 5CZJA 4RDYA 2OQLA 2AOSA 2OKTA 1H7RA 1T8XA 3B4YA 2PSNA 3EWCA 3GX9A 4PRRA 4RLIA 2DJLA 1L6FA 4WJEA 1E9IA 3B8IA 3FEMA 4DWSA 2VTFA 3CGTA 3GAKA 3MI2A 1Z69A 3IGXA 1W3KA 4O1DA 2OYKA 1S2CA 4HMCA 2ZTKA 5FCZA 3IJ8A 1UYQA 4XQ6A 3E0VA 3L2LA 2BMBA 3LNPA 2VZSA 2P50A 2ZUUA 4RDVA 4B3LA 4XZHA 5FESA 3R25A 4J5NA 1HQTA 3W6MA 2WBGA 2E09A 5HR6A 5EYWA 1UD5A 4R27A 4HNCA 5E6ZA 4IFOA 2HPIA 3WLPA 1TA3B 4K8GA 3U3HA 2PP1A 1K8YA 4C6BA 5EL1A 3TTQA 1DBTA 3RX3A 1LROA 2XFWA 4LH8A 4ATDA 4MJ4A 3PG8A 3LHVA 3ORWA 3MYPA 1Z41A 2VM8A 1LQAA 3VMNA 4IL2A 2GYIA 1AD1A 2QDGA 1YKWA 3S5YA 1WKYA 2DT3A 3WX7A 2VC7A 4Z1AA 3IUHA 1FX6A 4LFYA 3L4UA 5G1TA 2J74A 4QROA 3KOXA 4EE9A 2Z2UA 1FKWA 1TMHA 4DI9A 4O16A 1LL7A 3E38A 4QQ3A 5JXQA 3W7GA 3HFTA 2VMFA 1GQNA 4ICCX 1W31A 3BPWA 3H2CA 1V7AA 5AC4A 1F8IA 1UMYA 4UIOA 4KFNA 4INFA 5IOBA 5BXRA 3EX2A 1AJZA 3BV4A 4AVOA 1P7TA 1UD3A 4YLWA 4RE3A 4BI6A 4C6MA 1GOWA 2GWNA 3M0MA 2G8ZA 3VD3A 4AF0A 4H4IA 3DENA 4GX9A 4C1NB 4D6HA 1LBLA 3D47A 4LGXA 1RXOB 4FNQA 1CLKA 1KM4A 2Q71A 2V5BA 4JTRA 4IISA 1FHVA 4O0KA 4FLSA 4CCZA 3WK2A 2QAPA 3SY8A 1UWIA 5CBIA 4C1KA 4FS9A 3GFZA 1J0YA 1G6CA 1NU5A 1JCNA 2ZE0A 3KS5A 4KBXA 5D32A 2A3CA 4UTKA 3T0BA 1W5PA 3LENA 4D6FA 3SFWA 2EGZA 1RBAA 2PD5A 1TWIA 2ZRZA 1GQIA 1SSDA 1AQFA 1A5SA 5I3JA 4AXNA 1RLCL 1HKJA 3HPXA 2YXGA 1TG7A 3A12A 2J7GA 2QCHA 1U5VA 4AYSA 1KFLA 2BY1A 3U7BA 4EK7A 5REQB 1KXVA 1OBAA 3Q58A 2EPHA 2XN1A 3A4WA 1EBHA 2JIWA 1OFRA 5M03A 5C7VA 4E8CA 1Z48A 3E74A 5DMMA 3TC6A 1BG4A 3S47A 3DI0A 2CFFA 1QRQA 5K4XA 3EKGA 1DV7A 3LOTA 2J7BA 3A23A 1FWHC 4JY9A 3H2FA 3ZR4A 3N73A 1FWCC 3RX4A 3LYEA 3OHMB 1CLXA 1QHZA 4PYSA 1JDCA 3CO4A 3RIKA 3RAOA 4FLRA 2REQB 2WCGA 1TZZA 3BICA 2FGBA 2ZUSA 2CLEA 2NQJA 4PL2A 4O0ZA 2EG8A 1CTNA 2GDUA 4JTTA 3AHXA 3GNXA 3QFWA 3LTSA 4HPXA 3W7JA 1JDEA 3G2GA 1TKKA 2YFOA 3QZEA 2AL2B 3HGOA 4ADTA 1RJPA 4D6DA 2QCEA 1OYBA 2V63A 2EF9A 3B0UX 4UMCA 4AZCA 1HUVA 2P0IA 2CU0A 3AJXA 4REQB 1OWQA 4J3SA 4PL1A 2HBVA 2PTYA 1J2BA 2VDHA 2VT0A 3S9IA 3WBXA 3LGGA 2FH8A 3DFYA 4WJXA 1RHCA 4H9YA 3NA8A 3AS0A 4O1EA 2VEGA 1E6NA 1JYVA 3BW2A 1EC7A 2DZSA 2WOQA 1AMKA 3QTPA 3PANA 1SJCA 5TIMA 1AK5A 2DUXA 2FGZA 1W3JA 4Q4KA 2WLYA 3QMRA 3FKKA 4CEXC 3KP0A 1NFBA 3SJ3A 3LY0A 4O1AA 1O4UA 3D3AA 3MMTA 2WQPA 4ECLA 1AA1B 2NXHA 1EQCA 2FKPA 2VZKD 4LEQA 1DJIA 2BOFX 3OJGA 3NZ1A 2QDHA 2QLYA 1TE6A 3G0UA 4NNAA 2VFHA 3B8SA 1WKDA 4IUGA 4LY4A 4ATLA 3W2LA 3W71A 4F0SA 5BRQA 3CK5A 2Z26A 3ANUA 3T81A 1VEMA 4MZ1A 3UY7A 4G9PA 3SCTA 4PB4A 5GJNA 5MKGB 3WQWA 1NP0A 4PUWA 3TJ4A 3KHDA 2V82A 4AC1X 1TCMA 4MSSA 3FHAA 4B5VA 3ZJ8A 3C2VA 3GBEA 2DW7A 1FWWA 4XD6A 4PMXA 3GTNA 1PUDA 4GZJA 3QLLA 1DXFA 4L65A 4BY3A 1WDRA 2J9YA 3M44A 3V18A 3MKVA 2CHRA 2FVKA 1RWGA 5JMUA 2YL5A 1BPLB 2OLAA 2B7OA 1Q3NA 3PWAA 3UXIA 2XH7A 4MZYA 2WCSA 5KZEA 3IVSA 4CD7A 4MTVA 1I6NA 3XIMA 1RQBA 3BLLA 5HWNA 2QDEA 5K3VA 4GIEA 4ZQNA 1OX4B 4XIMA 3TXVA 3QPEA 4DF2A 3TYBA 3H53A 2X05A 5CZKA 3EMZA 3W3OA 1PX3A 4CCEA 3CHCA 1RBLA 2BVDA 4MWAE 1O7AA 1Q6EA 1W54A 3K46A 1H61A 3RITA 2YCIX 4TVCA 1IWPA 3DHPA 5MKGA 3D5HA 2HRWA 3VM5A 1YDYA 2CETA 3SRFA 1HFBA 1XF0A 3POCA 5FJUA 3UJEA 1MWOA 1UA3A 3N2TA 1MUCA 1XD0A 3REQB 5HNRA 2OOFA 3ZJ6A 1UQZA 3FV9A 1BF6A 2Z29A 5T26A 4K8EA 3CHFA 1ZNNA 4RL3A 3A6OA 1XIEA 4S3BA 4X0VA 4JN6A 2VZOA 2PRHA 3I3DA 1M65A 2CYGA 1JRCA 4ASTA 5BW6A 3ERPA 4NJGA 3FNDA 1SFTA 1MVYA 4Q7NA 3ABZA 1TPH1 1HO4A 3KOWA 3QSRA 4A2SA 4AG0A 1PIIA 4HSHA 4DIAA 4YVPA 3BL3A 1LWIA 3OVGA 3TDFA 1IE7C 1K6AA 4WX2A 1M68A 3SGGA 1FWBC 1GW9A 1H0IA 1RJRA 1QHPA 4O53A 1ME9A 4BI5A 4EKJA 2ZRWA 1V4YA 4S3DA 2ON3A 3I7QA 3OLEA 3ZVIA 2VOMA 1I2RA 1IZJA 4JTKA 3L66A 3NL3A 5D9OA 2E5DA 4EPKA 1VFFA 3FVDA 4LRSA 1RQHA 1IEIA 2XGBA 3R0DA 3GYEA 3STGA 5LIYX 5A94A 2WKJA 3URBA 3UF9A 1RUSA 2HS8A 4YHGA 4MF4A 4KIRA 4ZCWA 3RCNA 2F84A 2AL2A 1LQ2A 2XN2A 4XUYA 2DJXA 3BUVA 3U2CA 4ML4A 2Q3OA 4IXHA 8RUCA 2VX5A 1RA0A 4CQAA 3RPDA 4B5UA 1NWSA 1UD4A 2OSWA 1SW7A 4ENLA 4I8DA 1S5NA 3RO6A 2G3NA 1F6PA 4H9VA 4PUNA 3AMKA 5IHSA 3HF3A 5D2WA 3VGFA 4D6JA 4Z42C 2XFYA 3W1XA 3GYCA 2XIIA 1UWRA 9XIAA 4UOZA 4WEVX 4JTGA 3VD9A 2OWXA 4B4HA 2VEIA 2PWEA 1FWIC 2PDWA 4GJ1A 3ATYA 2WNQA 4AY8A 4V15A 3KL5A 3KRZA 1H62A 2E8ZA 4LAOA 3P0WA 3ZR5A 4R33A 4XVDA 3K30A 5ABGA 1AH0A 3QGKC 3HPSA 1R8LA 1CXIA 4DWSD 2WWDA 3BQ5A 1MO0A 4S23A 4X63A 3BZJA 3TTSA 1IR2A 3B8TA 1UH4A 3QH2A 4HNVA 1TO3A 5CZ0A 3W83A 3EMQA 3MB9A 4GQQA 4C65A 2ZZ4A 3P8JA 4ROPA 3GNNA 1DJGA 3MDUA 4IHCA 5D8WA 1WKEA 4PTXA 1UOZA 4TX8A 2BGQA 1OG0A 4RPQA 3PWIA 4GVFA 3I3BA 2WCOA 2YB4A 5I09A 3B9DA 1OCQA 1U83A 3N12A 2OZ3A 2TSYA 4OBRA 3N2OA 3H4WA 3S5NA 4DWSB 1T8QA 3KCLA 4NP7A 4M1RA 3HMJG 1EH9A 1KCXA 5HJXA 4X0NA 4JTUA 4ZR8A 4OFCA 4Z1YA 3VUSA 5G5IA 3CU2A 3W87A 5CJMA 2PDIA 3GH5A 4TXEA 2PTXA 1QW7A 1LUCA 4QG6A 2BRWA 1M3UA 1DJZA 4HGXA 3E0FA 4UR9A 1W9DM 1WV2A 3GTIA 2ZZ5A 5FF7A 2DIKA 1T6MA 2IUZA 3OIHA 4JIHA 2NT0A 4AY7A 2H90A 3CPGA 3POHA 1J8VA 2E9MA 3VCNA 4NL1A 1VRAB 3VC6A 4IPPA 4XBKA 5HDRA 3G1AA 3T7VA 1Z9AA 4HJFA 1TTPA 3IJ9A 1SJDA 1EWEA 1QR7A 1VCFA 3G1HA 3JZUA 1TREA 1YTDA 1J18A 1IYXA 3AZRA 3KXQA 1N8WA 3GSMA 1GJWA 4UTWA 3QC3A 2PWVA 3CQIA 1V6VA 3IIXA 2CLFA 2Z2AA 4L5ZA 3N14A 1L6WA 4U33A 3M0XA 2DP3A 3T4CA 4LVFA 3HOJA 2QJIA 3OYZA 1I4NA 1SQ7A 2HNEA 1XR2A 1UR0A 4JTAA 3F5KA 4GX8A 1F05A 1B90A 2GGIA 4ORMA 4TR9A 1I1WA 2CZDA 4ATWA 2CZEA 4DJDA 2C1HA 3W7KA 4JAWA 2NQZA 3F5JA 4AHQA 1W3IA 3TW7A 3EX1A 3S0CA 2XZ9A 2JQXA 3ECQA 4F0KA 5I77A 4XZMX 3EDJA 2FHFA 1IZCA 4RE4A 5I07A 4JTLA 3S83A 1OFDA 3TMQA 1AMYA 3NFUA 1GVFA 4N9EA 2ZADA 4JYEA 2J9ZA 3EAUA 2OODA 1ZPTA 1LZOA 5REQA 5K7JA 4IIEA 4ZQPA 3IVTA 2PRMA 3NXFA 3BGGA 3CTTA 1OF8A 3B4UA 1X1ZA 1HKKA 3GR4A 3BTNA 4D8OA 1IT0A 4QJ3B 1JPIA 5DCDA 1Y0EA 1FY6A 3N2BA 2E3ZA 3SBFA 1OX5A 1OFOA 4ZTXA 3CUJA 1YDNA 4C7DA 4G56A 4O18A 3OTRA 4ZSTA 1FH7A 2ZVIA 1UKQA 4Z1DA 4MKNA 1AUSL 1J0ZA 1CCWB 1D3CA 3SCSA 2XVNA 1KFBA 3NSXA 3LMYA 4ZODA 4QX4A 4O50A 4TQTA 1RP9A 1W5QA 2HMCA 3W37A 4AX7A 2DSKA 1MRQA 1UWSA 3LZ5A 3ZT7A 4QE1A 1N7KA 5CZSA 4M6PA 4LCRA 4DUXA 2WJFA 5FKYA 2C15A 3QR3A 1B3YA 4BA0A 3MWAA 3R4IA 1NWRA 1H5YA 3TX9A 5TF0A 3BV7A 1XG3A 3V16A 1XGEA 4J3VA 1H51A 5F2MA 2WAGA 3PQIA 2QQ6A 2D23A 4L6OA 5GPRA 3SN0A 4PCFA 2J8FA 4DHGA 1B4KA 4TO8A 1F07A 4LANA 3CPUA 4O11A 1CB7B 3L5MA 4GFSA 3VOCA 3E0IA 3PBWA 5FIPA 3MJYA 1A80A 1BVZA 2W91A 5LA1A 4C6CA 2EG6A 4DLMA 1ZZMA 3R1ZA 2OSXA 1S2WA 3LCXA 3QR1A 1E4MM 1UC5A 2VEFA 3STFA 4GA8A 1LG1A 2DIEA 1X1IA 4GQBA 4KCVA 4JIPA 4AXKA 4RXGA 1XC4A 3KHJA 2PDMA 2YA0A 3RJYA 4N2YA 4IWWA 4JY8A 4RNHA 3VE9A 1PWLA 4UFMA 1JEZA 4HN4A 2ABBA 1KM1A 2VUNA 3LLDA 4H7CA 2FVLA 3I7RA 1EWDA 2BP1A 1A3HA 2VR5A 4R3UA 1OHLA 1IWAA 4QE4A 1KD0A 3KW3A 4V2XA 3L23A 2YBTA 2ICSA 1R9XA 4KRTA 5BOOA 1KRAC 3PUOA 3V7PA 1JYXA 4Z2HA 3GXPA 4PCTA 3GHRA 4EANA 1M1BA 3NDOA 3ABRA 4WK9A 1GHSA 2XDFA 3VNZA 3FGCB 4AWTA 3LXCA 2C91A 3O07A 3R6IA 2W63A 5BOEA 3L4ZA 4GGBA 3OQEA 2YCJA 1CENA 3WBAA 5E9XA 4M19A 4M3PA 1CGTA 3V1PA 3AZSA 2CZ5A 3E12A 4UMBA 2QCDA 4JL2A 2GSEA 5F4WA 1EHAA 1C82A 3SRDA 3TR2A 2ZE3A 5HJYA 4S38A 3G77A 3LLXA 1ISXA 5EFDA 4AWUA 4RNIA 4DEFA 1EIXA 3KDOA 4Q4PA 1TVPA 3WF4A 1DWAM 3AMGA 4K6AA 2NVAA 3VMOA 3S5SA 1ZJHA 5FL0A 3WYZA 4H9ZA 4RW5A 4IX0A 3A13A 7REQA 1MXDA 1RH9A 1QXLA 3KCOA 4BQ2A 3TROA 3SR7A 4GABA 4MM1A 3U6WA 3TW9A 1O6IA 1LRTA 3CTLA 3GG7A 1FHLA 1ECQA 5MHBA 2X2GA 2DDXA 5LIUX 3ZM8A 4D2JA 1JRBA 1E55A 1XUUA 1E51A 2ZUTA 4CNNA 3N19B 4EXQA 2WZEA 4CEUC 3PZNA 1IQ8A 3ME3A 5AKQA 1JZ8A 2R1MA 3A64A 3HIJA 2V2HA 1N7QA 2HPMA 5CH9A 1DE5A 3OODA 2FZ8A 5BU6A 2ZXQA 4UTFA 1V03A 1EJ7L 3M9YA 1CGWA 3KDNA 5CJNA 3IVUA 1Q4NX 8TIMA 3B9NA 2DH2A 3GIPA 3NZPA 3GAYA 3E2SA 3Q45A 3WJZA 3PFRA 2CWNA 4XAGA 3PPHA 3PPGA 1TX0A 1FP9A 2C6QA 2FYMA 2YKKA 2NVCA 2G4JA 2E4TA 1GZGA 1MFUA 3R10A 4LNCA 1TPUA 1I60A 1OABA 3TYEA 5CC6A 4UTLA 1B9BA 3SQMA 1ISYA 3ABXA 4AAJA 1NQ6A 3RILA 3IPWA 3UA3A 4QP0A 3MPGA 1OVDA 4S3KA 5KMYA 2PU1A 3U5YA 1XFCA 1VZWA 3R13A 3UZXA 2DVXA 3UESA 1A5OC 5FAJA 1GZ1A 1RVGA 5CSUA 4O14A 2GUUA 4P7QA 1VIWA 1XINA 1R3RA 3CIVA 1KKRA 1XUZA 2ZA3A 1B3VA 1KQYA 3NQ6A 1KM0A 3S5OA 2ZZ2A 3W38A 4ES4A 2CLHA 1JUEA 5H91A 1QHOA 4XG1A 2FMNA 1R7OA 2WZIA 1JQVA 1CXFA 4M6VA 3LLFA 2J62A 4N4QA 1QW9A 3PNUA 4PE8A 3SUSA 1YPIA 3BCJA 3CUHA 2PDHA 4HIBA 1C9DA 4BS0A 4DI8A 4RDWA 4UQCA 1BYCA 2VD8A 3IANA 4KGJA 4R7JA 5AN7A 3GDTA 4CNSA 4WXZA 2W79A 1CGYA 3O15A 5LZLA 3AS2A 3CQJA 4HTYA 3IWPA 4UCGA 3H8AA 4F3HA 2WSQA 4OV4A 3E9AA 3GNOA 4ZB5A 1FCQA 2HV5A 4QG8A 1J12A 2BTMA 3H7RA 3NGJA 1NTHA 1G5AA 3F7JA 3P6LA 4HYVA 2EBNA 1N55A 5ABFB 3T0AA 4JBRA 3AJ7A 3NPUA 2YR1A 3PUDA 4W9TA 1F6KA 3S4TA 4MWAC 3NO3A 2NV2A 3IAQA 3W1AA 3VE7A 1ODUA 1RR2A 2OVLA 4A8IA 5BCAA 3QV6A 4WXYA 2O56A 4I7UA 2E7FA 2VZUA 2I9UA 5EA9A 3TOPA 2IPGA 2FVMA 2PDCA 4OVXA 3NWRA 1I2NA 3WJXA 1HW6A 2R1PA 2VVNA 4GXWA 3KBSA 3REQA 3WQCA 4FLQA 1EO5A 3KLKA 3HO8A 2J78A 1JNEA 5IDIA 2YPIA 4O13A 3MANA 3NQMA 3PZOA 1MNZA 4N6EA 1BXBA 3FXYA 1AZ2A 3NVTA 5A8OA 4G6CA 3OBEA 1E6SM 3U4AA 5DN1A 4DYKA 3EZ4A 4IT1A 1MFVA 1SYTA 4QAWA 5ECUA 4XB3A 1AW1A 4GNVA 4GUGA 3OOQA 1BTCA 2OT1A 1G94A 4I9AA 4YXGA 1R38A 3QC0A 3QSTA 2VC5A 1I9CB 3LCFA 3ARYA 5A6TC 2XIOA 4HK6A 2DFAA 5CBBA 3K2GA 1CZ1A 4C1LA 2XHYA 1HT6A 1P48A 3KWSA 4BQ3A 4LVBA 2BXVA 3WUEA 4AWSA 3ATZA 3ZYZA 2BDQA 4MB4A 1ZBKA 1S3TC 1S2TA 4KWWA 4UZSA 2WMJA 1P0EA 4LUSB 3CB3A 3SIZA 3C0SA 3UXLA 2YL9A 3SSJA 4O19A 2HS6A 3T2QA 1CLVA 5F1VA 3AIBA 1E0VA 1W3NA 1K9DA 3UERA 2J4GA 3GXTA 2G0WA 3AI0A 3LCLA 1CNVA 3GDBA 1W17A 3AWOA 3LSCA 2GPTA 3TTOA 1QPRA 1TUXA 1XRSA 5DT5A 1TPB1 4RZ6A 2X42A 2QF7A 3PBVA 1E0XA 1CB8A 4IL0A 2P8CA 4M0XA 1E9YB 3AIEA 3LBOA 3BLFA 5JIPA 2H8ZA 3VYLA 3TWBA 4JHOA 5BXSA 4TTUA 5CSYA 1A5MC 2D0HA 4YPJA 5SWUA 2NQ9A 3T55A 4C6LA 1RY0A 2JF7A 3S42A 3W81A 1HG3A 2XVLA 2VEPA 3S9ZA 3BAIA 3WUBA 5AHIA 4I8YA 1QWGA 1XBZA 3QBUA 2CBJA 1A4MA 1TA3A 4PMVA 3UWEA 3AHVA 4QCEA 4MLRA 4U3AA 2VGIA 4XZWA 3RU6A 3F4VA 2VX4A 4HKPA 4GI9A 5XIAA 4DXXA 1CXEA 3CNYA 3NUKA 1LL4A 3C0QA 3QGAC 1WZKA 4IFRA 1GKRA 3FFSA 3DC0A 1M7PA 3VIMA 3CHDA 5GNZA 2X1UA 4XZBA 1PVNA 4M81A 1EF2A 3QYQA 2XN0A 3B8WA 4JICA 2EPLX 1GVRA 2PTZA 3KUMA 3BGAA 2W4XA 4PSPA 1WYIA 3H12A 3VNIA 4D9PA 4HOZA 1X7FA 2YL8A 4JN7A 1X97A 2FTWA 1KGWA 3LQGA 3MW7A 3BAJA 4U28A 2QPXA 2BG5A 1V0LA 1QFEA 3UR5A 3MBDA 4Q8NA 5LNSA 2YCKX 1GOQA 4ACYA 3FCPA 3HQ1A 4R7OA 3WL1A 4PGLA 1V6YA 1VYSX 1MUMA 4WSKA 1CYGA 4MOZA 3VM7A 3GDRA 3UPWA 1VQTA 3WZ0E 4H8UA 3ZVHA 1QI3A 4J1OA 2VEMA 3GUGA 1LP6A 3PUEA 4U5IA 3M0VA 4MFEA 4KWVA 4WRHA 4MAVA 3MT1A 4AZ6A 4O1CA 4DZIA 4QJ5B 1HL8A 3GXMA 3EEGA 1KBIA 2X0SA 1DHKA 4LQ1A 2YGYA 1EF3A 1I2PA 2QIWA 4AIBA 2OFJA 3GR7A 1VBJA 2V2DA 5FACA 1H7OA 4M6QA 5DLCA 2AQWA 4NKCA 2FMOA 3TCSA 3MSDA 2VEKA 4HJWA 4KESA 4KMQA 1XIIA 1TVLA 3DGBA 2PTWA 4QDMA 4J3WA 3NSNA 1FDJA 3B04A 3WBEA 3BSGA 1L2UA 1Z89A 5EMJA 4HPNA 1XLKA 3S2JA 2PDPA 2WANA 3ARUA 5FEPA 1NDZA 5KINA 5E09A 4A3UA 3TQ0A 1FVPA 2DGAA 4GYPC 3N6QA 2V5LA 1X1HA 1GGOA 7TAAA 3VIJA 4NU7A 1JAEA 4L7ZA 3BJSA 5I3IA 2WSRA 3G6MA 5EMYA 2BVTA 3G3DA 4NY2A 4BF7A 3TYCA 1GT8A 1OZMA 4WGHA 4NJJA 4PC8A 2C0HA 3DAQA 3GVGA 4QG9A 3N9SA 4PUDA 1R3WA 2A7NA 1WAWA 1EJRC 3LQLA 4GXMA 3LBMA 4PUJA 1ICPA 3LTPA 3WH5A 2XJ7A 4JQ4A 2WZMA 2O4MA 4UTUA 3HPAA 3WDQA 3O3RA 4WKFA 1R3QA 4XKYA 2RHGA 1EO7A 4NVTA 3QTGA 4PTVA 2Q8LA 4GH1A 1ZRQA 4EVZA 1EPXA 1PSCA 5A6BA 4IIFA 4LUIA 4W93A 3UGVA 5C5YA 3HQPA 1LLQA 3PC0A 3VX1A 1UOKA 1ISVA 3AZTA 4W5ZA 1T0OA 3B3DA 4L4MA 4XZIA 1TPFA 1HKWA 4S1FA 3H26A 4ZO6A 1HIZA 3LPFA 3FAXA 4JIIX 2IPFA 4GO9A 3QN3A 1TJ0A 4BKNA 2P88A 4PEEA 1ELSA 4AZCB 1Q2SA 3EOLA 5HUOA 1TB3A 4GWEA 1IT8A 3HN3A 1QOQA 1QPQA 3UXKA 4N9DA 3VPLA 1XWYA 1ZUAX 3NL2A 2A3EA 4Y9NA 1FDYA 4R9XA 3VDHA 3V35A 1ADDA 5K9CA 3QHOA 2R24A 4ZXLA 3WQGA 4DVOA 2PBGA 4GIRA 3SY5A 3HFYA 2EKGA 3A3WA 3WNOA 4L9ZA 3KVKA 5L9FA 1SZGA 3BOLA 3QPYA 4CQDA 3QMTA 4S3FA 4US5D 3T09A 3STCA 1ZBWA 2QIIA 1XYZA 5D04C 3FXGA 3LHUA 3KVMA 3O6YX 3STEA 5LYRA 4AMCA 3W7MA 1SW3A 1YPFA 1LQ0A 4NYYA 1VENA 3MHGA 5HAOA 3SSZA 2VFFA 4Q8VA 3TOYA 4WY0A 2C71A 4CQCA 1V3KA 2JKPA 1I0BA 3TYDA 5I7GA 3F2DA 2GUYA 1K7EA 2J79A 3DZ1A 4QS5A 1DVJA 1QPNA 4H6EA 3CC1A 2C8NA 1VFSA 4LBSA 1OFQA 2YEPF 4WLCA 4L6HA 5D38A 3HG4A 4W87A 4R7WA 1OK6A 4LOCA 3B03A 3G24A 4DQWA 3THCA 3LZ3A 4JZ5A 1WDWA 3KEHA 4HTBA 1TELA 1RV8A 1FCBA 2F6UA 2CNCA 4N02A 2BXYA 4JDYA 2ZX9A 4OUEA 4B92A 3USZA 4IJCA 4U10A 4A29A 2D20A 2O9PA 4ZENA 3B8DA 2ODOA 4NJKA 2QULA 3O9NA 1AQ0A 1BRLB 2Y6ZA 3HPZA 2PWHA 5EBAA 1O60A 2JALA 4I5UA 2ZC8A 3VNJA 2ZUVA 4ZB2A 3KZPA 3QF0A 3PP7A 1S1RA 1XG4A 2MANA 4DPPA 2GSJA 1N82A 3DFQA 1MZRA 1BWVA 1VPQA 5KZMA 4JHMA 2CLOA 2PF8A 4QNWA 3GW3A 2B7PA 2QPSA 3B40A 1EDTA 4EOUA 5E70A 3FIGA 3IRDA 1FWTA 4XIAA 1VFLA 3QXBA 3NQDA 4NI3A 2BNJA 4IFKB 4POCA 3W2JA 3COTA 1NOFA 2QEZA 2OELA 3MP5A 3CWOX 2J13A 3SCNA 1KW1A 2UBPC 1HN0A 1UWQA 3BC9A 1K77A 2YJQA 5F4SA 3WD4A 2B4GA 3C2OA 2XVGA 3PUGA 5TAOA 9XIMA 3CL6A 3ZWSA 4JPGA 4LS0A 5ABEA 4CNUA 3GO2A 2Y1HA 1K7FA 2W0UA 1LBMA 3ZFHA 4CUCA 1Q13A 3TR9A 1GYLA 3S6OA 1LOQA 1W2PA 2VC9A 2DVTA 4PN2A 1PL9A 2CLPA 4GG9A 4PUMA 3WQOA 1A4LA 1EJTC 3VVGA 3R8RA 2C79A 3T08A 1V3HA 1CGVA 3A3HA 4XAFA 3SECA 1GTEA 3H2OA 4JIEA 3CEUA 1Q6FA 4AUBA 1EJXC 4O4VA 4YL2A 3CO8A 1FWSA 3VGHA 3W7QA 4GNJA 2X09A 2BSLA 2DZVA 5CGQA 2Y70A 2AQOA 3IRSA 4JX4A 4E6MA 3GD6A 4Y9PA 3GE7A 3M46A 3QOMA 2J66A 2X0HA 1R47A 1XV8A 3QLDA 5DFAA 3SRKA 4AC7C 4HA1A 3BW3A 2DQXA 4PMYA 4WD0A 4ILSA 1E70M 4H9UA 2EPOA 3RF9A 2WMGA 1WUFA 3RGTA 3TQPA 1BF2A 1WA3A 1A5BA 1OCNA 3KBNA 3D46A 4UFHA 3FVMA 2WQDA 3NO5A 1W5NA 3VILA 4S3GA 4JTEA 4JR5A 3QKZA 1GKPA 2A5HA 3NO1A 3UG8A 1J11A 5C9WA 1OGGA 1VFHA 3TA9A 3GTFA 4H8HA 3BARA 3W7IA 3W82A 3ZJ7A 4H2HA 3GRIA 1NVMA 4H9TA 5DEZA 3NPXA 4W8BA 3V0UA 3U9IA 2ISDA 1UROA 3LG3A 2Q01A 5DRCA 3FJNA 4B9ZA 3OG3A 2I1OA 1XP3A 1B3WA 4ACZA 4OUIA 4PMNA 3N2XA 4LALA 3A4AA 3BXWA 3BCDA 3C61A 1NDYA 2P1FA 2A6NA 2E5BA 2CPUA 4QXIA 1XLFA 2ZX7A 3U2EA 1SZFA 4IGSA 1UR8A 1S2UA 1W2VA 3GDLA 7PTDA 4HNLA 1ZGDA 3ZXWA 2IKGA 5EMMA 3D0CA 2Y62A 3QQWA 4K68A 2AMXA 7ODCA 2OYLA 1NOUA 1IXQA 1H7XA 1B3XA 1FWAC 3SY1A 3C5QA 3AXXA 3CIWA 3BGJA 4QITA 3IJ6A 1LT8A 3TVAA 3JR2A 3EWXA 1ZSXA 4LF1A 1WPCA 1C92A 1ZAIA 5G4HC 2R1LA 1EPVA 1QI5A 2YX0A 5MF5A 4QHRA 1E72M 4WDTA 3CPRA 3N3TA 1VF8A 3H21A 3NSMA 4GKTA 1Q7MA 3A22A 1UR9A 4GLEA 3EPNA 1DWFM 2PGEA 1FWNA 3NZQA 1GEHA 2Y5SA 4UC5A 4YTUA 1DJQA 1XYCA 2DY3A 2E6DA 4ICNA 3P84A 5C9RA 4IMEA 4YVXA 1RD5A 1E5JA 1BVNP 3W27A 1MRAA 1DWJM 1JPMA 3KBTC 2W61A 3EA1A 2W9MA 1XW8A 2XU2A 3CUZA 2YLLA 1JCXA 3DG3A 3WD0A 2FPVA 4DLFA 4ZOBA 4I6VA 5HNUA 2GJNA 5HA7A 1GW1A 1VPYA 1ZP4A 1B0IA 3FEQA 1M04A 1JXJA 5E9AA 3PAOA 4U2YA 4B5XA 3USBA 2P53A 3LHWA 3KOFA 4U4MA 3GLCA 3S1VA 1PBGA 2R9RA 1DKWA 1X96A 4XVEA 3EPMA 1F5ZA 4QR6A 3G18A 3M0KA 4IG2B 3N29A 3M5YA 3TYAA 3PTMA 2V68A 3T2OA 2F38A 4GUFA 3OB8A 4OV9A 3V5FA 1IEVA 2YDAA 3VNMA 2C0AA 3N1AA 2W92A 4JNMA 4QLKA 4X22A 3RDKA 1N8FA 4CQ8A 4FNPA 4XAPA 3P60A 4BWLA 1VAHA 1YPXA 3KP1A 1EUNA 2DUZA 4C60A 4U3CA 3ARZA 2WPBA 2SFPA 4GPNA 1TJ2A 2VNCA 4LT9A 1GOMA 3MCOA 4H7VA 1F74A 2Y5EA 4MY8A 2CCRA 2YLAA 1XM3A 4I3GA 3DG7A 4OIFA 4IP4A 1ZP3A 3UEQA 1ZQ5A 1J01A 1W1VA 3NOEA 3PZ9A 4DM2A 1TQJA 3GHUA 2QNEA 3IJLA 2WNNA 2WZHA 2QKFA 5LXXA 4C6DA 4HZ8A 1TWWA 4D8ZA 2ZUWA 5CG7A 1I8QA 3CHEA 2B31A 1RW9A 4S3EA 3PBMA 1J5SA 4L56A 2ZICA 3RN6A 4DY1A 2FZNA 4QJ4B 3KCJA 1E3ZA 3VD7A 4IPJA 5HBFA 3FS2A 4DNMA 1HM2A 3VOHA 1QU4A 5C7HA 3CXOA 4E8DA 2NW0A 4P61A 2INZA 1QI2A 3HU7A 1MQPA 1XS2A 4OGZA 4W88A 5FF2A 3EA3A 4AHOA 2VENA 4AZBA 5BROA 2GL5A 4ERIA 5U4NA 1CDGA 1FWJC 3W28A 1BYDA 2PUZA 4C6QA 1ISWA 4IJBA 1MDLA 4K1GA 3K4WA 4HZMA 1EJVC 5GQBA 2O7SA 3PWGA 3W01A 3RLHA 3AO0A 2ISWA 2I5IA 1KM2A 4Z17A 2Q09A 5F2GA 1RWFA 4E3TA 3VFLA 2CXGA 3WLJA 3V4BA 4PA8A 4E4UA 2FLIA 6REQA 1A5AA 4GXPA 2QCLA 3CAQA 4HU8A 3K8KA 2CLMA 1XC6A 1JCTA 5FSDC 4AWEA 4Q8WA 3ZT5A 4GC4A 1W0MA 4HNTA 4R5EA 3FLUA 2ISVA 4O54A 1ISZA 1O68A 2VGBA 4LW7A 2LLEA 2RDWA 2CKSA 3WQDA 3VIPA 1KM6A 3MP4A 4H2CA 2FZBA 1TJRA 3LTYA 5I3DA 1XXXA 1XRFA 3UD6A 4Y9AA 3IK4A 5HQMA 1HN1A 3RUBL 1V8EA 4GVIA 1YIXA 4GQGA 3FGCA 3AXMA 1G1YA 2YFNA 3B9EA 3ONCA 3WEMA 2J7CA 3FA4A 1XBXA 2BODX 1VKFA 3U7VA 3MY9A 2V8ZA 4M1BA 4LPCA 2AMGA 1REQA 9CGTA 3U48A 3FN9A 3QV8A 4JQ3A 4ZQOA 2FB2A 1XCXA 1X7IA 2HK0A 2J77A 3SCPA 3I4EA 1XSKA 3O1NA 5CAHA 2HJPA 1KFKA 5JIWA 4CN4A 4BF5A 3APYA 1BSIA 1KBBA 2JF6A 3DKJA 3UZWA 3IT4B 1WXZA 1RZMA 3K8MA 3LCWA 2HQAA 3RXZA 3UJFA 3UNDA 4L4PA 2VELA 3TFXA 1DTNA 3EX6A 1EYEA 1F2JA 3KVLA 4DYJA 1FA2A 1B2YA 3AWNA 3T05A 5DBUA 1UWUA 4H8NA 5DY3A 2F9RA 5DCBA 3UZZA 1E71M 4GC3A 4PMZA 3BW4A 3UA4A 3FJ4A 3N04A 2OX1A 2NXIA 4Q22A 2HSAA 2OWWA 1PYMA 2H3DA 1XQKA 3DHUA 2XSBA 1QUMA 3UVIA 5AYZA 4L1XA 4LRTA 4WIWA 2BGNE 1H7WA 4MY1A 3AAMA 3OQ8A 4D8AA 4ZMGA 3RPMA 2Y4SA 1YXDA 1OCBA 3E2RA 1TMLA 1IT7A 3W1PA 3PVFA 3UWWA 4IGHA 4MPKA 3M4HA 3DN5A 4FF5A 3B97A 5D37A 1R3SA 2GGHA 2DSUA 5CPQA 3E0LA 3A5VA 1OM0A 2X1IA 1KGUA 3S1UA 1XGZA 1JZ2A 1DJNA 4GACA 4MDOA 4Y96A 2JGYA 1OIMA 2HBXA 4WDXA 4L80A 2NXGA 4YCPA 3WDRA 4N9BA 1A0DA 5AHNA 1VYRA 3F4DA 1PAMA 1P6BA 3ZQ9A 1ZS2A 1MYRA 3EMCA 4KS0A 1KXTA 3EB2A 4OOUA 4BHYA 4JFVA 3QR0A 1FHUA 1K8XA 4BF9A 1XCFA 3MS8A 2QUVA 1VCGA 1JUKA 1QT1A 3O63A 2JBMA 1FDZA 3ES7A 4R53A 1V77A 2WSKA 3RNDA 3YPIA 2WMKA 3J7HA 4AQLA 3S1WA 3WQPA 5HATA 2PGRA 3C2FA 3C52A 4MVAA 4AD3A 1XYFA 3RMJA 1A0CA 3NXLA 1EX5A 2PZ0A 1WCGA 4K39A 5ABFA 5AC5A 1XFBA 1ITQA 3MI6A 1H7PA 2XH4A 4OKDA 3WNPA 1KR0A 4KH2A 4LC6A 4AIOA 4IPIA 4L6DA 3L4VA 4FALA 4WUIA 3SCWA 2KX9A 5KZ6A 2UWFA 2VWTA 4IQLA 2WC7A 3AOFA 2GK1A 1AZ1A 3K1DA 4RZ4A 2BY3A 5C70A 3WLMA 4NT0A 1O5QA 3UPMA 5EFFA 5IFPA 5G2HA 1W3YA 5IXEA 3PHAA 4QNEA 2FHCA 3G8EA 5FOOA 4E2BA 1UG6A 1F4AA 2TRSA 1MQRA 3B0YA 1OSEA 2HZGA 3DU0A 3G0SA 3WBYA 3KX6A 1IF2A 4PFMA 3ITLA 2OLSA 3WLIA 1Y5XA 4QIUA 2VFEA 1HM3A 4C7FA 1IEWA 1Y5WA 4ZZ9A 4F0MA 3NL5A 4MJZA 2DZUA 1UQYA 3N2CA 4A3YA 3BLPX 3LI0A 4WKAA 2OQYA 5HWJA 2I57A 3WF1A 3SFKA 3WIJA 4KRZA 3WLNA 1W1ZA 1JFXA 3HGRA 2PPGA 1YE6A 1DWGM 1GPWA 1UIPA 3G1VA 1XDJA 3CWNA 3LV6A 1V02E 3S46A 2Y7DA 3L5AA 3GM8A 5AHLA 3DIPA 3GXFA 4KKXA 1R46A 1Z3NA 3LUTA 4XV0A 3FDKA 3WQEA 1Q8AA 3NYDA 1Z8AA 2IQ0A 3IV8A 4H1ZA 1JCJA 4NAFB 2RGMA 2POZA 3PZGA 1MEIA 4DNHA 2F2KA 1GJUA 3N25A 4LAKA 1J0HA 4QJ1A 1JCMP 4KEMA 3GY1A 3H4GA 4H6KA 3L12A 1M41A 1V02A 1ONRA 1PS9A 3LHYA 1FWRA 4CCCA 5I03A 3H2NA 4P7OA 4A4AA 2FQIA 4UFIA 5AZ1A 1RWCA 3KBVA 3FSUA 3CV6A 1KFWA 5D4YA 4H8VA 3UZJA 2CBIA 3HV8A 4OQVA 2OCZA 2O55A 1TSIA 3S1XA 1ESWA 1EFZA 4BQ4A 1V3LA 1H41A 4J7RA 3WH9A 3S9YA 5HULA 1X1JA 4WY0F 5D05A 2GGEA 4ACZB 3W2NA 1KLYA 1EP2A 2XH2A 4S3JA 2O9TA 3TSBA 3UJRA 3OG2A 4XBSA 4B5WA 4B3KA 3W73A 2VUYA 4G7EB 4F0HA 1JZ5A 2ANUA 5C9ZA 4O17A 2GVJA 4YU1A 2I14A 2V67A 4JD4A 1UW9A 3PZUA 4PFHA 1GJPA 1NF0A 5I5RA 5D9PA 1F7BA 2GSHA 3GHTA 2XM2A 5DBTA 3AS1A 4NASA 3QVQA 5XIMA 2QCGA 3PB2A 3N3MA 3L0NA 2Y0FA 2NUXA 4NRSA 3VGBA 1JNDA 1V0KA 3TK7A 1DJYA 1WXJA 3W2KA 2DT2A 1O1HA 4RW3A 1IZKA 3RCYA 2QV4A 2YZRA 4HPJA 1V0MA 5FL1A 1F73A 1H5VA 3VOJA 1NJJA <