2WMIB

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 in complex with the a-trisaccharide blood group antigen.
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
582
structure length
571
Chain Sequence
b'VDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTENYWIWANDIENKAADYLKVSAKNGGYFIWAEQNNGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKSKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
molecule tags Hydrolase
source organism Streptococcus pneumoniae
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
total genus 212
structure length 571
sequence length 582
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmiB03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmiB01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmiB02
1LXMA 3S2CA 5ABFA 4AISA 5E0CA 1JAKA 2XJ7A 2DT2A 4CUCA 2FH8A 1CGVA 5CLTA 4UR9A 1XYFA 4FLRA 4P7QA 2J7DA 3RILA 3ZMRA 2HVMA 3CUGA 3VOCA 1W9VA 3WQ8A 4M1RA 1JIBA 2GUYA 2XFRA 4M82A 3AQUA 1EH9A 4U31A 4AD4A 1B3XA 1WZLA 2D0FA 1B1YA 2G41A 1V3JA 1EQCA 1V3HA 1DWIM 1XH0A 3T2QA 1X1NA 4HA4A 4NSBA 1R86A 3K8LA 4D6CA 4LYPA 1X1HA 1JXJA 3VD7A 3PZUA 1JFHA 3AIBA 1H0IA 2JALA 2WHLA 1JDCA 5CJ5A 3GBDA 4ML4A 3W38A 3SCVA 2BHZA 1BLIA 1H09A 2WYSA 5CPSA 1VBUA 3QHNA 1V03A 4U2ZA 1VIWA 5I77A 2RGLA 4MB3A 2O9OA 1E6XM 5LA2A 2E22A 2CBJA 4JKMA 5FL0A 2Y5EA 3PN8A 1EDQA 2WB5A 2Y8VA 1WDSA 1FP8A 3AMDA 2W5FA 5DMYA 1E3ZA 4L4OA 2DT0A 2BY0A 1UR1A 2WMGA 1GOOA 1C3FA 3B8SA 3N18A 1EXPA 2J7EA 1W1YA 5BWFA 4CVWA 3II1A 1TUXA 7CGTA 5A2AA 4GPNA 4B15A 5C8BB 2J78A 2VZVA 3NSXA 5CGTA 1JDDA 2Z1SA 1KXTA 3SUUA 3OGSA 4UFHA 1ODUA 3FXYA 3N12A 4H04A 2WDAA 1V3IA 3LPGA 2WAGA 2J4GA 2ZXAA 1U33A 3VUPA 1J0YA 1OD8A 3WD4A 5A8OA 2J79A 3AS1A 5M17A 1Q6FA 5A1AA 1VJSA 2GJRA 3BGAA 1JZ4A 1Q4NX 4HOZA 1OM0A 1BFNA 3GNOA 5HPCA 1K9EA 2NSXA 3CHCA 4W5UA 2ZUSA 4QCFA 1L8NA 5CZKA 1GOIA 4FK9A 1VRXA 2VZSA 3AIEA 2EJ1A 2YL8A 5I78A 3L4ZA 3N9KA 3CUIA 4UFJA 3UESA 2J7CA 4UZUA 3T0BA 2CETA 4H2CA 1C7TA 4M24A 2OYKA 5EFDA 1BQCA 1H11A 5DT7A 4E4PA 2JFEX 1WAWA 1XYZA 3TA9A 1MYRA 1GW1A 4BZYA 3A6OA 1CXHA 2PWDA 3CIVA 2VC9A 4HP5A 4DM1A 1JZ2A 2JIWA 1TVPA 4TOQA 2ZXQA 4JFTA 1ZJBA 1EOKA 2V3GA 4QCEA 3WKZA 3A4AA 3BCDA 3MUY1 3DECA 1ITCA 3OZOA 2VQUA 1W9DM 1UD6A 1BYDA 4WSKA 5KEZA 3T0DA 1PIGA 1QHOA 3QR3A 4JFWA 2OSWA 2PF0A 4WKHA 1E6NA 2ZXBA 3AMLA 3WEZA 2BY1A 1E5NA 1UWRA 3N17A 1HJVA 2XVPA 1ZBVA 4J3VA 5CLWA 3BC9A 1QI2A 3POHA 3VO0A 2YBUA 2ZXDA 3OB8A 2XVKA 1D3CA 4X0VA 3FHAA 2ZUWA 3CMGA 1N7QA 1RD6A 2PC8A 3WNLA 3HU7A 3OLIA 3ZJ7A 5EB8A 1Y7VA 2G3NA 2IXVA 2VO5A 4W89A 1A47A 3W81A 3CMJA 1GNXA 4WSJA 4RE4A 4DM2A 5A95A 1NOUA 2MANA 4QLLA 4OBSA 1BVZA 1W9XA 3TTYA 3VIHA 1WKYA 3WMBA 3CPUA 1J10A 3I3BA 1PX3A 1UR8A 3ARRA 3ZSTA 2Q1FA 4HU0A 1PX8A 3QGVA 1J11A 2VQTA 1HKIA 3ARXA 4AD0A 1QW8A 1GVYA 3FAWA 4PCTA 2EPMX 2BFGA 2VZUA 1JI2A 2D3LA 2ZX6A 2JF6A 5M3WA 4U33A 5BXPA 2WPGA 1LQ0A 4P8XA 1TFVA 4P7RA 4NF7A 5ECUA 1R8LA 3OGVA 1V02E 3VD5A 4PN2A 3ZJ8A 1IZJA 1OGSA 3PZNA 5BYWA 1X6LA 4MDPA 2CERA 1RWCA 3VD3A 5BRPA 4B9ZA 2VRQA 4PMRA 2X05A 1FA2A 1W1PA 3M46A 2X03A 3WUGA 1JNEA 3FN9A 1QNSA 5AYBA 1C8XA 1JF5A 2X1IA 4UOZA 1BG4A 3ZO9A 2WHMA 1XD0A 4W7UA 2XVLA 2EXOA 2FHBA 1SYTA 1FH7A 3OG2A 1F4HA 2EPNA 4J3TA 3WF1A 1D7FA 1TCMA 2PWGA 2GJPA 5CG0A 3EYPA 3MMUA 1RWAA 3PZMA 3E1F1 3THCA 2DSVA 3WMCA 1IT0A 1DWFM 1UD2A 5E0FA 1HT6A 3U7VA 4J3WA 4OBRA 2UY2A 4AIUA 4HPHA 4UTFA 3PTQA 1CTNA 2F61A 1QHZA 2XM1A 4WKFA 1FOBA 3GTNA 2W63A 4AZ6A 3WDIA 4MJ4A 3WFZA 3RIKA 1XSIA 4MTVA 1UA3A 2D0GA 2GJXB 4PTXA 1C92A 3UR8A 3AOFA 1UR4A 1V3LA 3AYSA 1BVNP 3TTOA 2DIEA 2JE8A 5EFFA 2PBGA 1O6IA 1DWGM 5D4YA 3MUZ1 4D6DA 1XCXA 2W67A 2O92A 1K9DA 1GJWA 2NW0A 3DHUA 2EPLX 5GPRA 3WENA 4GZEA 5AYIA 5A6BD 1LL6A 4MNMA 3LPFA 1W3YA 4NI3A 5LA1A 1UKOA 3PZQA 5FOOA 4MPKA 4AEFA 3O6AA 3EMQA 1SFSA 2WMKA 4H8VA 3BAWA 5BROA 1UR9A 1M03A 5AC5A 1JD7A 1OT2A 2ZOXA 2VX4A 1CIUA 3WN6A 3A47A 3VMPA 1UH3A 1H0GA 3FAXA 4Z2GA 1KFWA 4N42A 4PTWA 2TAAA 5DO8A 1ZBWA 2D3NA 2X0HA 1EO7A 5A2BA 2WHKA 5HDRA 1DP0A 3A4XA 2Y4SA 3CZ8A 3NYDA 1W9BM 1XH2A 4P7NA 1RP8A 2C7FA 3VGDA 2FH6A 1QPKA 1OBAA 1W9UA 2WMIB 1LLOA 5M5DA 1LOHA 4NRSA 1V6XA 4YN5A 2DSKA 3WQ4A 3K8KA 1N7OA 1HMUA 1BSIA 4HMDA 3ZR6A 3WDQA 3OIHA 2A3CA 3BLPX 4AZGA 1PX4A 1PZ2A 2XM2A 1R7AA 1TG7A 3CHDA 4H41A 3RMEA 3T0AA 1MVYA 1UQZA 3VM5A 3FNDA 3F5LA 1N82A 7A3HA 4U2YA 1E5JA 3T08A 3WH9A 3NDYA 1MW3A 1DWHM 2DQXA 5A8MA 1CNVA 1UKSA 2VNCA 4PSPA 1ZJAA 1UD5A 3O9NA 3AZSA 2CPUA 4GQQA 1UHVA 2VJXA 4AXNA 2Y24A 1XD1A 2BVTA 3ECQA 4HZ6A 1HM3A 4AY1A 4XZWA 4WKAA 1G0CA 1RW9A 3F4VA 1UD8A 3WUEA 1KGUA 2XHYA 4AZ7A 4Z2LA 2G4FA 4B3LA 3MKKA 4W86A 1JXKA 3WQ5A 3BAKA 4XX6A 1GVIA 2YBTA 1H41A 2EBNA 4D6HA 5GNYA 4V28A 1E4IA 4WLCA 1GCYA 4E8CA 1OSEA 2OWWA 3LPPA 3UETA 3D5HA 1C90A 1FP9A 5C71A 3SUVA 1E6QM 3B9EA 3BXWA 2CBIA 2NT0A 2FDMA 4OKDA 1U2YA 5I24A 3W4RA 3MV01 1VBRA 3WD1A 2CITA 1KXHA 4J3SA 1Q6GA 4KRTA 2J7GA 5IHSA 1ZB5A 2VCBA 1OB0A 1GOMA 1H4PA 1W3JA 2WCAA 1KQZA 5D9PA 4AD3A 4OJYA 2ZX7A 1ODZA 1UA7A 2WVVB 3EDEA 4UFKA 3CUFA 4W8LA 1GPFA 1E3XA 1WB0A 4BF7A 3AYRA 5A6BA 4BQ5A 4S3JA 4AC1X 2VL4A 3TP4A 1PJ9A 1G94A 2G3MA 2VTFA 4Q7NA 4QAWA 5A6JA 2CHNA 3OLGA 5BXSA 3WH8A 4QP0A 4W85A 4CN4A 1JYNA 1HJSA 1KGWA 4AIEA 3VDAA 3AMGA 3POCA 1JFXA 1WO2A 3QHMA 4PUDA 8A3HA 2GVYA 3CUHA 1BYCA 4V2XA 1JZ3A 1W3KA 1E0WA 2W62A 3HN3A 2XUCA 1UZ4A 1PPIA 1UKTA 3A3HA 1HJQA 1V3MA 2QMKA 4HMEA 3KEHA 3RO8A 3WNPA 3CLWA 3VD9A 2BRPA 5HBFA 1UD4A 2DT3A 1LG2A 5CPTA 1VEOA 3BH4A 8CGTA 5I0DA 3AI0A 2PWEA 4HZ8A 1JZ6A 2J7HA 1WZAA 3TTSA 1E71M 3VTRA 3VD4A 3KL0A 4PYSA 3W6MA 3IJ9A 1CXLA 5IFTA 1WDQA 1GOWA 1J0NA 3NJ3A 3OA5A 3ZJKA 2EO7A 3EMCA 5KZ6A 4A3YA 1E9LA 3AIRA 3CHEA 4JFUA 2E9MA 3AMKA 2BHYA 3MSDA 4W8BA 5A3HA 2V5DA 3GYCA 3ARVA 4ATDA 3SUSA 1GHSA 3AS0A 4BQ3A 1UQYA 3CUJA 2YL6A 2WK2A 4W88A 5CSYA 5BXTA 2DSZA 2RGMA 2ZWZA 4B16A 3BMWA 3VIGA 4DUWA 4ZENA 3MMDA 3NSMA 3FHQA 1Z32X 4GO8A 4UFLA 3ALFA 5JUVA 1PEZA 2C0HA 3I3EA 4IPLA 3WQWA 4GO9A 1V08A 4KGJA 1E6SM 4IPNB 4PSRA 2J77A 4WF7A 1JYVA 2W61A 1XC6A 4YHEA 1LWJA 4CCDA 4F66A 2J25A 2ZE0A 5TD4A 2WVTA 1E55A 1BHGA 2WVUA 3VGHA 1GQIA 4MJ2A 1US3A 2F2HA 3WNMA 3WFLA 1A3HA 1JI1A 1H49A 7TAAA 1KWGA 1GOKA 1WCGA 3WH7A 3RPMA 2DH3A 1XCWA 1H3GA 4JHZA 1E40A 1FFRA 1ECEA 3PZTA 1B3VA 4OUEA 1UOKA 2VOTA 4PMDA 1R87A 1NP2A 2YOCA 1MQPA 5AY7A 3AHVA 1LF1A 4HMCA 1JZ8A 4IM4A 3RDKA 1MW2A 4R5EA 1GJUA 3W27A 1HX0A 1G01A 1FHDA 1QW9A 3VNZA 4U5KA 2DH2A 1OGBA 5A6MA 2J74A 1NM9A 4HOXA 5F7UA 3PZOA 4PTMA 4D1IA 1BYAA 3VIOA 4AYSA 1CGXA 3VU2A 4TX8A 1KQYA 4AZIA 1QI0A 1K9TA 4D1JA 1RWFA 1NWSA 1ZS2A 2VZOA 4GINA 4AZCB 1HF6A 1IV8A 5LYRA 1V02A 3U5UA 2OSYA 3BSHA 2E0PA 1B3WA 3IJ8A 4C7GA 4X9YA 3GH7A 5A94A 4UFIA 2OWXA 1O7AA 4TX6A 5CQ1A 1EDTA 3THDA 4URIA 2A3AA 5M03A 1W91A 1W32A 3GXIA 2VVSA 2WLYA 2XVNA 3WH6A 2J7BA 1XH1A 5CXPA 1J0ZA 3M7SA 4JKLA 4GQRA 1CB8A 3KZSA 4FLSA 1J9YA 1VF8A 3ZSSA 1GQJA 1VAHA 4JCMA 5GNXA 4CU8A 4MNLA 3J7HA 2D22A 5E6YA 3D3AA 2YA1A 4HU8A 3L4VA 2EQDA 2D24A 2WCSA 2VUYA 2WANA 4UQBA 2GSJA 4DWSC 1ESWA 1MQQA 3GH5A 4CD8A 1E0XA 1Q6EA 2YLLA 2J7FA 2WHJA 2J75A 4N0RA 4CN1A 3CH9A 1SMAA 2W66A 3CZLA 1CPUA 1RWHA 4MNKA 2OYMA 2E4TA 3LPOA 4EE9A 2V3DA 1HVXA 4HPGA 4P7OA 2V3FA 1E0VA 3APGA 1H2JA 5HOSA 2EPKX 3WMSA 3OBAA 5ABGA 1AQMA 1QNQA 3HMCA 4AD1A 2QPUA 4JFSA 1J0HA 2ZWYA 3AIUA 4H8UA 4AD5A 4W84A 2GJXA 1CEOA 3ARTA 4AIOA 3BAJA 2WLZA 2Y2WA 1FH8A 4GI6A 4XB3A 2WVVA 3ZQ9A 1CLVA 4AZ5A 3SCPA 1C82A 4JIEA 1BTCA 1WNOA 4IUGA 2WC4A 3VIPA 2WMIA 3BAYA 3WNOA 2CBUA 5ABFB 4MB1A 2WBKA 3FY1A 2XTKA 2WZHA 3EDKA 4V27A 1HVQA 3N15A 1GONA 4TVUA 2PWHA 4XZBA 3SIMA 1J0JA 1M53A 5IDIA 3U7BA 4MDOA 3MUIA 4J28A 4PRWA 2W92A 3GM8A 3S6TA 2WM0A 2D0HA 1CWYA 3RM9A 4AMCA 3EBVA 3AHZA 3N1AA 3WELA 4WIWA 3WNKA 1R85A 4QLKA 5EMYA 1CENA 4P8UA 4UQDA 3ARYA 4EK7A 3L4YA 1UZ1A 2YA0A 1GOQA 1R7OA 3CZEA 2VMFA 4NZCA 6A3HA 4TTUA 1E6RA 2WNWA 1ISVA 4GIAA 3AXXA 4DWSA 1J0MA 2WWCA 4FLQA 1OIMA 4BS0A 2J8GA 2X0YA 1B31A 3WF3A 3MANA 1W1TA 4D6JA 1KR0A 4PMVA 1N7RA 1UR0A 1BF2A 3MUAA 1RP9A 4J27A 2BY3A 1K6AA 1LJYA 1YHTA 5E70A 4D72A 2X2YA 3F5JA 4CD5A 1E4MM 3DC0A 4RE2A 2WMJA 2WSKA 5FIPA 4B3KA 2PI6A 1J01A 2CCRA 1PBGA 2IUZA 2QPSA 4YPJA 2BRWA 4KRUA 3RM4A 1Q6CA 3WL0A 4JKKA 1GZJA 1B3ZA 3DYPA 1UD3A 2IXUA 4ZXLA 1CBGA 3EDJA 3AHYA 4UOJA 4JZ5A 5A69A 4H7VA 1MFVA 3WD2A 2WKGA 3AICA 2JEQA 1MXDA 4AD2A 3JUGA 4JHOA 1KXQA 3WBAA 1QI3A 4D6FA 4EANA 4OIFA 1KCLA 2ZICA 2F8QA 1NWTA 3NCOA 3WD0A 1HKJA 3GNRA 1MFUA 3VIFA 2QMJA 4B9YA 5JIPA 1J0KA 1UKQA 3VNYA 3WD3A 2YKKA 2QV4A 5A8PA 3AFBA 2VVNA 3B9AA 3WF2A 4MADA 1MW0A 4FF5A 4UOQA 2CXGA 3BMVA 5A6SA 2ZIDA 4AW7A 5JBEA 4ACZB 4LGXA 1B90A 1QOXA 4CKQA 1HJUA 2C8NA 4GI8A 1Q6DA 3OGRA 3CZGA 2VZTA 2W91A 4ZXOA 2VR5A 2VCAA 4UFMA 4F79A 1JD9A 3A4WA 3TTQA 1CGTA 3ZIZA 3SCUA 2WXDM 4GZJA 1XRVA 2PBOA 4PMYA 1N7NA 4D6IA 1PIFA 1BG9A 5CPQA 3CBWA 1NH6A 3BLKA 3ZJ6A 4CD4A 1X1IA 3T2OA 1TE1A 1W2PA 4LXFA 1HP4A 4D6EA 4W8AA 4PMZA 1BAGA 5ABEA 3ARWA 5IFPA 4PCSA 2OSXA 2CNCA 2BVYA 4QDMA 2XGBA 1KBKA 1E15A 1E73M 3MSGA 3T09A 2A3EA 5D9OA 1C7SA 4UZSA 2DEPA 2HISA 1EDGA 3RM8A 1XSJA 1BPLB 2CYGA 2XIBA 2D23A 1UKPA 2BHUA 2E8YA 1QNPA 3VGEA 4CU6A 4RL3A 3TONA 2QHAA 3WF0A 3L4UA 4OOZA 1LWHA 1V6WA 4RE3A 4EAMA 3IAPA 2CBVA 3G6LA 1VFMA 2NT1A 4TXEA 1IZKA 1LL4A 2YDQA 2YA2A 4M29A 4TVCA 4GKLA 1JYWA 2Y8KA 4A3HA 2GDVA 2QLYA 1B3YA 1RPKA 3AZRA 3VMOA 1ISWA 2PB1A 1QI4A 3UG5A 1EHAA 1V0MA 2WC7A 1HJXA 4R27A 2BNJA 3BCFA 4ACZA 5DEZA 4PMNA 4JFVA 1B9ZA 1HXJA 2YDSA 4PEEA 4UQ9A 1JNDA 4CCCA 1TMQA 2YL9A 2G8ZA 4GI9A 3W24A 3AXHA 3WEMA 3L4XA 2J8FA 1FFQA 1KWKA 3VDBA 1HKKA 3PTMA 3GXMA 3VINA 4X0NA 4LX4A 1V6YA 3VILA 5HXMA 1HIZA 2VI0A 1E72M 2VRKA 3PZ9A 1V6UA 1NWRA 1CYGA 1E56A 4U3CA 2XG9A 2ZUMA 1MWOA 3VIMA 1KBBA 2VX5A 3AZTA 4PTVA 1GQKA 3SUTA 2VRJA 5EBAA 4J7RA 5HNNA 4CU7A 1PZ3A 1EGUA 3AIQA 3MMWA 1CXEA 1JG9A 1E70M 1OGGA 5I5RA 2YIHA 2VURA 1HL9A 3WH5A 2W4XA 4P8VA 4M81A 2WBGA 1M7XA 3VGBA 4A4AA 1KB3A 5FD0A 4TUFA 3WUFA 2WSPA 5A8QA 5E9AA 2GDUA 1EQPA 2XWEA 2DDXA 1U30A 1EA9C 1CLXA 1WP6A 4S3KA 2V5CA 3IJ7A 1OJMA 4U3AA 3UG4A 2UWFA 1UWSA 1QNRA 2CKSA 2UY4A 1TR1A 3PTKA 4DUVA 1OIFA 5BCAA 2FHCA 3MO4A 3NUKA 4BQ2A 1J0IA 4DWSB 3HJEA 1BGAA 2XSBA 1HN1A 3SCSA 6TAAA 3ARUA 5DFAA 1CXIA 2BRVX 1J12A 1GHRA 5D9MA 1EHNA 1UYQA 1V3KA 4XUYA 1JF6A 2CIPA 1C93A 3CHFA 1F9GA 5I6SA 1WPCA 3W6LA 5GQBA 1M01A 2AMGA 3UERA 3O2LA 1AQ0A 5A6KA 1DWJM 2E40A 1WZKA 2XFYA 3AISA 3OLDA 4KH2A 3SCNA 1B2YA 1WDRA 3CO4A 2FHFA 4UCFA 2CESA 1E1FA 2AOSA 1OJOA 4W7WA 3VMNA 4LPCA 1FHLA 3AJ7A 1ZL1A 3AXIA 1W1VA 2XSAA 3BSGA 2B31A 1US2A 5A6AA 2BS9A 4K68A 1ZBKA 1RWGA 2G3IA 1OT1A 2JIEA 3MU7A 1GQLA 2V3EA 4HOWA 3PZGA 2VCCA 3QOMA 1G9HA 3PBGA 1JGIA 3UCQA 1AQHA 1ISXA 5DF0A 5ABHA 1H1NA 1XHGA 2ZUTA 5I23A 3WNNA 3WBEA 4F9JA 2J62A 1UH4A 3VIKA 2ZX8A 4DWSD 2E24A 1F1SA 2BY2A 4C7DA 1VFFA 3GH4A 3QHOA 1OWQA 4AZCA 1VENA 4MNJA 2XPKA 1UWQA 1VEMA 5CSUA 1CZ1A 1UUQA 4KMQA 4MB5A 2ZX9A 3GDBA 1E4LA 1HJWA 1CGWA 4BQ4A 4F9DA 3B9DA 3W0KA 3VDHA 5E09A 3G6MA 1W2VA 3T2PA 1WDPA 2DSUA 1WZMA 2WZEA 2CHOA 4TTGA 1HL8A 1HNYA 1PAMA 2WMHA 2DT1A 4Q22A 2E9LA 1G5AA 4LQ1A 1E4NA 2ZUUA 2WVSA 3WEOA 5I79A 1F4AA 2EEXA 3ZR5A 4ATLA 1VJZA 2XIIA 1UH2A 1CXKA 3IK2A 2WC3A 3EDDA 1HKMA 3KE0A 3K1DA 1DEDA 3BAXA 4CGTA 1FH9A 3L2LA 3L4TA 3SUWA 2G3JA 1NOWA 4AWEA 5A6LA 1DHKA 2VT0A 3K4DA 1SR0A 4ATWA 1I1XA 2VR4A 1DWAM 3MV11 3WY1A 3CTTA 4QLJA 4JL1A 3WDHA 4PMUA 1E6ZA 3K4AA 4AZBA 4AZHA 2A3BA 2O9PA 1EIBA 3DYMA 4D6GA 2OLHA 3I3DA 5DT5A 5D8WA 4JCLA 1UWUA 5CGMA 5A8NA 3WDJA 4ACYA 1UR2A 1MW1A 3M6DA 2XFFA 3CZJA 2V38A 4MB4A 2AAAA 3RJYA 5BRQA 1I75A 4Z2HA 1ITXA 4PMQA 1KXVA 3CGTA 3ZM8A 1P6WA 1C91A 4BCEA 3U5YA 3VX1A 3NDZA 4WK9A 1JDAA 3GNPA 2DSWA 3ZT7A 1VB9A 5D8ZA 3RJXA 2GK1A 1QHPA 3OLEA 1MXGA 3EDFA 3GXFA 1K9FA 4CCEA 1I1WA 5LA0A 3PZVA 4CD7A 2ZUVA 3EMZA 2X09A 1M04A 2XYLA 2CKRA 3OZPA 1XV8A 3VGGA 2E3ZA 1V0LA 2EPOA 3IANA 1LG1A 4Z2KA 1RH9A 1L0PA 1QVBA 4JL2A 2D2OA 3M07A 4MAVA 5D9NA 2JF7A 4KGLA 4ZE5A 3SCQA 4PMXA 3WDPP 3W25A 4LYQA 1XSKA 3GXDA 1OCQA 4J3XA 1JL8A 3AS3A 1CGUA 3SURA 3UR7A 4Z2JA 1I8QA 2YL5A 5JIWA 3AIWA 5JBFA 3N04A 4HTYA 4ZFMA 3UEQA 3AHTA 4FMVA 1V0KA 2BXZA 4M8UA 3NIYA 5A2CA 1YQ2A 2WWDA 3VVGA 1SMDA 2XVGA 3SCRA 3WSUA 3AMCA 1TVNA 2YLAA 2XWDA 3ARPA 2XGIA 2DPEA 4F8XA 2BVDA 1LXKA 2O9TA 4PBGA 3WL1A 1C8YA 1ISZA 4J3UA 3W26A 1D2KA 1TA3B 1OINA 1UWIA 5FCZA 3W37A 4E2OA 5HPOA 4NRRA 2FGLA 2E9BA 3ALGA 3BAIA 5E6ZA 1KR1A 2VX7A 3CZKA 4HZ7A 2WCGA 1KGXA 3WIJA 1W3HA 3KL3A 1V0NA 2QF8A 2WW5A 3NSNA 5BXRA 4UQEA 3WUBA 2OWCA 3RCNA 3ARZA 1NWUA 4P7LA 2BXYA 4HA3A 3AS2A 1X1JA 2WKLA 1G1YA 3WQVA 5JBDA 9CGTA 3GBEA 3WQ6A 5C70A 3AIVA 2YJQA 3L4WA 4M56A 3K46A 2VX6A 4W87A 3VKKA 2ZUNA 1JZ5A 2Q8XA 1TA3A 1S46A 2Z1KA 3MS8A 2X8RA 1CDGA 4CN6A 4UQAA 1CGYA 1VEPA 3AROA 5IXEA 2OYLA 3ARSA 4Z2IA 3VM7A 3VX0A 4E8DA 2A3HA 1V6VA 3GZAA 4JAWA 3ZOAA 3VPLA 3VGFA 1NARA 3IAQA 4PUEA 4W5ZA 1VFUA 2WCOA 4EKJA 6CGTA 5I3DA 1E1EA 1OJNA 2BV9A 4BA0A 2GFTA 2WZIA 3W28A 4ZE4A 1BYBA 5IHRA 3SEPA 3N11A 4LYRA 1AMYA 3KWXA 5FKYA 3FW6A 2GK1B 4IISA 4GXPA 2DIJA 5I2UA 1E6PA 3QOKA 3UG3A 2J47A 2D1ZA 4ZEPA 5FL1A 3ZT5A 2UY3A 2D20A 3SCWA 1B30A 1HP5A 3ZT6A 1EO5A 4QFUA 1QI5A 1UG6A 4H8HA 3N13A 2WMFA 4CD6A 3WDRA 3AHXA 3TOPA 1EGZA 2DGAA 4Y7EA 3DHPA 1JAEA 1HN0A 1WE5A 3PHAA 5GNZA 1MQRA 1KCKA 3WF4A 4DUXA 4W7VA 1HM2A 4FLOA 1W9PA 4TVDA 1JZ7A 3KL5A 1CECA 2PWFA 3ARQA 1LL7A 1W3LA 4HA1A 1NP0A 1B0IA 3PZIA 4GZIA 1UWTA 1N7PA 2YDRA 2ESCA 1GORA 4L4PA 4U5IA 1QBBA 4KWUA 4WJXA 4D71A 1H5VA 3SCTA 4UNIA 4P8WA 3SCOA 3W29A 1J18A 4UQCA 2ZX5A 1E43A 3F5KA 1QBAA 1NOFA 3L2MA 3W53A 3VDCA 2FGZA 2CEQA 1AVAA 2UY5A 1QNOA 4W93A 2E8ZA 1DTUA 1EOMA 5AC4A 1JYXA 1ISYA 4AEEA 2JEPA 1OD0A 4C7FA 1CXFA 3VIIA 4YHGA 3U57A 1NQ6A 1X6NA 4OZOA 1OJPA 1HMWA 4XV0A 3LMYA 1GUVA 1ZBCA 2O9RA 4PMOA 1VFOA 3VIJA 3W82A 1TZ7A 4OOUA 4CVUA 1ZU8A 3K8MA 1C8QA 4M80A 3DYOA 4MAZA 1BGGA 1XGZA
chains in the Genus database with same CATH superfamily
4MY1A 1KO0A 4CUCA 2FH8A 2REQB 3TOYA 2BVWA 1G4SA 2HVMA 5HMFA 1W3NA 4EACA 3KP1A 2J13A 1ZAIA 3LK6A 3WQ8A 3LI1A 2QCGA 2GUYA 5CBIA 2C15A 3W2UA 3MTWA 1OX5A 1EH9A 4U31A 2ZRUA 3CQ0A 5C2XA 3GLCA 1WZLA 5LIWX 1B1YA 3P93A 4LC8A 3I68A 1XH0A 4FIQA 2QJMA 1X1HA 3MT1A 3PZUA 3UVAA 1J93A 4LAKA 2OLSA 4ZB5A 1JDCA 1TUFA 2VFHA 1QWGA 3GBDA 4ML4A 3M43A 4JYFA 2ZRXA 3P80A 4QSHA 2BHZA 1H09A 3WLTA 4L1GA 2OU4A 1QNVA 3FX4A 4GUIA 1V03A 1XBXA 3QH2A 2I9UA 2PWVA 2QVHA 4DLQA 4JKMA 5FL0A 3LQLA 3TEVA 2R94A 1XGEA 3AMDA 1JCYA 4JY9A 4KF1A 2DT0A 2OZ3A 1KFBA 3TMQA 4OQVA 5HA7A 1X1ZA 2WMGA 2O0TA 1GOOA 4ZZ9A 4B5UA 3V75A 3BG9A 4GPNA 2A4AA 3NQDA 3UWVA 3QGAC 4GVIA 3OGSA 1RPXA 3FXYA 2WDAA 1JPIA 2V63A 3K4WA 1R2SA 3L7RA 1U33A 2FZMA 3ICJA 3N34A 1OD8A 2V82A 5A8OA 1NELA 3KRUA 1FHUA 5AHEA 1Q6FA 2ALDA 5A1AA 2AL2B 3BGAA 2ICSA 3LSCA 3KBSA 4JYDA 1RJQA 2A21A 4GXWA 3CHCA 2ZUSA 1GVFA 1PKNA 4NYUA 1EC8A 3C8NA 5CZ0A 3NZGA 2X1TA 1VRXA 3CB8A 3M0XA 3P8JA 4HYVA 2XGZA 1R47A 3AIEA 5I78A 4DQWA 1AW2A 3IJQA 3T0BA 5PTDA 1FWNA 3R89A 2JK2A 4H2CA 4XBJA 4EF8A 3E2VA 1ALDA 2OYKA 5DT7A 4ROPA 4D8AA 2FFCA 3STFA 3HPSA 4C1NA 3KZPA 3EZ4A 4BZYA 3M0IA 2PWDA 1ICSA 1Q8AA 4PBFA 3P81A 1JZ2A 3O7UA 2ZXQA 2D69A 2WNZA 3WKZA 4QCEA 4QITA 2GQ3A 1BYDA 5KEZA 3BGJA 1XIHA 3NQFA 3A9IA 1IIGA 2PF0A 2RJGA 2PLKA 3HBLA 1QJWA 2RJHA 3ITTA 2ZXBA 3BG3A 3H6OA 4AY8A 1H62A 1E5NA 3SIZA 1X8CA 3POHA 1W1IE 4ZVJA 5D03A 3W75A 4X0VA 3N73A 1TV5A 2PDIA 1M7PA 4XVEA 3WNLA 4AF0A 3OLIA 4IZGA 4RDVA 4PULA 2IXVA 2VO5A 3WK3A 1UZHA 1GNXA 3P61A 2OPJA 3HMJG 5A95A 2PDQA 5M2FX 3B4UA 4CNPA 1MEIA 3TJXA 3C2OA 3VIHA 4DELA 1J5SA 5LNUA 1J10A 2C18A 1PX3A 1UR8A 1RXOB 3ZLFA 2GDQA 1I4NA 4MHBA 2VQTA 3SQMA 3W7EA 4AD0A 3V36A 3FYYA 1I0DA 3FAWA 1VKFA 3USZA 4RUBA 2AAMA 1JI2A 3DG3A 1JCNA 5M3WA 5BXPA 3IACA 4NVTA 5XIMA 2GOKA 4PB4A 4MYXA 1LQ0A 1E9IA 2I16A 4P7RA 4GJIA 1R8LA 3OGVA 3ZJ8A 1OGSA 4MDPA 2Q71A 2VEGA 3VD3A 2E28A 2VRQA 2C71A 3HFTA 1FA2A 1W1PA 2X03A 1GZ1A 4ALDA 3WUGA 5AYBA 3W02A 1F2JA 3CXOA 4Z42C 1U1UA 1JF5A 2X1IA 2WHMA 1BXBA 2EXOA 3S2LA 2E6DA 2Q8ZA 5FAGA 2Y88A 1F4HA 2EPNA 3WF1A 4CCZA 1D7FA 1TCMA 3OVRA 4RZ4A 1S2WA 1H7RA 3MMUA 1RWAA 1IR2A 2NX9A 1SFJA 3VK5A 1VBHA 3PZMA 3E0IA 3ZVHB 2ZZ6A 1E1CB 1UD2A 2AQVA 1S3HA 2NV1A 4OBRA 4AIUA 3KBVA 2VDGA 1XRSA 3PTQA 3GU2A 1CTNA 5D05A 4WKFA 1WUFA 2W63A 6REQA 3WFZA 1XSIA 5AYZA 5I3JA 4FX8A 3UU0A 4L6DA 2AQWA 1UR4A 1V3LA 3QFWA 4IMEA 3F7JA 5EFFA 5DBTA 2PBGA 1O6IA 2I5QA 1DWGM 4NAFA 5F2MA 3TZFA 7REQA 3CL7A 3C2YA 4RCXA 3LNMA 1F61A 4JR5A 1GJWA 1DTNA 1R38A 4HHLA 3RG6A 1BVWA 1T0OA 4WVXA 4NI3A 1UKOA 1J96A 4Y9AA 4MWAC 1V51A 1RQEA 3VA8A 4AYGA 3V18A 4ADUA 3O6AA 2QKFA 3WJYA 4DJFC 1QPRA 3PF3A 3WN6A 3PUGA 5C7VA 3M44A 4DIAA 2HCVA 1KFWA 3F4CA 3O15A 2ZADA 3QQ1A 4Y90A 4LBSA 1EO7A 5A2BA 3UWWA 3TSMA 2Y4SA 4FXRA 2FH6A 1QPKA 4AVNA 4B5NA 2PF8A 5EYWA 1IXPA 4ZTXA 4NRSA 1V6XA 2VOMA 4Z08A 4D8OA 2D2JA 3ZR6A 1JCJA 2A3CA 1E0UA 3S47A 3IWPA 4WOQA 1T6MA 3BLPX 1S5NA 3DFNA 3CJPA 1R7AA 1FXQA 1TG7A 3N3TA 3T0AA 4H41A 4G1KA 2OG9A 1MVYA 1UQZA 2JBMA 1N82A 5K2ZA 7A3HA 1E5JA 1Y0EA 3T08A 3WH9A 2Y63A 3NDYA 3KHDA 4IHCA 2DQXA 2BOGX 1CNVA 2VNCA 1XP3A 4S1FA 2YX0A 1ZJAA 1DVJA 5EMKA 1P4CA 4L9YA 4NXSA 2RHGA 3BLOA 1I60A 3MCNA 4RV8A 4L9ZA 4HZ6A 1HM3A 4MY9A 5C9ZA 1G0CA 2FVMA 2XH4A 1REQB 2AL2A 1GYMA 1TTJA 3LCGA 4Z2LA 5CAHA 4S3FA 3MKKA 4W86A 3IK4A 3EWBX 2F9RA 5CPOA 3BAKA 1UC5A 5HWJA 2YCJA 4GIRA 1UROA 3C2FA 2CLHA 4ZL1A 4UTKA 3LPPA 3V5CA 1C90A 1FP9A 4TMBA 3HG4A 1LLQA 2GL5A 3B9EA 3BXWA 3NWRA 1EB3A 4U4MA 4OKDA 5FSDC 5I24A 3W4RA 2PU0A 4LH8A 2I56A 1VBRA 3WD1A 1KXHA 3W6YA 4Y9PA 3QY7A 3ABQA 2JKEA 2NWRA 3OJGA 4IFOA 3LNPA 1XLAA 2HROA 1H4PA 2FPTA 2NLYA 1B57A 2WCAA 1WXYA 3I4EA 2BZNA 3P67A 1FWTA 4O4WA 3VNDA 4OJYA 1ODZA 1UA7A 3LCHA 4NUWA 4JQ2A 4WJ8A 4UFKA 3CUFA 2QCNA 4DJEA 1YMYA 4BQ5A 1QO2A 2FLIA 4S3JA 2D73A 3TSBA 1Y5XA 5JMUA 1I6NA 3ANVA 3GVRA 3GG7A 4UMBA 4QAWA 5A6JA 3SRFA 2YZ5A 2QCCA 4MKNA 4QP0A 2TMDA 2A7RA 4UTWA 2OOGA 3AMGA 1TQXA 2OR2A 3CQKA 1JQXA 3CUHA 3NL3A 2F6KA 3STPA 4Q4QA 3DCPA 1E0WA 2PD5A 3MI2A 1UZ4A 2PWUA 2Q8LA 3L66A 1V3MA 4LUYA 4M1BA 4NNCA 4IIEA 2GQAA 3GX9A 4YVXA 5FF2A 1UD4A 1LG2A 4G8TA 3I7QA 1QO5A 5I0DA 2YW4A 3DI1A 3AI0A 4JEQA 2PWEA 2B4GA 3TTSA 3VD4A 1J4EA 3IJ9A 1WDQA 1J0NA 3PFRA 2XISA 4IX2A 1VPQA 1LBMA 1CI1A 4K38A 3FXGA 5A6TC 1FXPA 5D2XA 2IQDA 3CHEA 4JFUA 2VEIA 5FJPA 1IWAA 3MSDA 1RCXB 1LDCA 2G3FA 1KFEA 2DIKA 3MI6A 1GHSA 1TPUA 4AWTA 4DPQA 4MOZA 1UQYA 2YL6A 2OO6A 5CSYA 4FNQA 3R5EA 2ZWZA 3B9OA 1T8QA 2G5WA 3FKRA 3IGXA 4S3AA 1XL9A 2QR6A 1Z32X 4G1NA 1F3EA 1PEZA 2C0HA 4IPLA 1I2OA 2VZKD 1EJRC 1V08A 4X2RA 3MP5A 5HJYA 1E6SM 3UZJA 1OG0A 2J77A 5IRPA 2W61A 1XC6A 3W74A 3MI3A 5CKSA 1LRNA 4IQLA 2WVTA 1EJ7L 1H7PA 1M7OA 1BHGA 2P8BA 1GQIA 2NUWA 4MJ2A 3WNMA 4RDYA 3PBWA 4GHRA 3W23A 1XINA 3FVDA 4Q6JA 3DX5A 1T99A 1XCWA 4JX5A 4KIRA 3GUWA 3ENLA 3M47A 3H12A 4H83A 3AWNA 1B3VA 4OUEA 1IHIA 1WA3A 1UOKA 3FGCA 1VCGA 2YOCA 2LLEA 5AY7A 1FDYA 4HJWA 1LF1A 4IM4A 2Z7GA 2OKTA 3CQJA 3RU6A 1PXGA 2CLPA 2X1UA 3C0QA 1KM6A 3W71A 4GVHA 4L61A 2FZ8A 4G6CA 1SO3A 1QMLA 3M6YA 1M41A 1R9YA 3HPZA 3PZOA 4PTMA 3NVDA 4PGLA 3HJZA 3VIOA 4L7ZA 3ISIX 2RDWA 3VU2A 4D1JA 1RWFA 2EG7A 3FEQA 2P3EA 4AZCB 1IV8A 5LYRA 1V02A 2OSYA 5D2VA 2PDNA 4LFYA 4C7GA 3M41A 2VWTA 3JVAA 2YB4A 5A94A 4E38A 2OWXA 5CCZA 3THDA 4PB5A 4URIA 4EAYA 1RVKA 3GXIA 2XVNA 2J7BA 1XH1A 5DCBA 5T91A 4GQRA 4FLSA 1RBOB 3ZSSA 3F03K 3W1LA 1GQJA 6ENLA 4CU8A 3J7HA 3D3AA 2YA1A 4QJ5B 3ABOA 4HU8A 1X96A 5F2GA 4YMZA 4HK6A 2WANA 3QC0A 1MQQA 3GH5A 4CD8A 1E0XA 1DJHA 2J75A 5K3VA 2PRLA 3CK5A 3H22A 2WPBA 3SFKA 3LHTA 4K3ZA 4O1DA 1RWHA 4E2BA 4MNKA 2OYMA 2E4TA 4C6LA 4EE9A 2V3DA 3QR0A 4HPGA 1A3XA 2XZ9A 1BF6A 1K03A 3BJFA 5HOSA 3R94A 2EPKX 3W1UA 3VCRA 1ICPA 1RCOB 3GD6A 4W84A 3PJUA 5KZDA 3K30A 4O1EA 4KRZA 5I07A 2BP1A 4JIEA 4F0SA 3O6YX 2WC4A 1LT8A 3TIMA 4FPSA 2H3BA 1NFBA 4O57A 4MB1A 2WBKA 2XTKA 3Q65A 5MKGB 3N15A 2R1KA 3TV8A 2X42A 1VRAB 4IL2A 3BQ5A 2E67A 2Y6ZA 3IIXA 5T26A 3QPEA 4ZQPA 2OKOA 4PRWA 2W92A 4GVFA 3RX4A 1TELA 2BBFA 3ZWTA 4FNSA 2D0HA 1CWYA 4HYRA 3BICA 1C9WA 3WELA 3QF0A 2VUNA 1I45A 2HDJA 1R85A 4QLKA 2J9ZA 4IJRA 4GYPA 2Q6ZA 1CENA 3SECA 5BZAA 3PNUA 3SJ3A 2PTYA 3L4YA 3E49A 1AH3A 1ZUAX 2YA0A 1GOQA 2O7QA 3CZEA 1QK2A 4MWAA 4A35A 3PTDA 1OADA 4HPXA 1E6RA 1EX1A 2WNWA 3P82A 3N2XA 5BMXA 1U83A 3AXXA 5GJNA 4XD3A 1J0MA 2WWCA 4ZBCA 3EOSA 1OIMA 2ZA2A 4BS0A 3MANA 3PULA 4WSHA 2J24A 4D6JA 2I9EA 2HK1A 2V81A 1BF2A 3QGKC 3MUAA 4ADSA 2BY3A 1EJWC 1K6AA 1HGWA 4AU0A 2X2YA 4JTEA 3CAVA 3ABRA 3MVIA 1ZP4A 4LB4A 2QPSA 4DO5A 3ZFHA 4QAIA 1Q6CA 4JKKA 4GE8A 3EWYA 1DQXA 3AHYA 1LM1A 1MFVA 3WD2A 1WXJA 3BGGA 3O05A 4XIMA 1P1MA 3WBAA 1HG3A 4YLWA 5RUBA 1W8SA 4D6FA 3L9CA 2F8QA 1FDJA 3U2OA 1HKJA 3GNRA 1MFUA 4JPGA 2Y1HA 2QMJA 4B9YA 3CV1A 4J3ZA 3DG7A 1YDYA 3QV7A 1UKQA 1R3YA 3WD3A 1MSSA 4DYEA 2IPWA 3M9YA 2ZFAA 4TMCA 2FZBA 3AFBA 3W76A 3OZMA 3KDOA 1VR6A 5A6SA 2R9RA 4LGXA 1B90A 3B8DA 1QOXA 2C8NA 5HNRA 1KLYA 4B92A 4O1FA 4ZXOA 4HSNA 2H3DA 2VR5A 3LBOA 3DKJA 2VCAA 3N3MA 1JD9A 3S5YA 3A4WA 1OX6A 3ZIZA 3OQ8A 2I14A 1SU5A 2PBOA 1ME7A 1N7NA 4K37A 4XZIA 3QM3A 2RDUA 2QT3A 3GR4A 3C86A 3CBWA 4C6BA 1NH6A 3O1NA 3AALA 5FJOA 3E0VA 1X1IA 3LN3A 3M64A 3EKGA 2AMXA 2QQ6A 4MIMA 4W8AA 3WJZA 2FZDA 3T05A 1M6JA 5JVLA 5IFPA 3UWQA 5IBXC 2OSXA 4LVBA 4QDMA 3G22A 2XGBA 2FJUB 1E73M 3MSGA 3UG8A 2XIBA 2DZPA 4L6OA 2D23A 1UKPA 4MWAD 1LRQA 4CU6A 3EPOA 4QGCA 4RKAA 3CIWA 4BKNA 4NXKA 2A6NA 4JGDA 3WF0A 3R0DA 3L4UA 1LWHA 3STCA 4IT1A 3EAUA 4EAMA 1ITUA 2ZVRA 1VFMA 2NT1A 1IZKA 3PG9A 1LL4A 2YDQA 4TVCA 1XYAA 4GKLA 4F48A 2R6OA 4GYKA 1RPKA 4IGHA 1V0MA 2WC7A 1KC7A 2KX9A 1OX4B 3BCFA 1EGVA 4LUIA 4ACZA 2PGRA 5KSWA 1HXJA 2ABBA 1TWDA 3RHGA 1JNDA 2Y70A 1SO5A 4GY7A 4GI9A 3NXLA 3QLDA 1A5NC 3WEMA 2HEJA 3GXMA 2WKJA 3VINA 3IUDA 1Q6OA 3W2JA 4MKSA 1HIZA 1OFAA 1OFDA 3IV8A 3S0CA 2GQ8A 1V6UA 1NWRA 2I5IA 1G4EA 2ZUMA 2VX5A 3AZTA 4RNJA 1RSCA 4JDYA 3U0HA 3PM6A 1E70M 1OGGA 5I5RA 2YIHA 4P8VA 4RXFA 1KCXA 1Z42A 4H1ZA 3W7HA 1KTCA 4A4AA 4JN8A 1KB3A 3GS6A 3WUFA 3ZXWA 1O5QA 1QU4A 3OVGA 1PTGA 3VDGA 2DDXA 2V68A 1SW7A 3KOZA 3THQA 1OJMA 3I6EA 2INEA 2UWFA 1FQ0A 4IJBA 5LNSA 1TR1A 3NZRA 2OQHA 1EWEA 3TC6A 8RUCA 3F2BA 1FKWA 2X0SA 4F2BA 1J0IA 9XIAA 4LNCA 4DWSB 1F05A 4RLIA 3ARUA 4XD5A 3TYDA 5C55A 3NURA 3E9AA 4Q8OA 3ATZA 3ITXA 4UNLA 1C93A 4E2DA 1VLIA 1A0EA 4XUGA 1F9GA 1XS2A 4JNYA 3NQ7A 5GQBA 3UERA 3S5OA 3OLDA 4KH2A 4WDWA 3TQKA 3R79A 4UCFA 2IKGA 2ALRA 1XXXA 4QRNA 1L2QA 1H7XA 3AJ7A 3BSGA 3HTWA 4K68A 4LVGA 3SY8A 1LT7A 1WKFA 2G3IA 4QR6A 3MU7A 1GQLA 1MZHA 4RDZA 3QOMA 1JGIA 2G37A 5HAOA 3UJRA 4V1YA 2CLEA 4GISA 1ISXA 1RLCL 5ABHA 3APTA 1QK0A 1GYLA 2RH9A 2P3ZA 1OFBA 3WBEA 4FP1A 3B40A 2E24A 5EA9A 3WJXA 4ZO8A 1UR3M 1UB3A 3GTFA 3W1XA 3PB2A 4R7JA 4R7WA 3T55A 4C1NB 1UWQA 1CZ1A 4QXIA 2P88A 3ZWSA 4HNNA 3ZLGA 1UP3A 1Y8BA 1VFSA 5E09A 3G6MA 1W2VA 3T2PA 3W7PA 4OV4A 2CHOA 5C5YA 3PB0A 2WMHA 2DT1A 3ABSA 4D8LA 4MWAB 3B0VC 1OK6A 4Q22A 1A50A 2E9LA 5CZSA 3UZYA 4FX7A 2ZUUA 1EC9A 4R34A 1DE5A 1LP6A 5I79A 1TVLA 3ZR5A 5J04A 4O1BA 4ATLA 2XIIA 3WLNA 2YEPF 3IK2A 3KE0A 4CGTA 1FH9A 4AWEA 4L65A 1O5KA 1EA0A 1PWMA 5C6MA 4Q8UA 1SR0A 1FX6A 4H9YA 4GA8A 3CAQA 5BMWA 2VR4A 3MDWA 3M5VA 4NZ4A 4DAIA 4K1WA 1XI3A 3LS9A 2VGIA 4J40A 3WDHA 1E6ZA 4AZHA 1XDMA 1EIBA 2B7PA 3AUOA 1R3TA 2FQIA 4NZJA 3CL6A 4TU1A 4I8DA 3BDKA 2QVNA 4ACYA 2DW7A 3M6DA 4M51A 3KRSA 3OTRA 3WQOA 4I9TA 1BD0A 2A1YA 2A7PA 3WYZA 3AUJA 5HATA 2E09A 2QDHA 3KP0A 5I03A 2WO5A 4B5TA 3VX1A 4ZGYA 3NDZA 3UY7A 3NM3A 1OCBA 2OZTA 5C54A 5GJMA 1VB9A 4E3TA 1DJZA 2GK1A 3EDFA 2QNEA 3SN1A 3EWZA 3EMZA 3R8GA 3N9SA 5AC7A 4XG1A 1R3VA 1UIPA 2GJLA 5G1YA 3JS3A 2E3ZA 3OZPA 3S83A 4JL2A 2WJFA 4KGLA 1H61A 3SCQA 3W1PA 3WLRA 3HPXA 3CMFA 3GXDA 1RLDA 4ZO7A 1TMLA 3SURA 3UR7A 1I8QA 3HG5A 2YL5A 5ABTA 5JIWA 3GU1A 4LY4A 2NV9A 2FFIA 2CHRA 3N04A 4ZFMA 3UEQA 3VCNA 3B0XA 3TSDA 4M8UA 3NIYA 4HNCA 3VVGA 3COTA 3SCRA 1F3TA 1TVNA 2YLAA 2XGIA 2BVDA 1YXYA 3G0UA 2RAGA 4PR4A 1SUXA 2Y61A 3LG3A 4NRRA 3M5XA 4LBRA 3WK2A 2QUMA 4LS2A 4GWEA 4Z0SA 2FZNA 3VNIA 1U22A 3ARZA 4P7LA 2BXYA 1D3GA 3AS2A 3KOYA 3WQVA 1OFQA 3AIVA 3BLDA 4M56A 5AYXA 2HTMA 4DZHA 7ODCA 2PEVA 3QZAA 4FEZA 2ZUNA 3MKCA 3KTCA 3B97A 2BB0A 3UYIA 2Z1KA 3MS8A 2X8RA 1P0BA 3W3OA 1DE6A 3E2SA 3ARSA 2OQYA 3G3MA 3RLHA 3VNJA 1QWKA 4E8DA 2A3HA 2PMQA 4JICA 1V6VA 4IIFA 3DKLA 3VPLA 1NARA 4PUEA 4W5ZA 1HGYA 1AZ1A 4O0ZA 3PWGA 1UBSA 2NUYA 2ZZ2A 4JN6A 4OT7A 1O94A 1SZEA 5EY5A 4H9TA 3P84A 2GFTA 1BYBA 5IHRA 1AMYA 3FW6A 2GK1B 4Q8VA 4UR8A 4OFCA 1E6PA 2J47A 4ZEPA 2WZMA 4O0KA 4XTDA 1B30A 4IH3A 3BLIA 2VWSA 3R12A 4FOKA 4JTAA 2EHHA 2A6LA 3H7RA 3WDRA 4F4RA 1CT5A 4FXSA 2DGAA 2P0IA 1NDZA 4DYJA 1JAEA 1XBVA 3M1ZA 2D2GA 3CEUA 2V6AA 5H6HA 4Z1CA 1MQRA 3LZ3A 4H8NA 3QPYA 1OYAA 1G4TA 1CX9A 4WZHA 3KL5A 2PWFA 3QJAA 3ARQA 3GC5A 4REQB 3OYZA 3C6CA 1NP0A 4WY0F 1UWTA 4LCQA 1GORA 3ONCA 2IQ0A 1QBBA 2OT0A 4TR9A 3U3HA 3UVIA 4WJXA 2Z1VA 3KOXA 3SCTA 1J18A 4ORMA 1E43A 3F5KA 1QBAA 1NOFA 1EYWA 3W53A 3KX6A 5T9CE 1VGAA 1XIEA 1AMKA 2DZVA 2CEQA 4WGXA 3IV3A 1AVAA 3FOKA 4W93A 2E8ZA 1T8XA 3F2DA 1XLFA 2OEMA 2YSWA 4B90A 4C7FA 1F8IA 3IVTA 3HQ1A 1CXFA 3H2CA 1R30A 2V4IB 3LXCA 4JIPA 1OJPA 1GZGA 4XV0A 3QMTA 1GUVA 3NG3A 2FVKA 4CNUA 1VFOA 1PYMA 3VAVA 4ICMA 3TTEA 4OOUA 3RX3A 5I3KA 4NZFA 1NEYA 3DYOA 4MAZA 3SDOA 4GGHA 3GRIA 5FEZA 4J5NA 1LXMA 2YYUA 1KRBC 2DT2A 1CGVA 4GD0A 4UR9A 3LHWA 3OIXA 4CNOA 3STGA 4UTJA 4NT0A 3P60A 4JTLA 1J2WA 3P0WA 4IFKA 4CLMA 3VOCA 4N9CA 3NTYA 1W31A 4ZA0A 1JIBA 3AQUA 4MFEA 3UWEA 1XCFA 1S2UA 4AD4A 4HBKA 4WDTA 3PC0A 3T40A 2C6QA 2OZ0A 3L68A 4ZCWA 1V3JA 3LXAA 3CV6A 1EQCA 1DWIM 3VOFA 1X1NA 2SFPA 1R86A 1VIZA 4IMFA 3DBPA 4D6CA 4NG3A 4NYYA 5H1WA 2JALA 3S2JA 2WHLA 1F74A 4Z17A 2OOFA 3W38A 4BF5A 2YB1A 2WYSA 5CPSA 3UZZA 1EEPA 1VBUA 3S42A 3UFYA 4MB3A 3HQNA 5EBUA 5I09A 4C91A 4ZQRA 4DUOA 7XIMA 3L12A 2E22A 3DG6A 3GR7A 3VNMA 3N6JA 1GKPA 1V79A 3TQPA 1ONRA 3PN8A 1PSCA 3GC2A 3B0UX 1WDSA 2BXVA 3RX2A 4DBDA 3I6RA 2Y85A 5DMYA 5I3HA 4B3ZA 4EXAA 1H63A 2HJPA 4K8GA 1IQ8A 3GG8A 3G18A 1HO4A 3B8SA 4MPQA 2HPMA 1EXPA 2J7EA 1W1YA 1VJIA 3DFHA 3QZ6A 1HUVA 2ADAA 2DJLA 3II1A 2VENA 3N4AA 2YZRA 3GSMA 2VZVA 3NQCA 3QV8A 1JDDA 3DFSA 4NY2A 5HQMA 1KXTA 1ODUA 1A49A 3N12A 4O14A 4R33A 4NJHA 4UTTA 5AB3A 3A64A 5DY2A 3AS1A 1E9ZB 1FWRA 1XLCA 4Y6GA 1U5JA 2DQWA 3NAVA 1SZNA 1EZ2A 2QCMA 5I3GA 3MYPA 3TNBA 1KV5A 3S1GA 2GJNA 1L8NA 3KFTA 3RITA 1GOIA 1MI3A 3NFUA 4TQTA 3L4ZA 3N9KA 4UFJA 3UESA 3QVQA 2J7CA 2W6RA 4UZUA 2CETA 1BXCA 5LGXA 1R2RA 2OX4A 4E4PA 2PAJA 2JFEX 1US0A 1YNPA 4LCSA 1GW1A 3ZS4A 1O95A 5AVNA 3LGEA 3FDKA 5H8MA 4JFTA 3MO7A 3MUY1 1ITCA 3OZOA 2FTYA 3FA5A 5JH1A 2GVGA 4WSKA 2WJEA 1ZLPA 1PIGA 4HIBA 3QV6A 3IGSA 2P8CA 4HD5A 3WLIA 4WHBA 4AUBA 4QM1A 1IWPA 3N17A 1HJVA 1RJPA 4AH7A 4DJFA 1XLHA 1QUMA 4GABA 4J3VA 2OT1A 3BC9A 4FAMA 4L80A 4H6KA 4K7YA 1DKWA 3CMGA 4X3ZA 1RD6A 5DXXA 4RR4A 5EB8A 1Y7VA 2Z25A 2BODX 5HJLA 3IARA 4WSJA 4J9JA 3CASA 4I5RA 4J1OA 3NEHA 2GPTA 4OBSA 4ZR8A 3AC0A 2NV2A 2CXEA 3TTYA 3WMBA 1W8GA 1WKYA 3CPUA 4GNVA 4WDXA 3TAKA 2A5HA 2RKXA 4JN7A 3KTXA 4HU0A 1PX8A 5E1QA 1OK4A 3UPMA 2PDPA 3RPDA 2PD9A 4NAEB 2BOEX 1OF8A 1ZNNA 1ZZMA 4XSMA 1LRTA 4PCTA 4DNHA 4U33A 1FWIC 4AEOA 3GVQA 2WPGA 3NNTA 2PLMA 3FVMA 3VKJA 3FFSA 2YEPB 1TFVA 1XYLA 5ECUA 2H90A 3S46A 3W1NA 2O4QA 3E38A 3VD5A 4PN2A 1AH0A 5FACA 3PZNA 4XZLX 3IEBA 3H4WA 5BRPA 3UA4A 1XDLA 4PMRA 2X05A 2Z27A 1IIHA 4QDPA 1XPGA 4S3DA 2V5BA 3M46A 2V5LA 1YBQA 3MHFA 2Y5JA 4INFA 3FYOA 1DORA 2ZDSA 4QE1A 2PDKA 4UOZA 4W7UA 2FHBA 4DNMA 1X7IA 2F6XA 3OG2A 3LSBA 3WLQA 2HRWA 3E1F1 2DSVA 1YXCA 1YDVA 3BURA 1LZOA 2PRMA 2DJXA 2XH0A 3BW4A 4UTFA 1TZZA 2X1SA 1D7KA 1LBLA 4MJ4A 2D0GA 2E68A 2YYTA 1W5PA 3UR8A 3NPUA 4PFHA 2JE8A 3IUIA 1UOZA 1WOBA 5EU9A 4LJ3A 1XLIA 5BU6A 2W67A 2DP3A 2O92A 2NW0A 3DHUA 2EPLX 4G7FA 4LT9A 4KBXA 4GH1A 5C2CA 5AYIA 1LL6A 5FA5A 3PZQA 1OCJA 5FOOA 1DPMA 1OQFA 4WCJA 8XIAA 3T44A 4RPQA 5BROA 1UR9A 1ADSA 5AC5A 5AFDA 2VX4A 1CIUA 3VMPA 1UH3A 1UW9A 2BDQA 7REQB 4DWDA 1YDOA 3A24A 2A79A 3C3UA 4US5D 3A4XA 2W79A 3PVFA 3CZ8A 1W9BM 3LHVA 4FXFA 4D9PA 2WMIB 2GGIA 1O12A 1YRRA 3QY6A 4YN5A 2DSKA 3WQ4A 3K8KA 2J8TA 1BSIA 4HMDA 4BFAA 1TJ1A 4NQ1A 3WDQA 1Q6LA 3OIHA 3XISA 1OCNA 2J9XA 2BGSA 1OC5A 4AZGA 2XM2A 1XWYA 3VM5A 4N2YA 5EGRA 3LDVA 4U2YA 2QAPA 4RNIA 1MW3A 4ZB2A 2I17A 3HGSA 1S39A 3VE9A 4UWMA 1F6KA 1KBIA 4GQQA 4AXNA 2Y24A 4RV3A 3EKLA 1XD1A 5D30A 2BVTA 1S3TC 1VZWA 3WUEA 3Q45A 1JR1A 4WUIA 4A3QA 3NQ6A 1TMHA 2G4FA 2NQ5A 4AHQA 4AB4A 2ASHA 4XX6A 1GVIA 4YVPA 3RU8X 5HWNA 3UBPC 1WX0A 3G2GA 4WLCA 1GCYA 2OWWA 3W01A 3TR9A 1SJBA 4AVOA 4XK2A 2ZC1A 4N4PA 3MV01 4IPIA 2NQJA 2CITA 1F6PA 1EUNA 4KRTA 3E0WA 3NPVA 3EA1A 1ZB5A 4E4UA 4NJKA 1OB0A 1GOMA 2PCEA 5C9WA 4OTKA 1WQ5A 4H6RA 1BKHA 4J2MA 1VCFA 3EDEA 1R5YA 1GPFA 1WB0A 1TIMA 5A6BA 4NJJA 2VL4A 5KITA 1PJ9A 4G2DA 5JH2A 1S38A 5CPNA 1ZP3A 3OLGA 3WQCA 4W85A 2OMAA 1HJSA 3W7JA 3VDAA 1JFXA 2Z0IA 3FGCB 4PUDA 4ZO9A 1JZ3A 4Q32A 3HN3A 4ZOCA 1S5MA 3A3HA 3EX1A 2QMKA 3PUEA 1XIJA 3KEHA 4FNUA 1SZGA 4Q7BA 2E5CA 3B8VA 2ISFA 3N2CA 4NX5A 1VEOA 1C8VA 3DFTA 4DBSA 6ALDA 1EFZA 8TIMA 1KKRA 4KS0A 4D8ZA 1A5UA 4DXXA 2W0UA 1JVNA 1TV2A 3HG3A 1UPPA 3TYBA 3LBMA 1L6FA 3ZJKA 1DBTA 1HL2A 3IIVA 1E9LA 3AMKA 1TPVA 4MUPA 2V5DA 3UNTA 3GYCA 4ATDA 5LGZA 3SUSA 3AS0A 1S5WA 2WK2A 4W88A 2YXGA 3S1UA 1HTIA 4GACA 2DSZA 3BJTA 4B16A 4EIVA 3BMWA 5F4SA 4DUWA 4ZENA 1SSGA 1RJRA 3NO5A 4AMAA 4UIOA 3L5AA 2YXOA 3T6CA 4QBXA 2JGYA 3LEPA 1K7FA 3AYVA 1DOSA 1UUOA 1LWJA 4PUUA 1K4HA 1SVDA 4JNZA 2ZE0A 4S3EA 4LUSA 1E55A 2F2HA 3W83A 3RO6A 2WNNA 4ORIA 3WFLA 1A3HA 2C19A 1JI1A 1H49A 1KWGA 2CLFA 1B3OA 3WH7A 5G5IA 1DXIA 2DH3A 2Z4GA 4X61A 1FFRA 3WLJA 1W1B1 1I2RA 1LORA 2H6RA 5IDZA 1V77A 3AHVA 2W9MA 5I7GA 1H1ZA 3S2MA 4FSAA 2OODA 5HWMA 1UASA 2ISSA 4M3PA 3GDKA 4K8HA 1MW2A 3UJ2A 4CQCA 3W27A 4TX9A 1W1A1 3IJDA 3VNZA 1D9EA 4IPJA 5A6MA 2J74A 4E2VA 4DF1A 4HOXA 5F7UA 3GB6A 1NDYA 3U9IA 3W1AA 3PY2A 3TYZA 1M3UA 2OFJA 2Q02A 1IXQA 1HF6A 2UV8G 3GAKA 3BSHA 3IJ8A 5MKGA 4EWND 3GH7A 4ONVA 1SSDA 3H54A 5HQLA 1W5OA 4TX6A 4NKCA 1VFTA 3ITOA 2VGBA 3NR0A 5M03A 1W91A 1W32A 4GH3A 4Y9NA 2ZA3A 2FKPA 3P7YA 1VAHA 3G1VA 5GNXA 1A0CA 2DVXA 4MNLA 2NZLA 4NILA 4NL1A 4Q3MA 4S3BA 2QDGA 3ID7A 3P0XA 2Z1BA 3A9BA 2PZNA 4I5UA 3PBUA 3RK8A 2PDXA 4N9EA 3UXLA 5FI8A 2D24A 3PWIA 3SADA 2DVTA 2GSJA 1ESWA 4JIHA 4JTJA 1DJXA 4DPPA 3W2MA 4CN1A 1D8CA 5REQB 1SMAA 2E5BA 2Z26A 4GY1A 4L4MA 2NXHA 1H7WA 5C7HA 4JTIA 4P7OA 1ZHAA 1JCLA 3OBAA 1TV7A 1FCQA 4AD1A 3HMCA 3U2ZA 3H2FA 2ISDA 1J0HA 2ZWYA 4NZ1A 3C0LA 4QIUA 4FR1A 3CUZA 4YTRA 4PTDA 4AIOA 4DBUA 3BAJA 2WLZA 4GI6A 2WVVA 3ZQ9A 3OQEA 1CLVA 5I3IA 5EKYA 1WNOA 3S2NA 4IUGA 2WMIA 1I0BA 5U7SA 4PCNA 2C79A 1P1XA 1JDFA 5HUOA 3FY1A 2WZHA 1AL7A 4XO7A 1B9BA 4XZBA 4PL2A 3BCJA 5DELA 4QJ3B 2VHLA 5IDIA 1O4UA 4KW2A 3OHMB 4W4QA 1RCQA 4C6JA 2EAWA 1OFEA 3ATYA 2NX3A 5LIXX 3E2RA 1TO3A 5CPLA 4LVFA 3ABXA 2DY3A 4QISA 3EBVA 1MEWA 1YBQB 4IQDA 5H8UA 5EMYA 4P8UA 1R3QA 3DFYA 1UMLA 4DBEA 2E6FA 3ARYA 2QULA 3LZ5A 4BWLC 3NM1A 1F9CA 3U8GA 5HANA 3VKDA 4PUWA 3B3DA 1R3WA 4DWSA 2YGYA 3IIZA 2J8GA 4Y9MA 3C3NA 3MHGA 3WF3A 4PTNA 3IRSA 2AL1A 1KR0A 1YPXA 1UR0A 3HO8A 1RP9A 4P61A 2R82A 4HYWA 4RZ5A 3MYOA 1YHTA 1DJWA 3F5JA 1E4MM 3DC0A 1TWIA 4B3KA 1X39A 2QUNA 2DUXA 3R11A 1YYAA 2BRWA 1DJIA 3RM4A 1XGDA 1N8IA 3RXZA 2NUXA 1B3ZA 3DESA 2DZTA 3KBTC 2HNEA 1ADDA 4J4KA 2WKGA 1MXDA 3VI2A 1QI3A 2QCFA 4JD4A 4EANA 1J6PA 5C9UA 2ZICA 1NWTA 2ODOA 3NCOA 3W1MA 3L5MA 3WLKX 2Y89A 5BOEA 4A05A 3IT6B 1J0KA 3M0VA 3W7DA 3G8RA 3ITCA 1RK6A 3TN6A 2QV4A 1IEXA 5A8PA 3KS6A 4Q6XA 3WF2A 3PPFA 4ZB0A 4MADA 4FF5A 4WEVX 1TJPA 2CXGA 2KZHA 5LIYX 3EWDA 4V1XA 2Y5SA 4AW7A 4ACZB 3VC6A 3T0TA 1HJUA 4LV4A 5ENLA 4IQEA 2NXGA 3EWUA 4OWGA 3PSWA 4HU4A 3TTQA 4GZJA 1XRVA 4I3GA 4PMYA 1IEIA 4D6IA 2OTDA 5CPQA 3WLPA 3G1DA 3MWCA 3ZJ6A 4CD4A 1YW1A 4L4LA 3KBMA 4D6EA 4BEQA 3SQLA 1JEZA 1IT8A 2YCLB 2ZRVA 4JTCA 1VP5A 4X9SA 3A13A 1E15A 2A3EA 1XIIA 1Q63A 1LWIA 4LYKA 4UZSA 2HISA 2VGGA 3N2BA 1BPLB 3G5EA 4UR7A 1QNPA 2AGTA 1FBAA 3IVSA 1UUMA 4RL3A 3V5FA 1A80A 1YIXA 1GWJA 4DXKA 2PTZA 3TONA 2QHAA 4OOZA 4B5SA 2CBVA 3GC4A 1QW7A 3G6LA 1JYWA 4GBDA 2QLYA 1ISWA 1T40A 3W87A 2Q3RA 3TDFA 4A3UA 2DORA 4F2TA 5DEZA 4JFVA 3AJXA 3SY5A 4O0QA 4UQ9A 3BW2A 4CCCA 2YL9A 4DXVA 2G8ZA 4LU0A 2BTMA 3O3RA 3HGRA 1JPHA 2J8FA 3VDBA 3PTMA 1UIOA 3F2CA 1C29A 3VILA 5HXMA 5AHMA 1AW5A 2VI0A 1F73A 1E72M 3W7MA 2VRKA 1V93A 1Q7ZA 3KUMA 4MWAE 2IPGA 1EJXC 4PTVA 1QPNA 4A3RA 5EBAA 4J7RA 5HNNA 1PZ3A 1CXEA 1PZ1A 1HL9A 3PAOA 2W4XA 4ICNA 3GIYA 2P10A 4M81A 2QAFA 1Q6QA 3YPIA 4TUFA 5A8QA 5TF0A 1EQPA 1GYNA 1EA9C 1TZ9A 1CLXA 3UJFA 1MEHA 2QJNA 3BLLA 2XN0A 3PTKA 4DUVA 1OIFA 1BEUA 5BCAA 2FHCA 1VS1A 1Z69A 4UTIA 3NQEA 2OQLA 3WLOA 4IMDA 2BSLA 1RD5A 4WY0A 1XM3A 1KFKA 4PZVA 1PZ0A 4WXZA 2BRVX 2ZA1A 1GHRA 4XQ6A 3H70A 5FSEC 2CIPA 1VD6A 3V7PA 3N4EA 1ICQA 3W6LA 4F0KA 1M01A 1DWJM 4LVDA 1YADA 3AISA 1EJUC 3TQ0A 3SCNA 1B2YA 2CESA 3G1XA 4RW3A 4LPCA 3VMNA 4BF9A 3TLQA 1KFJA 3ANUA 2PDMA 4GX8A 4IL0A 4BHYA 3TLLA 1MZRA 4ENLA 1F8MA 1WKEA 3TXVA 3H2OA 1ZBKA 1IXOA 3MJYA 2JIEA 4FB7A 1TWZA 3PZGA 4XAZA 2VCCA 1W5MA 2OJPA 4IFKB 3TKFA 4Y2WA 1AQHA 3NDOA 4L1XA 3V0TA 5DF0A 4V33A 4I8YA 3PP7A 1H51A 4A8RA 1XBYA 2ZUTA 5CJMA 4FNTA 3F4WA 2J62A 1IE7C 1ZTVA 4DWSD 4G7EB 3VC5A 2BY2A 1VFFA 3IJLA 2CC0A 3LY0A 1OWQA 4HCDA 3GDRA 4AZCA 3UJSA 3W2LA 2QF7A 1VCVA 5CSUA 4MB5A 3GDBA 1A53A 1M1BA 3W7CA 3HB9A 4NNBA 1CGWA 4BQ4A 1XYBA 2TYSA 1YPFA 1A0DA 1WZMA 4UNKA 2WZEA 4JNMA 1HNYA 4PA8A 4AVFA 2FB3A 3U2CA 2WVSA 1JRBA 2EEXA 5HJXA 1VJZA 4CQAA 4K1GA 1G6CA 4ZQOA 3H7UA 1QRQA 4GNJA 3SUWA 1NOWA 4B2DD 1DHKA 2VT0A 2Z6IA 2ONEA 3UR2A 1I1XA 1DWAM 3SSZA 1GG0A 3M0ZA 3R8RA 1VHNA 3URBA 1G7UA 2PTXA 1OZQA 3GVWA 4JL1A 6XIAA 3M0KA 3K4AA 3E96A 3DYMA 1XYMA 4IIGA 2Z2BA 1NU5A 5A8NA 3S1XA 2XFFA 2WOQA 2ACRA 1B4KA 4EPBC 4C1KA 3RJYA 2IPFA 2G4JA 3BJSA 4Z2HA 4PMQA 1KXVA 4JBRA 4AWUA 1TTQA 3ZM8A 1P6WA 3WO8A 4JYEA 3U5YA 4WK9A 4RZ6A 3QC3A 1JDAA 2HNHA 3M4HA 3GNPA 4CQ8A 4BI7A 3ZT7A 4Y8FA 3MMTA 4DZ5A 1QHPA 3LCFA 5FF3A 1K9FA 1I1WA 5LA0A 3PZVA 3ITYA 3RRAA 2QJGA 2XYLA 2CKRA 3NL2A 4YCOA 1V0LA 2EPOA 3IANA 1LG1A 2XN1A 1L0PA 5D9NA 2JF7A 3W25A 4LYQA 3R0UA 3DHDA 2GGJA 2PP0A 1S2TA 1N2VA 1RR2A 3AIWA 5JBFA 2VC6A 4FMVA 4PRRA 4QDWA 1IWBA 1SMDA 3WSUA 3S9ZA 3QBUA 2OELA 4IP5A 6REQB 4F8XA 1A5AA 1TPWA 1C8YA 4J3UA 1D2KA 1TA3B 4E2OA 5HPOA 3CV2A 2PDBA 2YPIA 1KR1A 2VX7A 5K9XA 1KGXA 1V0NA 2QF8A 4AC7C 1FWFC 3C8FA 2F6UA 2E6YA 4UQEA 3WUBA 3K1GA 4POCA 3PR2A 1XUUA 2C91A 6XIMA 5JBDA 9CGTA 3GBEA 1SZRA 2YJQA 1OHLA 3CS2A 4PCPA 2EJAA 2QEZA 1JZ5A 1S46A 3RCYA 3UXKA 1CDGA 4ILSA 1AUSL 1VEPA 4GC4A 1U5VA 3H26A 2IS7A 3DAQA 4V15A 4XVDA 2YW3A 1YDNA 2V2HA 3H4GA 3NOYA 3GZAA 1AODA 3ZOAA 1TWWA 3FLUA 1VBGA 1RAKA 3EOOA 2R14A 3CO8A 1VFUA 1JPKA 3G3DA 1K3UA 2KAUC 4ZOAA 2WCOA 3SFWA 3KAOA 4H6QA 4E4FA 5I3DA 3A3XA 1E1EA 2H8ZA 1V4YA 3C2EA 1E9YB 4ZOBA 4BA0A 3S6OA 4CQDA 3N11A 3KWXA 5FKYA 1DJQA 4IISA 5D2TA 2NWSA 1Q65A 1ZAHA 3ZT5A 3HG2A 2D20A 3SCWA 3W2KA 1EO5A 3VKBA 2VGFA 3RAOA 4AG0A 3BK0A 4H8HA 2RDTA 3N13A 5A5WA 4H4IA 3C56A 3CU2A 3E02A 4CD6A 3TOPA 4MJMA 2GZXA 3EB3A 4QQUA 1HN0A 1XLDA 2Z24A 3BOXA 3PHAA 4RNFA 4O10A 3EB2A 3WF4A 1KCZA 1K70A 1HM2A 4F0LA 2A7NA 4TVDA 1JZ7A 2G0WA 1LL7A 2GGEA 4GZIA 4OBTA 4PUKA 1NDVA 1EWDA 1VC4A 2PLCA 1N7PA 4L4PA 4U5IA 1XF0A 4E8GA 4D71A 1H5VA 5AZ1A 3B8WA 4P8WA 3KBWA 3LCLA 3P62A 5DRIA 3LGDA 1W37A 3UA3A 3ITVA 2FGZA 3KRBA 3EOUA 3H55A 4GC3A 4K36A 2UY5A 3NO3A 2YCKX 3PPCA 1WBHA 1JYXA 4XD6A 3LCXA 1ISYA 3L2IA 4HMNA 4NNAA 2JEPA 3N14A 2A85A 1OD0A 2ACSA 2KXRA 3UWYA 5AN7A 4KT2A 2F38A 4Z1DA 3VIIA 4WR3A 1KV8A 3URNA 3LMYA 1ZBCA 1B54A 2O9RA 2VYOA 3LB0A 3K2GA 3VIJA 3NO1A 3W82A 1NQKA 1OY0A 3MUCA 2EPHA 4Z0JA 1ZU8A 2R1PA 1CLKA 2VRJA 1DHPA 4UTLA 1EKOA 3KS5A 4AISA 5D37A 4PMJA 1FY6A 5CLTA 3PBVA 2V69A 1XYFA 3C0JA 2J7DA 3B8IA 2IKIA 3RILA 3ZMRA 1VH7A 3CHVA 5CBJA 3PSVA 3QW3A 1WXZA 1W9VA 3ANYA 4HN8A 2XFRA 2VZKB 3I7SA 4LY8A 2NQHA 4Q8WA 4E3VA 4XAYA 2ISVA 4XAGA 1WYIA 2D0FA 3GDMA 3H8AA 2DZUA 1V3HA 1KRMA 3T2QA 5AZ0A 5B7YA 4QX4A 4RXGA 3W70A 1A5OC 3TW7A 2DFAA 2I5GA 1RQBA 2Z28A 5DLCA 1H0IA 9XIMA 3BQ6A 4DZAA 3W72A 3NQ8A 3GYEA 5CJ5A 2QDEA 2PRHA 2QS8A 3SCVA 1ADOA 1BXNA 3I4KA 3BV7A 3QMSA 1TB3A 3QHNA 3EX2A 4U2ZA 1VIWA 1Z6KA 5I77A 1E6XM 5LA2A 1YLVA 1YKWA 3DC8A 3EGJA 2Y5EA 1EDQA 1TREA 3TCSA 3EKZA 1FP8A 3IVUA 1E3ZA 4L4OA 3TK7A 5CZJA 1JRCA 1QXLA 2XZ7A 1UR1A 3QXBA 1AA1B 2QCDA 4DI8A 1C3FA 3AAMA 3N18A 5BWFA 7CGTA 3V16A 4B15A 1JCMP 5C8BB 2J78A 1EYEA 5CGTA 2Z1SA 1NJJA 1KA9F 3E0FA 4DJDD 3SUUA 1JQVA 3PAJA 2ACUA 4UFHA 3T8LA 4YTUA 2WAGA 3HURA 1Q13A 3MB9A 3N2MA 2OGJA 1Z8AA 2Q09A 5M17A 1SM9A 4OU1A 2GJRA 3PFMA 5HR7A 1YNYA 1OM0A 1BFNA 1F76A 4HN4A 1PKMA 1K9EA 1VFHA 1XLLA 2ZTJA 2E6AA 3QR8A 2YFNA 3W73A 3WQEA 3W7RA 2VZSA 3ORWA 2EJ1A 3CIXA 2YL8A 5U4NA 3CUIA 4HNOA 3V3WA 1C7TA 4O54A 2Y7GA 1EGMA 4U10A 1TX0A 3LLXA 3EPNA 4CNSA 3MQTA 3CIVA 2VC9A 4WD0A 5G2IA 2ZKMX 4HP5A 1O60A 2JIWA 4KEVA 4TOQA 4KPLA 4XAFA 3ZYZA 3ERPA 3QRHA 1EOKA 2V3GA 3A4AA 3BCDA 2X2GA 4MUZA 2GSHA 2VQUA 3USBA 1W9DM 2INZA 4A8IA 1UD6A 2NVDA 2V0TA 1GVEA 5HMSA 1WDWA 3T0DA 4LRSA 2YDAA 1QHOA 4JFWA 1T7LA 2OSWA 3QQ0A 5C0QA 1E6NA 1N7KA 4KCWA 3QQWA 1ZALA 3WEZA 1UWRA 2XVPA 2PDYA 4AFYA 1ZBVA 1GQNA 3V0SA 2P5NA 2W3ZA 3VO0A 1ZJHA 1RHCA 1VRDA 1D3CA 4DBWA 4GLEA 2ZUWA 3S8HA 1N7QA 4B5VA 3GW3A 3ZJ7A 4L6HA 2G3NA 3W81A 1G67A 1ME9A 2ZRYA 2CFFA 3DXIA 3WZ0E 3LRMA 5MHBA 4RE4A 2MANA 1GOXA 1W6TA 1BVZA 3UW6A 3SZ8A 3UZXA 3CYVA 3I3BA 3M0LA 3MWAA 4AXKA 3A3WA 3QGVA 3QYQA 3E0LA 5G1TA 3PQIA 3AWOA 1ITQA 3ARXA 3UP8A 2C1GA 2EF9A 1YTEA 4B4FA 3C5QA 2EPMX 2VZUA 3TVAA 3TROA 3BE7A 3V0UA 2HBVA 4EPDC 1IT7A 1TWSA 5DY3A 1GVRA 2PDWA 4Q4OA 3W84A 4GG9A 3GHUA 3G77A 4KWVA 4BI5A 3AO0A 1V02E 4BJHA 3LHZA 1XPYA 3QN3A 1IZJA 4EWJA 5BYWA 4ROQA 1F3XA 1RWCA 1EJSC 3P5ZA 2QZRA 5HK4A 3LM3A 4XKMA 3TN5A 1QNSA 3BWWA 2DW6A 1C8XA 5EL1A 1VPXA 4Z1YA 3N4FA 1Y5VA 2OLAA 1UCWA 3F1QA 3ZO9A 1XD0A 2XVLA 1K8ZA 3E3HA 3PWAA 2B7QA 3QSRA 1XLMA 2GJPA 4IMCA 1DXEA 2C1IA 3THCA 1XBZA 2Y0FA 3WMCA 4DF2A 4QE4A 1IT0A 1DWFM 4C90A 1LUCA 3I6TA 2UY2A 1QPQA 1DL3A 4HPHA 1A5CA 1FKXA 2PZ0A 3DN5A 2XM1A 3EXRA 5CC6A 1JDEA 3GTNA 5HNTA 3WDIA 1PUDA 3LMZA 4MTVA 4GOAA 4NJGA 1UA3A 2QDDA 2GJXB 4PTXA 1C92A 2PFHA 1BVNP 4JHMA 2DIEA 4HB7A 1JCTA 2XDFA 3MUZ1 4D6DA 1XCXA 3UXIA 4LRTA 3EXTA 1PTDA 4A21A 4FZIA 4LF1A 5GPRA 5A6BD 4MNMA 3LPFA 4DJFD 1W3YA 3ABZA 5LA1A 1K7XA 3TN3A 4RPPA 3EMQA 3LLDA 1SFSA 2WMKA 3BAWA 3CLMA 2GUUA 1NAL1 4GCXA 1JD7A 2ZOXA 4ZQMA 3A47A 1S1RA 3FAXA 1LBFA 4Z2GA 3VOGA 2ZZ3A 2TAAA 1ZBWA 3ONBA 2WHKA 5HDRA 1DP0A 3WBXA 1Q45A 3NYDA 1XH2A 2C7FA 2JKAA 3TZNA 4G7EA 3VGDA 3XIMA 1OBAA 5LNRA 1W9UA 5M5DA 1LOHA 4S2CA 1QATA 1FWDC 1GVQA 2QGHA 1IR1A 5CZTA 3CYJA 1L6YA 4JTDA 1GEQA 1TSIA 1PX4A 1PZ2A 1TQJA 3CHDA 4O15A 3RMEA 3TYCA 4O16A 3F5LA 4HQVA 4KKXA 5K4ZA 2PGWA 5MF5A 2CU0A 1DWHM 1WV2A 4L1WA 1UKSA 4PSPA 2PODA 4D2JA 3O9NA 1Q85A 3BLFA 1OFRA 2VJXA 3UD1A 1QDSA 4YJ5A 4O12A 3RNDA 3LD5A 4YXGA 3U4AA 4KESA 1A5MC 4HPJA 4Z1BA 4WKAA 1RW9A 5DCDA 4O19A 3C4UA 1UD8A 4I9MA 2XHYA 1NY1A 4B3LA 2ATMA 3WQ5A 4G56A 4DVOA 4JIRA 1XLJA 2BG5A 2ZVIA 1XRFA 1H41A 5K9DA 1W0MA 4HHPA 1GVOA 5B80A 1E4IA 4PEKA 4E8CA 1OSEA 3CB3A 3D5HA 2FIQA 3HIJA 3SUVA 4E5TA 1E6QM 2NQ9A 7PTDA 3JZUA 5G2WA 2G95A 3HGJA 1P6BA 3LCIA 1OFOA 2HZGA 2J7GA 4FF7A 1SFLA 5IHSA 4B5WA 4FR6A 1SO6A 4GJJA 5I02A 4M0XA 4AD3A 2NSOA 3T9PA 2WVVB 4W8LA 4I9AA 4BF7A 4DX3A 2HE8A 1TV8A 1P0KA 3TP4A 3DFPA 1J79A 1G94A 2G3MA 2L5HA 3KCJA 4Q7NA 5HMDA 3WH8A 4NU7A 4TO8A 4CN4A 3POCA 1TJRA 2HBXA 8A3HA 3F59A 2GVYA 4OGZA 4R9XA 3GIPA 1NFPA 4A2SA 1BYCA 3OVPA 4V2XA 1W3KA 1ZJIA 2W62A 2XUCA 2F7FA 4H3DA 2Z1WA 4IF2A 1UKTA 3L0NA 3O63A 3UJEA 4H7CA 2GGGA 3RO8A 3WNPA 4LNYA 1CB7B 3LYEA 2BRPA 5HBFA 2I7GA 2O56A 3HV9A 3HV8A 4S3GA 1J8VA 2AKZA 4HZ8A 1JZ6A 2J7HA 1HQTA 4FX6M 1PDYA 2V9DA 1E71M 1MUMA 3VTRA 2QUTA 2OVLA 3KL0A 5KZMA 3O6CA 3W6MA 1CXLA 5IFTA 1GOWA 2FB2A 3L0KA 3OA5A 2EO7A 3EMCA 5F1VA 5KZ6A 5FAJA 4A3YA 1NTHA 1LUCB 4N6FA 3AIRA 1RY0A 2E9MA 4ZTYA 1E0TA 1DJNA 4W8BA 1A5SA 3KBUC 5A3HA 3LM7A 3N29A 4Q4MA 3ARVA 1MO0A 4Y8EA 3TC7A 2Z7KA 5TIMA 2VFGA 5FEXA 3N2OA 4C6DA 3SN4A 4AY7A 4KQNA 3UPWA 3GG1A 2RGMA 3RFAA 4WXYA 1EJVC 1B4EA 3MMDA 3ES7A 3OBEA 3DFOA 4F40A 4GO8A 3ALFA 5JUVA 1ZFJA 4MGGA 4UTTC 3QPZA 4GIYA 3GE7A 1ZRQA 4KGJA 2Y7FA 2ZRZA 5E9XA 2CLOA 4PSRA 2RDXA 1JYVA 3IIPA 1DQUA 4IIDA 4JX4A 3NGJA 1YE6A 4CCDA 3CV7A 4F66A 3BANA 5TD4A 3MZNA 2WVUA 1H60A 2CZEA 1US3A 1ECQA 4AHPA 1FWJC 4LEQA 1WCGA 3TNOA 2JQXA 5FF4A 1H3GA 4JHZA 3PJWA 1E40A 3QYSA 1ECEA 3OOQA 3PZTA 1Z44A 1NP2A 4JTHA 2ACQA 1EBHA 3CTLA 4HMCA 4LTSA 1JZ8A 1ZSXA 2IPJA 4GI4A 2R1NA 3RDKA 3BOFA 5TBOA 1GJUA 2QGYA 4DF0A 1HX0A 1G01A 3U6WA 1D3HA 1QW9A 3I7RA 1EEXA 2DH2A 4JS3A 4PODA 3FJ6A 3L23A 1TTIA 3DGBA 5DN1A 3SN0A 3GFZA 3ZVIA 1BYAA 1D8WA 5KINA 4DO4A 1PCWA 4IQJA 1GPWA 2BLEA 4LUTA 4AZIA 3DGRA 5EMUA 4JIQA 1NWSA 1ZS2A 4GINA 3PANA 2E0PA 4IIHA 2P76A 3P74A 1TPFA 3GUGA 1OG6A 1PTAA 4UFIA 2OX1A 1O7AA 4C6QA 2J66A 4RX0A 2VVSA 3WH6A 1E51A 4QS5A 5CXPA 1J0ZA 1MUWA 3M7SA 4JKLA 4O8RA 1CB8A 4B4HA 3CQIA 4H19A 3M0JA 2XIQA 1KBLA 3SJNA 2XU2A 2D22A 1A4MA 4HU3A 5E6YA 3IIOA 3FDGA 2Q01A 1XQLA 4LALA 4IGNA 4LSBA 2NQLA 4NZ3A 1X98A 2VUYA 3BO9A 5B7ZA 1X7FA 4GZ7A 2G97A 1Q6EA 2YLLA 3B0YA 3GNNA 2J7FA 4UMCA 1EPXA 3CH9A 4MY8A 1R9ZA 4X22A 1L6GA 3CZLA 3RYSA 1CPUA 3R2GA 2P1FA 3LPOA 1RZMA 3MZ2A 1HVXA 2V3FA 1E0VA 3APGA 1H2JA 3WMSA 3TFCA 3RF9A 4NAFB 1AQMA 1QNQA 3KWSA 4YNGA 2DZBA 2QPUA 3EX3A 4JFSA 1XISA 4I9JA 1CEOA 4QJ4B 2Y8UA 3TXZA 4DLFA 2HSAA 4AZ5A 1AD1A 4O13A 1BTCA 4R9OA 1M68A 3VIPA 5H2ZA 3KTSA 5ABFB 3F4DA 3EDKA 4V27A 1HVQA 4GNKB 4TVUA 3SIMA 4O50A 4DO7A 5DMLA 1R9XA 1M53A 1F5ZA 2OEJA 1GVSA 3MUIA 3FSTA 4PRTA 1NFGA 4LVAA 4AWSA 3TJLA 3R58A