4D6FA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 1 blood group a-tetrasaccharide (e558a, x01 mutant)
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
586
structure length
586
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTASYWIWANDIENKAADYLKVSAKNGGYFIWAEQNVGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 215
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6fA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6fA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6fA02
1C82A 2VC9A 3WNPA 5A8NA 4LPCA 1CBGA 4PMZA 1KFWA 1UWUA 2Y5EA 1UH2A 4U5IA 4M24A 3CMGA 2O9OA 4F66A 2OWXA 3WSUA 4GI8A 3FHQA 2C8NA 1TCMA 1LL6A 1DWAM 1JZ2A 4GKLA 5C70A 3VIJA 4Z2JA 2CESA 1W9VA 5M5DA 3BXWA 4TX8A 2WMIA 4PTMA 1UD3A 3AIVA 2GUYA 3MV01 3CZKA 5HBFA 2CHOA 3SCQA 1QHZA 1E71M 3VINA 5GQBA 6TAAA 4GO9A 1BYCA 3OBAA 2FHFA 4ATLA 2UY5A 3AS2A 3ZJKA 3ARRA 1BSIA 2E40A 2YDQA 3UG3A 2X03A 5D8WA 3T09A 2W4XA 4PMNA 5FOOA 3DHUA 1GJWA 1HVQA 2WSPA 1DWIM 3WMBA 2Z1SA 1B30A 1HKMA 2OSXA 3HJEA 3SCNA 4CN1A 4AZ6A 1D3CA 1TE1A 4BQ3A 4XV0A 2ZWYA 4HPHA 1OCQA 1NP0A 4UQ9A 3ZM8A 4P8VA 1RWFA 4P8WA 2TAAA 3ZOAA 2J8GA 1W3LA 2DIEA 5F7UA 1V3KA 5HPCA 3AS3A 1BHGA 1D7FA 3ZT6A 3VUPA 2VZTA 1EH9A 2YL9A 1QNSA 3GXFA 3GXIA 3WD4A 1QI4A 3AZRA 4J3XA 3ZSSA 4YHEA 3NSMA 3AISA 2FH8A 3VIIA 4NI3A 4FLOA 1UWTA 2WMKA 4D6HA 2JE8A 2O9RA 4AXNA 3WQVA 3D5HA 2AMGA 1QI2A 4C7DA 4MTVA 3N15A 1G0CA 8A3HA 1Y7VA 4FF5A 4JCMA 2J7FA 1Q6DA 3N13A 4J3TA 1GQLA 4PEEA 3MS8A 5FL1A 4PMYA 1XGZA 2PWFA 2WVVA 1CDGA 4RE3A 2PI6A 3CZLA 3U57A 7TAAA 3GBEA 4OZOA 3PTKA 4ZFMA 1MVYA 1F1SA 2XSAA 3ARZA 1LOHA 1KXHA 1XCWA 3WD1A 3WH9A 1E1FA 3DC0A 3K8KA 1X6LA 2JEPA 1J18A 1BG9A 1DEDA 1B1YA 2WLYA 2XYLA 4DM1A 3W53A 4AZIA 1C7TA 3L2LA 3OGVA 3A3HA 2PBOA 1J01A 3TTSA 1KR0A 1ZJBA 5DFAA 1BYDA 4ACZB 1PZ2A 2ZUVA 4F9DA 1DWFM 1O6IA 4J28A 4JKMA 3WQ4A 1XYZA 4HP5A 1Q6GA 2J7HA 4CCDA 1M03A 4GPNA 1QNPA 2BRVX 1HNYA 3GH4A 3AOFA 1B3VA 2WANA 4TVUA 5E6ZA 1AQ0A 4ML4A 1GW1A 3IAQA 4S3KA 1KQYA 1BF2A 5DT7A 3GNRA 3WEMA 1ZB5A 3ARVA 2J7DA 1WE5A 3VD4A 2WAGA 2XWDA 3THCA 2DT3A 1V3LA 3VM7A 1R7AA 5BXSA 3EMQA 3N1AA 1VJSA 3GNPA 2D0HA 3RM9A 2V3EA 1J10A 1CGVA 5ABFB 1E4NA 1OBAA 1UD6A 1V3HA 1HM2A 1QBAA 2QHAA 4WSJA 2JF7A 1B3WA 2GJXA 3WDIA 1C7SA 5ABGA 2HISA 4MAZA 3SUUA 1JG9A 4GI6A 4IISA 1EO7A 3E1F1 4TUFA 1LF1A 4MB4A 2ZXAA 1QI5A 1OJPA 3I3EA 3WH6A 3KWXA 2PC8A 1FFRA 1LG2A 2UWFA 1KR1A 1NWTA 1TA3A 1WDRA 2EJ1A 2WM0A 1VEMA 3RILA 1W3JA 2FDMA 5JBEA 2ZUNA 5EB8A 4JFWA 1N7PA 2BV9A 1JD7A 3MUY1 1V6XA 1E40A 4L4OA 1KXQA 1EGUA 1NWUA 4UQBA 5EFDA 1UD5A 1M7XA 1G01A 1W9UA 4PMQA 1RWAA 2CBVA 4HA4A 2HVMA 3PTMA 4QLKA 1UR1A 1FP8A 2BHYA 2BNJA 2CNCA 3RM4A 4IPNB 1U33A 1HT6A 2IXVA 3THDA 1E0VA 2D23A 4WKFA 1XSIA 3VGDA 3QGVA 4CCEA 3VVGA 2BRPA 3ZR5A 2CITA 5BWFA 2MANA 4AD5A 1HX0A 4AWEA 1V3JA 1OJMA 4C7FA 2DT1A 3VOCA 1CWYA 4PTVA 3FXYA 3OLGA 5FIPA 2VR5A 2E8ZA 4GIAA 1JI2A 4PMDA 3LPFA 3UERA 3ARQA 2OYKA 4OOZA 2YOCA 5I5RA 3AYRA 3WUFA 1VRXA 4B9YA 1JFXA 3VKKA 3IAPA 2VJXA 3SUWA 5KEZA 4YPJA 3SCTA 1GUVA 3BCFA 3W27A 4PN2A 2FGZA 4GQQA 1R86A 2VQUA 1HJVA 3AI0A 4JL2A 4B3LA 1MFUA 1CXLA 1JFHA 1JD9A 2DT0A 5HPOA 5AC4A 1VIWA 3CZEA 3VDCA 4WSKA 4QCFA 3T0AA 2XWEA 2YDSA 4R5EA 4CD4A 2PWEA 1W32A 3VIMA 4EAMA 1GOKA 3GYCA 2WCOA 2GVYA 1HJUA 3FW6A 6A3HA 4M80A 1CGUA 1JZ3A 1AVAA 4NRSA 3W0KA 2X0HA 3TA9A 1E3XA 3CHCA 1J11A 1W91A 7A3HA 4TTUA 4R27A 4W93A 1CGXA 1CXFA 1VEOA 2E9LA 4B9ZA 1JF6A 4LYQA 1GORA 2ZWZA 1W1PA 4ATWA 2E8YA 1L8NA 3AS1A 3RM8A 1RW9A 4W87A 4UFHA 3NYDA 2V3FA 2JF6A 1E4IA 3WNMA 1X1IA 3KL3A 1LG1A 2DIJA 5M17A 4NZCA 4UR9A 3T2OA 4JFUA 4IM4A 4AZHA 1QPKA 1EDGA 1K6AA 3HMCA 1B31A 4QLLA 3TONA 4F9JA 3W37A 4AZCB 3SUTA 3UG4A 2DDXA 1CEOA 4W7WA 3GDBA 4CD7A 4J3VA 2YDRA 1PPIA 2VNCA 3QOMA 2YA0A 1GNXA 4M1RA 4TTGA 1CENA 1W9XA 3W6MA 2YIHA 3ZSTA 2XPKA 2D2OA 4EE9A 2BHUA 3B9EA 2CYGA 3AXHA 3SCWA 4X0VA 1E6QM 4D6FA 2G8ZA 4ZXOA 3N9KA 4E8DA 1H2JA 1WDQA 1PX8A 3KL0A 3EMZA 4UOZA 3CTTA 3ZIZA 5DO8A 2XVNA 1KBBA 3WDQA 2OSYA 3VIHA 4W86A 3OZOA 2XVKA 3OB8A 3AZSA 2AOSA 1JZ7A 2QMJA 3WF1A 4AEEA 4M82A 2CBJA 3ALFA 3AS0A 4HMDA 3PZVA 1HM3A 5A6LA 1HKIA 1EA9C 1VF8A 1E43A 2YA1A 4MNMA 2VQTA 4W84A 4HZ6A 1NP2A 1UWSA 1WO2A 3KEHA 5ECUA 5CQ1A 1NQ6A 3AXXA 5DEZA 4DWSB 5A6KA 2WMGA 3FNDA 3WN6A 2BVTA 1AQMA 1N7NA 1OWQA 2YJQA 4Z2LA 4UNIA 4MNKA 3CLWA 1C92A 1QI0A 3VD5A 5E70A 1MFVA 1WDSA 2XIIA 1OM0A 1HL9A 2DT2A 5D9NA 2QV4A 1UA3A 1W9BM 1F4HA 1SYTA 2J25A 4J3SA 4NRRA 4UQEA 4PBGA 1ZJAA 2YL8A 5JBDA 3MU7A 1B90A 4TOQA 2W92A 2D3LA 3IJ9A 2ZOXA 1VFMA 4QFUA 4ZE5A 3CMJA 3VGEA 3AFBA 1XH0A 1JNDA 5HNNA 1GPFA 5ABHA 4DUVA 1XH2A 3VIGA 1C8XA 4DM2A 4J3UA 4J7RA 2V5CA 2V38A 1DWJM 5A6SA 3VIFA 2VURA 1Q6CA 4UFIA 3UR7A 1CGWA 2BS9A 3CHEA 4GO8A 4ZE4A 5E09A 4H8UA 5EMYA 2WHJA 2QMKA 3AHZA 1HMWA 1W1TA 1R85A 3EDEA 4XZWA 5CLWA 3WH8A 4W7UA 2J7EA 2ZIDA 1ISZA 1LWHA 2EXOA 4CVWA 3GM8A 3WQ6A 1FP9A 3NJ3A 2XGBA 4X0NA 3ARTA 2VI0A 2VMFA 1AMYA 1VJZA 2JIEA 1V02A 1RP9A 1E6SM 1WPCA 2WHLA 1NARA 2CETA 3VILA 2VRQA 1E0XA 1V6UA 1UKOA 1ECEA 2VZVA 3OLEA 4JZ5A 5A8QA 2E9MA 3S2CA 1H4PA 4FLRA 2YBTA 2DGAA 5CPSA 1X1HA 5AC5A 4PUEA 2J74A 1OJOA 5LYRA 1OT2A 4AZ7A 1QHPA 1FH9A 3PZ9A 2DQXA 1ZU8A 5EBAA 8CGTA 4HMEA 4AD0A 3VIOA 1XYFA 5CSYA 4TVDA 5HXMA 3M07A 3VMNA 1EIBA 1RPKA 3RJXA 3WL1A 2GK1B 3WF0A 4BZYA 1CYGA 3ZO9A 1W3YA 3F5JA 3MUZ1 3K4AA 3WIJA 4ACYA 3NDZA 1C91A 1PX4A 1WP6A 5IHSA 4CVUA 3ZJ7A 4AZBA 5CLTA 3CUFA 2UY4A 3LPPA 2OYMA 2XVGA 1V6VA 1M01A 2DSUA 4NSBA 4MPKA 4W89A 2PWDA 2UY3A 2DEPA 2XSBA 4W8BA 1UQYA 1W1YA 1KXVA 4LXFA 3AHTA 4TX6A 1OD8A 3CO4A 5I77A 3APGA 1CTNA 4LQ1A 1JIBA 1E6NA 1J0KA 1FH7A 1Q6EA 3PN8A 4FK9A 1WCGA 4WK9A 3WQWA 5IXEA 2D0GA 3SCOA 3N18A 4UQDA 1FFQA 1E3ZA 2CIPA 4D6DA 1N82A 2J62A 5A2BA 2G4FA 5CJ5A 1J12A 1HP4A 2W66A 2VVSA 3CPUA 5CXPA 1JZ5A 3VX1A 3UCQA 1J9YA 2RGMA 2BY2A 4P8UA 1R87A 4JKKA 1UR9A 4U5KA 2CKSA 3WH5A 1GCYA 1RH9A 2BY0A 2EEXA 4PSPA 4W85A 4JFVA 4F79A 3O2LA 1E56A 2ZX7A 4GXPA 4CN6A 2E22A 4HU8A 1PX3A 3VD3A 5ABEA 1EXPA 2WWDA 4H41A 3B9DA 1XC6A 3K4DA 1CXKA 4W7VA 3W25A 1GOWA 1BQCA 3OLDA 4QAWA 2GSJA 7CGTA 3NUKA 5I23A 2VX7A 1OGBA 2FHBA 3W6LA 3BCDA 2X09A 1BG4A 3A47A 4TXEA 1CGTA 4U3AA 1DP0A 5A95A 2EPNA 3J7HA 1GZJA 5I6SA 2OLHA 2ZUTA 3BAXA 1E6XM 4GZIA 5IDIA 3ZJ6A 1MW2A 1TG7A 2XFFA 3PBGA 1C8QA 3WEOA 5CSUA 5I24A 3AICA 3HN3A 4W8LA 1JZ8A 4ATDA 1FHDA 2OSWA 3BAIA 4RE2A 4U33A 4AIEA 4DUWA 2WMFA 2CEQA 2WMIB 3SURA 1XSJA 1MYRA 2A3EA 5A8MA 2YKKA 1UZ1A 4PCTA 3O9NA 3L4XA 4M56A 2DH3A 5D9MA 3G6LA 4QCEA 3EBVA 2ESCA 1KQZA 4FMVA 2WHMA 4JCLA 4KRUA 4CD6A 3QHNA 2WLZA 1N7RA 2IUZA 2FGLA 4C7GA 5E0FA 3A4WA 2XVLA 2NT1A 3OG2A 4MNLA 4ZXLA 1KGXA 1WKYA 1BVZA 2EO7A 3KE0A 3GTNA 5LA1A 3VO0A 1MXGA 3A4XA 5CG0A 3AIBA 1KCLA 1NM9A 2GJRA 3VMOA 4KGLA 5A3HA 3RJYA 4BCEA 2J77A 1G5AA 1OSEA 4HPGA 1HJWA 4RL3A 2W67A 1KXTA 1OGSA 4UCFA 4RE4A 3MANA 2ZUUA 1HVXA 2DSVA 3F5KA 2QPSA 3BSGA 3NSNA 1UR4A 5I78A 3TP4A 3VTRA 5A6BD 4Y7EA 4U3CA 3BLKA 3EDDA 2DH2A 4H8HA 4JKLA 2O92A 1OB0A 2ZX5A 3W82A 1TZ7A 2BVDA 1QW8A 4QDMA 1HL8A 1W9DM 1MQPA 1CPUA 4AD4A 1X1NA 1E5NA 1ODUA 3ARXA 1GOQA 4L4PA 3N11A 2DSWA 1H41A 4PTXA 3AIQA 5BYWA 1LL7A 2WVVB 4PYSA 5HDRA 3U5YA 3WMCA 4E4PA 1JZ4A 4GZEA 4U2YA 3NIYA 1GHSA 1ITXA 5M03A 4P7LA 1W3HA 4KH2A 1WZKA 1K9FA 4U2ZA 5DF0A 4BQ4A 3KZSA 3IJ8A 1D2KA 1QNQA 4UOJA 2WWCA 1H49A 2G3IA 3VDBA 4GQRA 2PBGA 4KRTA 3AIEA 1RD6A 2XGIA 3WD2A 3OA5A 1SFSA 1BGGA 4AD2A 1ISWA 3UEQA 3CUGA 1EDQA 1VB9A 1BGAA 3KL5A 1CXEA 4QP0A 2VCBA 5BXRA 5I3DA 1HN0A 1ZS2A 2FH6A 1V0NA 1TUXA 4PRWA 1OGGA 4BS0A 1NOFA 4LX4A 3RCNA 1H0GA 3AMLA 2G3JA 4J27A 1HJXA 3CZJA 4H7VA 3RPMA 3AIUA 3AIWA 3O6AA 4UFMA 2W5FA 4K68A 1UH4A 1JF5A 1WDPA 1BVNP 2WC4A 3WQ5A 1UOKA 4JFSA 4UZUA 3TTQA 2JIWA 1FOBA 1GHRA 1CXHA 2BVYA 2VX6A 3PZQA 1CGYA 1KGUA 1E6ZA 2C7FA 3EDJA 1JXJA 1US3A 1R7OA 3BMVA 3T08A 1UKTA 3WDPP 1GOIA 3OZPA 1V6WA 2D22A 1LXMA 2E0PA 1EHNA 5JIPA 1E55A 1ISYA 5LA2A 4BF7A 4EK7A 1JL8A 1GOOA 2WZEA 2X0YA 5GNXA 2D3NA 2GJXB 2VVNA 2G3NA 4BQ5A 4Q22A 5HOSA 4AZ5A 3VU2A 3T0BA 1BAGA 3WUGA 1KGWA 1TA3B 2VRKA 2NW0A 1H11A 2CBUA 3G6MA 4D6JA 3AXIA 3A4AA 4D6EA 2YLLA 3BLPX 2V3DA 4CU6A 2CHNA 4CD8A 1U2YA 4UOQA 1HKJA 3ZT7A 5TD4A 1UKQA 4JFTA 4PMRA 1V0LA 4E8CA 1TVNA 3VGGA 5A94A 4W5ZA 1WZMA 1E70M 2YLAA 1H09A 5BRPA 5E9AA 1KWKA 3ECQA 2WBKA 1PJ9A 3D3AA 4YN5A 3BMWA 5I2UA 1RWCA 2XM2A 2ZX9A 1ODZA 3ARYA 3WFZA 4BQ2A 3QHOA 3TOPA 2WZIA 4HTYA 4MB3A 4JIEA 3CBWA 4D1JA 1LQ0A 3WNKA 4V28A 1BPLB 2YL5A 1UD8A 1KWGA 3ARUA 1JDAA 3SIMA 1JYVA 2W63A 4PCSA 1G9HA 3VGFA 1WAWA 1V03A 1BYAA 4DUXA 2VO5A 2VL4A 5CPTA 4NF7A 4LYPA 4CN4A 1BYBA 3RMEA 1CNVA 3VX0A 3W29A 3I3BA 3WF4A 3NCOA 5JIWA 3IK2A 1J0NA 1LJYA 1NWSA 1HJSA 3NSXA 3SCUA 4AC1X 1UR8A 3K1DA 3WDRA 4CGTA 3PZIA 5BROA 3DECA 1GVYA 3EYPA 3FN9A 4LGXA 3BC9A 4CU8A 4YHGA 4HA1A 3WUBA 1XSKA 1W2PA 4U31A 5D9OA 1KCKA 4DWSC 1GQJA 1J0YA 3VM5A 3LMYA 1M04A 3ALGA 3HU7A 2ZX6A 3BSHA 1CLVA 2Y2WA 4AISA 4PMUA 2Y8KA 4D72A 3L4UA 3WF2A 4D1IA 1E6RA 2WBGA 2EPMX 3WD3A 1PBGA 1YHTA 1E4LA 2WKLA 1MW0A 1WB0A 4M29A 1MQQA 1PIFA 1AQHA 3AMCA 3EMCA 2A3CA 2WVUA 3WH7A 3UR8A 3L4VA 2D0FA 1E9LA 3WF3A 1DWHM 1HXJA 3SCPA 5EFFA 2VUYA 1E4MM 5I0DA 3WDJA 1EO5A 2DSKA 1EQCA 3DHPA 4D6IA 3M6DA 2WCAA 2XTKA 1E73M 3SUVA 4ACZA 2OWWA 1IZKA 2ZUWA 1ZBVA 2WB5A 3LPOA 2EPKX 3SCVA 4CD5A 3VD7A 1HIZA 4D6GA 1B0IA 3CGTA 2ZXQA 1JNEA 2GDUA 1JAKA 2CXGA 5FD0A 1UWQA 5FCZA 1DWGM 3QR3A 5D4YA 1VAHA 1GVIA 3VPLA 2J7CA 2XG9A 1UKSA 2A3AA 3CHDA 2BHZA 2B31A 1B3XA 3WNOA 1SR0A 1QBBA 1EQPA 4AW7A 4OUEA 1Q6FA 1RWGA 1PAMA 5A8OA 1XRVA 1E0WA 4EANA 4E2OA 4UFKA 5KZ6A 2V3GA 5A8PA 1VFUA 1F9GA 1XV8A 4MJ2A 1GQKA 5CZKA 4HMCA 1V02E 2E9BA 3WBEA 1VEPA 2F2HA 4WLCA 5ABFA 1B3YA 1C93A 2XVPA 3A6OA 3T2QA 3T2PA 2ZXBA 1JDDA 1I75A 3NDYA 2XFYA 1VFFA 4B15A 1BFNA 3WNLA 1O7AA 3ARSA 1ISVA 3AIRA 4MB1A 2VR4A 3B8SA 3MV11 1H3GA 2QPUA 1VBUA 1UD4A 1PEZA 2O9TA 2NT0A 4H04A 5AYBA 1SMAA 2W61A 4B16A 1CB8A 4J3WA 2JEQA 3L4YA 3WQ8A 4JL1A 4IUGA 4P7RA 3WEZA 3WY1A 2O9PA 1OINA 3CH9A 5E6YA 4MDOA 3MUAA 4Q7NA 4HOZA 1HMUA 1OT1A 5AY7A 1HN1A 2FHCA 1NWRA 4OBRA 1QHOA 4GI9A 3AYSA 4H2CA 2CPUA 1EOKA 1V0MA 4WF7A 2Z1KA 4PUDA 1J0MA 4MJ4A 1ESWA 1XCXA 5FKYA 3PHAA 4MADA 4WJXA 1GONA 2VZOA 3POCA 1FH8A 3OGSA 4D6CA 2Y8VA 2ZUSA 5GNYA 1TMQA 4P8XA 1GOMA 1IT0A 3MSDA 3QOKA 4WKHA 3GXDA 1L0PA 3WDHA 3L2MA 2F61A 5JUVA 5IFTA 5BRQA 2VZSA 2VOTA 1LXKA 3QHMA 1I1WA 3L4WA 1TFVA 4HZ8A 1N7OA 3DYPA 3VIKA 3BGAA 1J0ZA 3AROA 2JFEX 1XD0A 4JHZA 5M3WA 1TVPA 3W26A 4FLQA 3WBAA 1Q4NX 2WK2A 5CGMA 5BXTA 4JAWA 1W1VA 3L4ZA 1JAEA 1LWJA 1UA7A 2XM1A 3WMSA 3K8MA 3MKKA 1LLOA 1DTUA 2A3HA 2VZUA 3B9AA 4PMXA 2BRWA 2J79A 4P7QA 2E24A 5IHRA 2Q1FA 4HZ7A 1E5JA 1RWHA 3VIPA 3WNNA 4W88A 1UHVA 2WKGA 1H1NA 1UZ4A 1I8QA 3VDHA 1R8LA 2X05A 3POHA 2IXUA 2VX5A 4PTWA 3PZUA 1QVBA 1CIUA 1HJQA 1UH3A 3VNYA 3FHAA 4X9YA 5D9PA 3AQUA 1P6WA 4OKDA 4EKJA 1X1JA 1V3IA 2J7GA 1FHLA 2C0HA 1OD0A 5DMYA 4AEFA 3VGHA 1J0HA 1W9PA 2J4GA 2E4TA 2VRJA 4N0RA 2PWGA 4Z2IA 5JBFA 3VNZA 1Z32X 1EGZA 1QNRA 3U5UA 3W4RA 3BAKA 4M81A 5GPRA 1VENA 3CUHA 3VMPA 3WUEA 1K9EA 1H5VA 1IZJA 3K8LA 2Q8XA 4LYRA 1WZAA 2WNWA 3F5LA 1V08A 5A6BA 1A47A 2J47A 3SEPA 3PZNA 3II1A 3MSGA 4BA0A 5AYIA 1SMDA 3M46A 5D8ZA 3U7VA 4AZCA 3JUGA 1E15A 1H0IA 1F4AA 1S46A 4M8UA 3WD0A 3FAXA 3WL0A 3PZOA 3AHVA 5A6JA 2WDAA 1JYWA 1JI1A 3GH5A 1JZ6A 2BY3A 1HF6A 1UG6A 1B2YA 3TTYA 4XB3A 1E1EA 2VX4A 4A3HA 4A4AA 1XH1A 3FAWA 1I1XA 1NOUA 1W3KA 3CHFA 3IJ7A 4B3KA 2Y4SA 2BXZA 2E3ZA 4Z2GA 4CCCA 1C3FA 2BFGA 3TTOA 2PB1A 2F8QA 5A69A 1PIGA 4WIWA 3W81A 3ZJ8A 1ITCA 2DSZA 2XUCA 2WYSA 4S3JA 1NH6A 3W24A 2J7BA 2XHYA 4AD3A 2EPLX 1QI3A 3UG5A 3UESA 2W91A 1UWRA 4ZENA 5C71A 3WFLA 1UYQA 5A1AA 2EPOA 2VTFA 2D1ZA 3BH4A 1N7QA 1UD2A 4P7OA 3PTQA 1DHKA 4DWSA 2WMHA 1JGIA 2G41A 3DYOA 2WW5A 5BXPA 4DWSD 2X1IA 1B9ZA 1V3MA 1JDCA 3AJ7A 4UFJA 3CZGA 1XD1A 1UQZA 4CUCA 3ARWA 4HU0A 3ZMRA 1QW9A 1W2VA 2D24A 1ZBCA 4MDPA 2QLYA 3PZGA 1UUQA 2WVSA 5CGTA 2J8FA 1KB3A 2NSXA 4WKAA 3GNOA 4OIFA 2GFTA 3N12A 3AHYA 5BCAA 2EBNA 1ZL1A 2GJPA 4KGJA 2ZE0A 1CECA 5I79A 3PZTA 4ZEPA 1HP5A 1X6NA 1V0KA 5GNZA 2D20A 3ZQ9A 3L4TA 4JHOA 2EQDA 4TVCA 1US2A 5A2AA 1E72M 1G1YA 4AZGA 2BXYA 3OIHA 4MB5A 1XHGA 4UFLA 1JYXA 3AHXA 1UKPA 1MW1A 3BAWA 1LL4A 4P7NA 3ARPA 3M7SA 2WC7A 3SCRA 4HA3A 3T0DA 1V6YA 1ZBWA 5DT5A 2WCGA 3VGBA 4OJYA 4XZBA 2VCCA 4MNJA 4OOUA 4XX6A 1CZ1A 3ZT5A 1J0JA 4MAVA 5A2CA 2J75A 1A3HA 2ZXDA 1E6PA 3W28A 3K46A 3CZ8A 4PMVA 1YQ2A 2W62A 1CXIA 3GH7A 3GXMA 4QLJA 3WELA 2WZHA 2GDVA 2Y24A 4UQCA 2WCSA 1KBKA 4KMQA 3UETA 5A6AA 3CUJA 1CLXA 2WHKA 1ZBKA 2YA2A 3MMDA 2XFRA 1EHAA 2AAAA 2X2YA 2X8RA 4N42A 4V27A 3S6TA 5C8BB 1U30A 2QF8A 3I3DA 4CU7A 1UR0A 1MQRA 2WVTA 4UZSA 4AMCA 2A3BA 3AMGA 2V5DA 3N04A 3U7BA 9CGTA 2WSKA 3N17A 3FY1A 3MUIA 5IFPA 2J78A 2VCAA 4AIOA 1VFOA 1TR1A 2DPEA 3MO4A 4UQAA 3OGRA 1M53A 3SCSA 2OWCA 3LPGA 2GK1A 4AD1A 2CERA 4HOWA 1BLIA 4HOXA 3F4VA 3PZMA 1GQIA 4F8XA 1C8YA 3SUSA 5FL0A 4FLSA 1NOWA 2YBUA 2OYLA 1UWIA 3AZTA 4Z2KA 4AIUA 4D71A 1OJNA 1K9DA 1B3ZA 3OLIA 3MMWA 2ZICA 3MMUA 1OIMA 1EOMA 3VDAA 1MXDA 1UR2A 2PWHA 1OIFA 1IV8A 2WXDM 4UTFA 1QOXA 1JXKA 5CPQA 3BAYA 4V2XA 4OBSA 4Z2HA 4KWUA 1G94A 1K9TA 4AYSA 2ZUMA 2WPGA 2CCRA 4W8AA 2WC3A 4A3YA 3BAJA 2XIBA 2CBIA 3ZR6A 1EDTA 4AY1A 1JYNA 3CUIA 2CKRA 1RP8A 3CIVA 3WKZA 1ISXA 4W5UA 1PZ3A 3IANA 3GBDA 2WMJA 1WZLA 4PSRA 4GINA 1BTCA 1FA2A 3W38A 4PMOA 2PF0A 1QNOA 3RDKA 2BY1A 2G3MA 4URIA 3RO8A 5LA0A 3GZAA 1GJUA 2JALA 1J0IA 2XJ7A 4GZJA 4H8VA 3AMDA 2RGLA 1HKKA 3VD9A 2ZX8A 2VT0A 1C90A 4XUYA 6CGTA 3WENA 1VBRA 2UY2A 3EDFA 5A6MA 1MW3A 4IPLA 3EDKA 5E0CA 3RIKA 1WNOA 3DYMA 4CKQA 1MWOA 3AMKA 2YL6A
chains in the Genus database with same CATH superfamily
1C82A 1MEIA 3BG3A 4O15A 4LPCA 1CBGA 4PMZA 1UWUA 3M16A 1KTNA 1P6CA 4F66A 1BD0A 4AVOA 2OWXA 4XKMA 4V1YA 2YSWA 2C8NA 1NFBA 1JZ2A 4GKLA 4Z2JA 2CESA 4HVXA 3GNDA 3PC0A 3EPNA 2CHOA 1QHZA 1VD6A 2E5DA 5JMUA 1Q13A 4GO9A 4WDXA 5CJMA 4E4FA 5I3KA 4FIRA 3AS2A 3UG3A 4XK2A 4PMNA 5FOOA 3WCZA 4ZQCA 3WMBA 1B30A 5AVNA 1HKMA 2OSXA 3GDTA 3ITVA 3CQIA 1TE1A 4XV0A 3A21A 3TJ4A 4UQ9A 3W7OA 2POZA 1RWFA 3CC1A 2GOKA 2TAAA 2J8GA 4Q7IA 4C1NB 4UCGA 4DIAA 3ELFA 1BHGA 1IIHA 1XDJA 4ICMA 1EH9A 4DBWA 1QNSA 2HS8A 3D47A 3DAQA 3AZRA 3IRDA 2IKHA 4J3XA 3O1NA 1OCNA 4YHEA 2FH8A 3VIIA 4NI3A 3DOPA 3G22A 1WKEA 1E1CA 3AO0A 4D6HA 4AXNA 1G4EA 2AMGA 4ZSTA 3S4TA 1DJWA 4XAPA 4C7DA 3F1QA 8A3HA 5FAJA 3PSVA 4JCMA 1Q6DA 4J3TA 3EOLA 3SJ3A 2H3BA 2D69A 1GQLA 1ZAJA 4AWUA 3ITYA 1K8YA 1RALA 3WMLA 4DO7A 1XGZA 4RE3A 2PI6A 3IIPA 3WQDA 4MLJA 2HPIA 3M1ZA 3FS2A 3ZLGA 3UP8A 2XSAA 3VC6A 5HWJA 3ARZA 4DO4A 3FJ4A 4D8AA 2OODA 1SZFA 1KXHA 3Q45A 5DCBA 3WH9A 1E1FA 3K8KA 3BW2A 3MT1A 1PKYA 4B2DA 1T7LA 4AZIA 2GZXA 3OGVA 2PBOA 3ABRA 1I2QA 1ZJBA 1PZ2A 1UIPA 4XBKA 5LIXX 3N2CA 1I6NA 3RPTA 1DWFM 1P1XA 1F74A 1F5ZA 3ZS4A 4RPQA 3GNXA 4NXKA 1DIOA 4LYKA 3GTXA 1M65A 5HA7A 3AOFA 2WANA 2LLEA 2QUVA 4NNCA 4IJBA 4MWAB 4DB7A 4O16A 1BF2A 4AF0B 1Q45A 3GNRA 2WAGA 2O55A 3RNDA 5FEXA 1VJSA 1LZOA 3EKGA 3EWCA 2CLKA 5HNUA 2D0HA 1SO5A 2REQA 1PSCA 5ABFB 1UD6A 1V3HA 3REQA 4ZTXA 3SY8A 3WDIA 3QPEA 5ABGA 3LRLA 2HISA 3SUUA 2NV1A 4NJIA 4KERA 4IISA 1EO7A 4PA8A 4REQB 3E1F1 3TN3A 2ICSA 3WH6A 3QBUA 1QRQA 2PC8A 1I8JA 4PB4A 4MKNA 1YW1A 3UXAA 2UWFA 4Q4SA 1TA3A 1WDRA 2AAMA 2WM0A 1VEMA 3N2BA 3U2EA 5JBEA 3WQCA 1YADA 1A3XA 2BV9A 5LSMA 4N9BA 1EC8A 3GX9A 4UQBA 2JGQA 5FESA 4O1FA 4MJMA 1G01A 3GVQA 3EOUA 1RWAA 3UJRA 1VJIA 1M5WA 5ECVA 4QLKA 1UR1A 4JR5A 2BHYA 1X8FA 4WJ8A 1XDMA 3RM4A 3F4CA 2ISSA 6REQB 3C2RA 2ON3A 3OIXA 4XISA 4CCEA 3OA3A 1KNWA 1XLGA 3BO9A 4AD5A 1OJMA 4AY8A 3T8QA 5LGZA 2QVHA 2E8ZA 4PMDA 1JI2A 4D9PA 4WEVX 1FKXA 3QV7A 4KBXA 2QNEA 4QTGA 4OOZA 3DFHA 4QE4A 4GI4A 3MWAA 4GQGA 4RW3A 4IMCA 4ZB5A 4YPJA 4E6MA 3PPGA 2FGZA 1KM5A 1HJVA 2W6RA 4JL2A 4XSLA 1MFUA 1CXLA 1JD9A 3CV2A 3FYYA 3GR8A 3LG3A 4KW2A 3T0AA 4CD4A 3W1TA 1W32A 4EAMA 5C6MA 1H5YA 2GVYA 2AGKA 1HJUA 1W37A 4MKSA 2QV5A 3B8UA 3VXGA 1EJSC 2G0WA 4ICCX 1JZ3A 1AVAA 5DXYA 1J11A 1W91A 7A3HA 1BWLA 1FX6A 1CGXA 2JBMA 3H12A 2ATSA 2V82A 2ZWZA 3TQVA 3G0SA 4ATWA 2PD9A 3AS1A 3DIPA 1F3XA 3T9PA 4FOKA 1UC5A 4UFHA 2V3FA 3P82A 2OOFA 2DIJA 3I6TA 4JTTA 4N9EA 3D0CA 3LLDA 1EX5A 4IM4A 4AZHA 1QPKA 1NIUA 4QLLA 5H91A 3U2ZA 3OBKA 1SW3A 3GDBA 3LRKA 4HK7A 2YDRA 1Z6KA 1J79A 2JKAA 2VWSA 4M1RA 3W6MA 2YIHA 2A2IA 5TBOA 3ZSTA 2XPKA 3Q65A 1DXIA 2D2OA 4JN7A 4DAFA 3B9EA 1TMLA 2CYGA 4D6FA 1ZP4A 2XH2A 2Y1HA 1OC7A 5D33A 4HT3A 1H2JA 4E4UA 4AVFA 1PX8A 2PLKA 2ALRA 3NQBA 3HFYA 2DV0A 4RJEA 5DO8A 3KS5A 3K30A 5HUOA 3WDQA 3IJ6A 3CV1A 3GUWA 1NFPA 2NVDA 3TSDA 3OB8A 2AOSA 2Y7GA 1JZ7A 1I2PA 2CZEA 3AS0A 5E5CA 3M6YA 3V7PA 1P7TA 5A6LA 1EA9C 1E43A 4MNMA 1YYAA 4HZ6A 3T8LA 1FHUA 3UJFA 1XRSA 3KEHA 5CQ1A 4LVFA 2I17A 1P0EA 5I3JA 2WMGA 2YJQA 1SFLA 1WDWA 3CLWA 3T4WA 1C92A 1DORA 2VHLA 1MFVA 2OLAA 1WDSA 1HL9A 2XISA 2KXRA 1F4HA 2BDQA 5AHLA 3VKDA 3KOXA 3WLSA 3ISIX 1HO4A 3BLDA 4ASTA 1ONRA 3WBXA 2YL8A 4WSHA 1P6BA 1K6WA 2FGBA 2ZZ1A 3DGRA 5CZTA 3UT0A 3NO5A 4LEFA 1JNDA 2I16A 4B5VA 1UJPA 4J3UA 4TV6A 1S1PA 2V5CA 2V38A 1RPXA 5SWUA 4MYAA 1Q6CA 4GO8A 2DVUA 4H8UA 2WHJA 5HINA 2CHRA 4XZWA 3V16A 4A8RA 3BV4A 2J7EA 3C3UA 1BKSA 2DJXA 4JX4A 3IGXA 1AZ2A 2XGBA 4X0NA 2VI0A 2VMFA 1AMYA 1VJZA 1UMYA 1RP9A 2WHLA 1IYXA 1NQKA 4IFKB 1LUCB 4GUIA 4O0ZA 2QUTA 4HHMA 4M6VA 4LAOA 2PWVA 1C8VA 2YR1A 3EB2A 3P81A 4M6UA 1VFLA 1TPWA 4HSHA 3PZ9A 4GBDA 3MTWA 3L2IA 4JYEA 4YWIA 3P0WA 1DJGA 2F6XA 3IVUA 1VPYA 2HV5A 4HMEA 2AQOA 3SIZA 8CGTA 1K7FA 5HXMA 2HJPA 2O7QA 4L80A 3LQGA 3PPHA 4CQDA 3EOOA 3MUZ1 4XAFA 5K7JA 2SFPA 1WP6A 4K3ZA 1AH4A 1TZ9A 3VFLA 2YXXA 4JIHA 3QV6A 2NV2A 2DW7A 4QSFA 3OYXA 2DSUA 1W3NA 4QG9A 1FWIC 2UY3A 5BMWA 4LXFA 2H3DA 3C2YA 3UR5A 1JDEA 1JIBA 1FH7A 1S5MA 4Q3MA 3S5YA 4FK9A 1P0DA 4WK9A 1FFQA 4Q6XA 2CIPA 1N82A 5A2BA 5CJ5A 3W3OA 1J12A 2W66A 2VVSA 3E2RA 3HG3A 1JZ5A 1J9YA 3E3HA 2RGMA 3G3DA 4YTUA 2QCCA 2E6DA 1DVJA 4P8UA 1R3VA 3P93A 1D3HA 2D2GA 3GW0A 1DIDA 1RH9A 2Z4GA 4UTKA 1U1HA 1OFDA 3HBLA 5CKSA 3EEGA 2ZX7A 3M41A 1XQKA 2E22A 1V4YA 3SBFA 2Z2UA 4JEQA 1J6PA 3ERPA 2A85A 1XC6A 1Q6QA 1O5QA 1YBQB 3OLDA 2VEGA 4MIMA 4QAWA 2QDHA 4RUBA 4PCFA 2VC6A 5JQ9A 3GTIA 3QMRA 4PTDA 3NUKA 1H51A 5I23A 2C6QA 2IPWA 4GVHA 3W00A 2C3ZA 1A53A 4TXEA 1CGTA 1OX4A 3O6DA 3S5NA 4BWLC 1UC4A 2PDXA 2E6FA 3J7HA 5FEWA 4UTUA 3KWSA 1E6XM 3ZJ6A 2YX0A 3PBGA 2XFFA 4TIMA 4FPSA 3ITXA 3OO2A 5IDZA 4C6DA 4H9UA 3HN3A 4UB9A 4ATDA 3QYSA 4E5TA 4R9XA 1EBGA 5HQLA 4WZHA 3VOHA 3G77A 2A3EA 4GOAA 1UZ1A 4PCTA 3GLCA 1DJNA 3G6LA 4QCEA 1W17A 1VFHA 3CJPA 3QY6A 4CD6A 3VOIA 1N7RA 2VDHA 1QO5A 4FXSA 2NT1A 3IGUA 1WKYA 1OG6A 2EO7A 1JULA 3GTNA 4RW5A 5JH2A 5HANA 5CG0A 3TW9A 3V18A 3JZEA 2GJRA 4RV8A 2CC0A 4I7UA 2NVAA 3TQKA 5C7HA 4BCEA 4Z08A 1NSJA 3MB9A 4XO6A 5HAOA 4ZB2A 5CAKA 3VC5A 2G4JA 3UJ2A 4NJJA 3S5SA 4DELA 4KWSA 3WLNA 3EZ4A 3F5KA 4O8RA 3NSNA 2V69A 3EWZA 3MDUA 4U3CA 3EDDA 4S3CA 3SRDA 8RUCA 1QW8A 1HL8A 4UTIA 4HNOA 4N7QA 3N3MA 3UFYA 3S83A 2UZ9A 4YLWA 1X1NA 3O6YX 1ODUA 1YRRA 4NJKA 3ARXA 3BCJA 2XIQA 3EWBX 4KQNA 4PTXA 2R94A 3EGJA 3LY0A 1R38A 3AIQA 3ZFHA 1UZHA 3QTPA 4ONVA 3U5YA 2P8CA 1FWSA 4GZEA 1GHSA 2XZ9A 1GJPA 3D46A 5M03A 4TV5A 2VGBA 4FB7A 4U2ZA 4BQ4A 4UOJA 1QNQA 2WWCA 2C16A 3VDBA 1DYSA 1RD6A 3H6OA 2QS8A 3OA5A 1SFSA 1LQ2A 1P43A 4GJ1A 1KV8A 1US0A 1H1YA 4MUPA 3UEQA 2PDIA 2PP3A 1VB9A 2B7PA 5AZ1A 5FJIA 3KL5A 1CXEA 3CQ0A 1N8FA 3B8VA 3PF3A 5BXRA 5C2GA 4PRWA 3DG7A 3O3RA 2B4GA 1R3WA 4NAFA 1XW8A 4IMEA 1NOFA 4XZ9A 3RCNA 3DI1A 5HK4A 2G3JA 1GVSA 1OQFA 3IVTA 3NPXA 5CSRA 2FFIA 1K77A 4Z17A 2QCDB 4H7VA 3MPGA 3AIUA 3LHUA 4LUJA 1AMKA 1GVQA 1XI3A 3QRHA 4OQVA 2W5FA 2DORA 4NZ4A 3LMZA 1FWTA 1D8CA 2QEZA 1JF5A 2ZA1A 3WYZA 1BVNP 2WC4A 1UOKA 1DV7A 1JR1A 1P0BA 1GHRA 2BVYA 3PZQA 1CGYA 2OEKA 3H2MA 4XAYA 5DLCA 3T08A 3WDPP 1GOIA 1OFAA 4DVOA 1V6WA 2D22A 2E0PA 1E55A 1ISYA 2Y0FA 3C8FA 4G9PA 3SN4A 1SO3A 2WPBA 4BF7A 4EK7A 2FZMA 4WRHA 2WZEA 2BOEX 2Y5JA 4YYCA 4BQ5A 2CFFA 5LIWX 5AYXA 1J5SA 2GGIA 2PEVA 1OYCA 3VU2A 2W79A 1BAGA 3WUGA 2PP0A 1JPIA 3KBSA 4KWVA 2Z6IA 2NW0A 3G6MA 4HNUA 3MJYA 4P2VA 4D6JA 3TQPA 3HF3A 2CHNA 4CD8A 3KBWA 3TC3A 3WG6A 2D2HA 3NM3A 4JFTA 1KW1A 1V0LA 2QGYA 4H83A 3K13A 5C9RA 1YNQA 5EMUA 3M5YA 1TPC1 3LBCA 1H09A 5BRPA 5E9AA 3ECQA 1RJRA 3LZ3A 4DHGA 1NDWA 5I2UA 3QPZA 1RWCA 1ODZA 3EA3A 3TOPA 9XIAA 3H2OA 4HTYA 1PYFA 4MB3A 4E3VA 3LSCA 1BPLB 4O1BA 1UD8A 2EKCA 2ZE3A 4OECA 3E0LA 3E2VA 4AHOA 1GWJA 4EACA 4DF0A 3MCOA 3I4KA 7REQB 3PUGA 2QIIA 4LYPA 4PMJA 1QJWA 1EX1A 1BYBA 3IT4B 3VX0A 3WF4A 1NWSA 3HPXA 3RCYA 4DO5A 3NSXA 3SRKA 3WLKX 1GKRA 1IXQA 1GVYA 1N2VA 3P74A 1TJ0A 3T42A 4LGXA 4YHGA 1EA0A 3NQ6A 3V5OA 1GVRA 4U31A 4DWSC 1F73A 4OT7A 2FTWA 2CLFA 1XM3A 1CLVA 2Y62A 3ITTA 4Q4KA 3L4UA 1FWWA 1E6RA 3TEVA 1XFCA 3WD3A 1YHTA 2NQ9A 2WKLA 3W2LA 3NL5A 1T41A 2NX1A 4M29A 1UZDA 3MO7A 1SO4A 3EAUA 3VNJA 3WH7A 4PTNA 3P3BA 2D0FA 1DWHM 1HXJA 1GVOA 2OQLA 3SCPA 1EQCA 3S8HA 4D6IA 2WCAA 3SUVA 3W7EA 1LYXA 1UBPC 1EP3A 4ACZA 1ZBVA 3LPOA 4H9MA 5AHMA 5DN1A 1V8EA 2QW5A 1FCBA 3B9NA 3MQTA 2P3ZA 2PDJA 4D6GA 1K1DA 4GLEA 4LVGA 3MMTA 3VOJA 3IIOA 3K1GA 1PYMA 3EWXA 1W8GA 2HBVA 2QCEA 3HQNA 5FCZA 1DWGM 4AAJA 3DU0A 3OZMA 5D4YA 3GIYA 3OG3A 1UKSA 1CLKA 3LHZA 4C6FA 1SR0A 4PCPA 1W1ZA 1EQPA 4UMAA 5I03A 1Q6FA 2EHHA 4UFKA 2Y89A 5KZ6A 5K4XA 2V3GA 5CZKA 4HMCA 5C2XA 2VKZG 4QITA 2F2HA 1R3SA 1EJ7L 5I06A 1C93A 1A3WA 1TQJA 3A13A 1XYLA 1JDDA 1VFFA 4B15A 4LTSA 2QULA 1TELA 3ORWA 3SY1A 1QOQA 3NO1A 2I56A 3GTHA 4IP7A 3IIVA 3BGJA 5AYBA 1SMAA 4QHRA 5E1QA 5F2IA 1CW2A 2JEQA 3RN6A 5FSEC 4RR4A 1TJ1A 3WY1A 4Y9NA 4R34A 3A5FA 4S39A 1XYAA 5E6YA 3BLOA 4MDOA 2A0NA 4WY0B 1S2UA 1Q3NA 4LSBA 1HMUA 2JK2A 3BLEA 1QHOA 3UYIA 1W8SA 4CNUA 5GVJA 3BSMA 3TLLA 1EOKA 3W84A 1V0MA 4G7EB 5CZSA 1A5LC 4PUDA 1Q6OA 4FX6M 1TO3A 4PUJA 2QJIA 5HUPA 4JTSA 4D6CA 3BARA 1VYRA 1Z7AA 3JU2A 4OWGA 4MHBA 4HPJA 4WHBA 1RA0A 4NQ1A 3QOKA 4E8GA 3GXDA 5JVLA 1LBFA 2IPJA 2F61A 2YYTA 5JUVA 5IFTA 5BRQA 4FNPA 1SW0A 2VZSA 1Z44A 1LXKA 1I1WA 2G50A 5DQPA 2DZAA 2GDQA 3DYPA 3BGAA 2ZRZA 2PDUA 3KVMA 3M0MA 3AROA 2JFEX 5G1TA 3VYLA 1TTPA 1TVPA 3W26A 4WQ6A 5BXTA 3EX3A 5EKYA 4PFMA 1LWJA 1LLOA 5LXXA 2VZUA 4I9AA 2J79A 4A22A 4P7QA 3BG5A 2E24A 7TIMA 2YZRA 3L12A 4A21A 2C19A 3WLIA 3GSMA 2WKGA 3VDHA 1S2TA 4LWWA 1UUMA 3EEZA 2Z1WA 3UXIA 3PZUA 4IJCA 1UH3A 3VNYA 3FHAA 4AX6A 4C6QA 3Q2DA 3AQUA 3GE7A 1X1JA 2Q71A 2C0HA 5DMYA 4GGHA 3VE9A 4AEFA 4S2BA 5D09A 2E4TA 4N0RA 2PWGA 1SGJA 4GKTA 3U5UA 3BAKA 2HSAA 5H1WA 3DCPA 3S9YA 5GPRA 3QH2A 1VENA 4UNLA 3B0VC 4DZHA 2Z1VA 3W1LA 2PODA 1A5AA 2PRHA 1L6YA 3K8LA 5M2FX 1A0CA 1TUFA 3DI0A 4HPXA 1F8IA 2WNWA 3MW7A 3F5LA 4CQ8A 1A47A 2J47A 3T81A 3MSGA 4AFYA 1IEIA 4UMBA 4UR7A 5AYIA 2Q6ZA 1X38A 3F59A 3LA4A 1TZZA 1S46A 2PCQA 4D8ZA 1RVGA 1ZNNA 3WL0A 3PQIA 2WDAA 5F2LA 1JZ6A 3DBPA 3LTPA 1UG6A 1B2YA 3TTYA 1F07A 4GE8A 4A3HA 4A4AA 3KDOA 1NDVA 3U4FA 2PS2A 1A4LA 3CHFA 2Y4SA 4CCCA 3UGVA 1PIIA 2GSHA 1ZAHA 4F0KA 2WYSA 4I3GA 1POKA 1UUOA 6XIMA 5LGXA 1FXPA 1EUAA 2EPLX 2IQDA 1RV8A 1D8WA 3R94A 1MDRA 4ALDA 2O56A 1DKWA 3VKAA 4F0RA 3AWOA 2NVCA 4NY2A 4HYRA 1JVNA 1WUFA 3C2OA 3NQ8A 5CZJA 3PTQA 1TJPA 1T96A 2WMHA 3MHGA 5BXPA 5AKQA 4DWSD 2DQWA 1V3MA 1TPB1 2QUUA 1XD1A 1UQZA 3QM3A 3LXAA 4OV9A 4B5NA 2D24A 5C9ZA 3PZGA 1UUQA 4HKPA 2RDUA 5CPNA 5G4HC 4ZCWA 4DLFA 3RXZA 4NZJA 3EKZA 3EWYA 3N12A 3B4YA 3E9AA 4E0CA 4DPQA 2DZUA 2EG8A 1HP5A 3M4HA 2D20A 4JNZA 3ZQ9A 1I2NA 4JHOA 2EQDA 3SW6A 1E72M 1EGVA 4IMFA 1PO9A 2I5GA 4R33A 3OIHA 7PTDA 2GSEA 4UFLA 3HV8A 3M0LA 3W1QA 1JYXA 3AHXA 1KLZA 3MP5A 1UKPA 1MW1A 3BAWA 1PCKA 4P7NA 5IRPA 2HE8A 3VABA 3M7SA 3P0XA 3L65A 4LFYA 1RK6A 2X16A 3GYEA 5DT5A 2WCGA 5HATA 3VGBA 2VCCA 4MNJA 2FPVA 1H61A 5FJJA 4Q8NA 4O1AA 4YS1A 2QDEA 3K46A 2PRLA 1YQ2A 2W62A 1CXIA 1KKOA 4UBPC 3M0ZA 4RZ4A 3CUJA 5KINA 2YA2A 3CWNA 3G1RA 4O14A 2GWNA 2X8RA 4N42A 4V27A 3CK5A 3EOSA 1U30A 2QF8A 2PU1A 2OGYA 2WVTA 3U4AA 3DDMA 1OADA 1RSCA 3KAOA 4AMCA 3AMGA 3U7BA 2WSKA 1ME9A 3N17A 3FY1A 3MUIA 3RHGA 1TB3A 5G2IA 5IFPA 2WNZA 2PC4A 2VCAA 1TRDA 1XS2A 2PCEA 2Z2AA 3A64A 2DPEA 3I10A 3R58A 2Z27A 2OWCA 2GK1A 4AD1A 3NQ7A 2KX9A 2CERA 3W1PA 4XTIA 4CQCA 3M0XA 3WQOA 1GQIA 2QAFA 3L5LA 1W5QA 4YTTA 3DKJA 2YFOA 2W0UA 1KCXA 4FLSA 2CLPA 4Z2KA 2OKTA 3N19B 1B3ZA 2VFHA 5E93A 3QR8A 4LUIA 3N34A 4EF9A 1YXYA 5J5RA 1OIFA 4Z42C 4UTFA 2QDDA 4NNAA 1NVMA 1XLHA 1QOXA 5C54A 5EGRA 4GJIA 4O28A 1GQNA 5REQB 2ZUMA 4WGHA 3G1HA 1A50A 2CBIA 1ZJHA 1E0UA 1YX1A 2G95A 4C6PA 5TIMA 4PUWA 3B8DA 3LHYA 1S5VA 1ITQA 1ISXA 3TV8A 4NJHA 4RLIA 1WZLA 3W38A 2BB0A 1BVWA 2HE5A 2G3MA 4URIA 4AHPA 3TR9A 4PULA 3LCIA 4G5DA 4WJEA 1J0IA 4H8VA 2RGLA 5AHNA 2HWGA 2VT0A 1C90A 6CGTA 3WENA 2J6XA 2UY2A 1MW3A 1XISA 3D6NA 4IPLA 5D04C 3H2AA 2I9EA 5F4XA 1ITUA 3GD6A 4CNSA 1WNOA 5LHEA 4B90A 1MWOA 2YL6A 2EKGA 3BJTA 2VC9A 5A8NA 1VQTA 5BMXA 3ME3A 2OZ8A 2TPSA 1S5WA 3TYUA 4H2HA 2G5WA 1S2CA 3CMGA 4ILSA 1A5SA 1KA9F 3WSUA 3PWIA 4GI8A 1EJUC 3GTFA 3UU0A 1G69A 2YGYA 1TPH1 4MWAA 4XO7A 2B7NA 5M5DA 1ZTVA 2WMIA 4KT2A 4PTMA 3WQEA 1UD3A 3AIVA 3CZKA 3I7QA 3UR2A 1BYCA 8XIMA 3E5PA 4HA0A 4XD6A 3TYZA 2ODOA 3PJUA 1BSIA 3GWQA 2X03A 5D8WA 3M0YA 3T09A 4NZFA 1XLCA 4R53A 3LERA 3CMFA 1HTIA 2WSPA 5FJPA 4PCNA 3SCNA 4CN1A 4H9VA 2VGIA 1BRLA 1BXBA 1A5NC 4ORMA 3RYSA 3VK5A 1OCQA 1NP0A 3SO7A 1DXFA 4GFIA 3TYBA 4P8WA 1G4TA 3T05A 5F7UA 1V3KA 5K9XA 2NWRA 2JKPA 4H1ZA 1T6MA 2OLSA 1D7FA 2BTMA 3ZT6A 3VUPA 2WV8A 4KPLA 3DENA 3WD4A 1QI4A 2ZZ2A 4O52A 2INFA 5HWNA 1KFLA 2XN0A 3RU8X 1YE6A 3HB9A 3NSMA 4HSOA 2ZBTA 4IIHA 4Q4QA 5HULA 3WQVA 3ANUA 1ZCOA 1O12A 4J2PA 3RO6A 4A05A 3TZNA 1RK5A 3V5CA 4GXMA 3HQPA 3N13A 5AFDA 3MY9A 4FO4A 5DRCA 3LDVA 4BF9A 4PMYA 3PNUA 4L9ZA 1CDGA 4Y90A 1AJ0A 3CZLA 7TAAA 3PTKA 2HK0A 1IT7A 1J2WA 4ZFMA 1F1SA 4O1EA 3FSTA 1EJWC 1V77A 4FOUA 4QG6A 4R3UA 4MY9A 5D37A 3WD1A 3DBNA 2R24A 3T44A 2Q01A 2C18A 1J18A 3HPSA 4Q7BA 4JICA 1BG9A 4BFAA 3NZQA 4IGNA 5EA9A 1B1YA 4B2DD 3SQSA 4Q8MA 1C7TA 2P53A 3TTSA 1KR0A 5DFAA 1W1IE 2R8WA 4F9DA 2KXSA 3FYOA 3CS2A 3KBMA 2WZTA 1O6IA 4I6KA 1VC4A 4J28A 4QISA 1XYZA 4A8LA 2V5KA 5FEZA 4PH6A 4LS1A 1QNPA 5T9CE 2VWTA 1HNYA 3RX3A 1KRAC 4TVUA 5E6ZA 3BE7A 4B5WA 3VZZA 1EPXA 1GG1A 1PKLA 5DT7A 4FNSA 1ZB5A 2E7FA 4E3TA 1QPRA 4ZO9A 1TVLA 4G7FA 1KFCA 1WE5A 3VD4A 3NXFA 2DZWA 2XWDA 4TX9A 5DANA 4XAGA 3JZUA 1B57A 3DERA 4X3ZA 1O0SA 1EUNA 1GYMA 3QQ1A 1VCFA 3NA8A 4GA8A 4DJEC 4LU0A 3VZYA 1IE7C 2PGRA 2ISWA 3R13A 3QEZA 1QBAA 2GJXA 4C65A 2ADAA 2PGWA 3RLHA 1G7UA 4MAZA 1W6TA 2ZZ3A 1UP3A 1OJPA 3VI2A 4LUSA 2FZ8A 3OHIA 5CCZA 1KR1A 1NWTA 3CO8A 4R9OA 1ICQA 2ZUNA 1P0NA 4NZ5A 1J93A 1E40A 2I5QA 1NWUA 1NY1A 3BZGA 1UD5A 3UW6A 3TC7A 2YFNA 1K7XA 2HVMA 3N2XA 1ONEA 5F2MA 5PTDA 2R1NA 4NIRA 4HQVA 4GUFA 2CNCA 1U33A 1H1ZA 3DFTA 3FXGA 2IXVA 3PAOA 4JN6A 2D23A 3OVGA 1O5KA 5BNKA 4DF1A 3LOTA 3AUJA 1QWKA 3QGVA 5XIMA 4QDPA 4Q32A 2HEJA 3ZR5A 1XIJA 1KRBC 3DKLA 4MM1A 1NDYA 4AWEA 4UXDA 4JTJA 4C7FA 2DT1A 3U2CA 3OVPA 2OCZA 1CWYA 4L64A 4JHMA 4PTVA 3MSYA 3FXYA 3OLGA 1TQXA 2VR5A 4GIAA 3TW6A 1HL2A 4R85A 1X39A 1XIFA 1XF0A 2YOCA 3T07A 5T9BG 1A5OC 1FBAA 3TA6A 2Y7EA 3IAPA 2VJXA 5KEZA 2DZXA 3W27A 5EU9A 1AG1O 1R86A 2VQUA 3AUOA 1K8XA 4L9YA 3CZEA 4GYKA 5D02A 3K4WA 4R5EA 1KBLA 3UWQA 2PWEA 3CQHA 2VD8A 3VIMA 1GOKA 2QCMA 2WCOA 3KBTC 4ZQMA 6A3HA 4WY0F 3M64A 2VD9A 1CGUA 1VR6A 4GIEA 1K03A 4XKYB 3TA9A 3A23A 4UMCA 3W7PA 1TE6A 4R27A 4W93A 3SN1A 1VEOA 4B9ZA 1JF6A 3TWBA 5MKGA 4AG0A 1TV4A 4IX0A 4FZIA 4PZVA 1W1PA 3Q4DA 5HJYA 4GYJA 2NUYA 1FWCC 1PWLA 1CB7B 3KL3A 2H8XA 3QR0A 4JTUA 2X2GA 1REQB 3T2OA 3SQMA 1EDGA 2BGSA 3WLMA 1PXGA 1RBLA 3TONA 1YXCA 1PV8A 4F9JA 3CTLA 2HNEA 3S5OA 2OZ3A 4AZCB 3PM6A 2DDXA 2FFCA 4JNMA 3PY2A 3TMQA 1GYLA 1FQ0A 1PPIA 3QOMA 1GNXA 4C60A 4TTGA 1W9XA 2PD5A 4L4MA 4K2SA 1LROA 3WLJA 3SCWA 2PAJA 1EWDA 3N9KA 1WDQA 3RU6A 2WSYA 4R7JA 6XIAA 4KCTA 1XL9A 1G7VA 3R5EA 5G4EA 1GT8A 3CTTA 4WGXA 3ZIZA 1CI1A 2YB4A 4IQEA 3VIHA 2H90A 3MZ2A 3IARA 2CZDA 5T8GA 3CWOX 3AZSA 1TTJA 2QMJA 4CNTA 4AEEA 4M82A 5I07A 2CBJA 2W9MA 4K1WA 2CXEA 3CV6A 2NLYA 1LORA 1ICPA 3JW7A 5H2ZA 3W22A 3HMJG 4DQWA 5ECUA 2VDIA 1NQ6A 4DWSB 3WN6A 1TV7A 4H6EA 2O0TA 3OOQA 4Z2LA 4DZIA 4JEJA 4UNIA 1XINA 3RLUA 5KZDA 3FEMA 1OM0A 2DT2A 3TC6A 2QV4A 3R0KA 4JTDA 4ML9A 1WKFA 3OTRA 3U8GA 1ZQ5A 2J25A 2PTYA 3RG6A 2P0IA 4TR9A 3N6HA 4QS5A 4UQEA 1QK0A 4X60A 4TOQA 5B7YA 1TV8A 3PFMA 3P14A 1B4KA 1C29A 2ZOXA 5FF2A 4ZE5A 3EB3A 1O68A 2YCJA 2G37A 3VGEA 1TV5A 1GPFA 4DUVA 4GNVA 1XH2A 2NQHA 3CL8A 4F48A 2I5IA 1DWJM 5JXQA 2VURA 2BLEA 1CGWA 4JQ1A 4ZE4A 5U4NA 2FZBA 3TW7A 4MSSA 1TWDA 3AHZA 3OVRA 2R1MA 4DJDA 3WH8A 1OABA 4C5ZA 1LWHA 3UPBA 3LN3A 1H7OA 3GM8A 4GZ7A 4CEUC 3SM0A 4X63A 5HJXA 3DEQA 1E6SM 1VGAA 2VRQA 3O0KA 4PUUA 3TAOA 1XLMA 2VEPA 5KMYA 1A5BA 4S3BA 5A8QA 4DJED 5DELA 4FLRA 2YBTA 4ZZ9A 2OQYA 1XX1A 4PUEA 3HO8A 2C79A 2DVTA 1QHPA 1SSDA 1SPQA 3QTGA 2NQ5A 3LM7A 4DXKA 4HK6A 2E5CA 4AD0A 3B4UA 4J35A 5AOUA 4TVDA 1F3TA 5EY5A 2E77A 3RJXA 2J8TA 3NQGA 1Q85A 4X61A 4O11A 1CYGA 1WV2A 1DHPA 3L7RA 3K4AA 3ZLFA 4EWND 2BOGX 5IHSA 1I4NA 1UBSA 3CUFA 1UASA 4IMGA 4HNNA 3LPPA 5AHIA 2XVGA 2OJPA 1K8CA 4MPKA 1BXNA 4IPIA 2PWDA 4W8BA 5D38A 1RXOB 5LZLA 3CO4A 4KWOA 2DY3A 4QS6A 1E6NA 1J0KA 5ABTA 1ADSA 4JTRA 2D0GA 4XQ6A 4QM1A 3HGJA 2YXOA 4D6DA 1XBVA 2J62A 3EB4A 5CXPA 1A5MC 1OF6A 3T4CA 3GVWA 2NV9A 4AHQA 2BY2A 1ADDA 4JKKA 3WQGA 3WH5A 4PSPA 3OQEA 1R9XA 1E56A 4HBKA 1FY6A 3TXVA 2NXIA 3BK0A 3TLQA 2BX7A 3LGDA 1R9YA 3VD3A 4HU8A 5C5YA 1RCOB 4AQLA 2WWDA 4H41A 3A9BA 2PSNA 1CXKA 1GOWA 3C0LA 3B0UX 1SJDA 1KM6A 2DUAA 1PS9A 4XAZA 7CGTA 4Y9PA 1YPIA 1MZRA 1ZALA 3W6LA 1EZ2A 2X09A 3A47A 4ADUA 1ML1A 2HK1A 1GZJA 4NZ3A 1YNYA 2CLEA 4GZIA 2NQJA 3W88A 4GQ0A 2VC7A 1MW2A 1C8QA 3WEOA 3S2JA 5CSUA 3ZZ1A 5I24A 3A9IA 3TK7A 1LRNA 1SW7A 4QX4A 4W8LA 3B8WA 2QJMA 1GYNA 4RE2A 4U33A 4AIEA 1EKOA 4DUWA 4GH1A 2WMFA 2CEQA 3TN6A 3DFOA 3KFTA 1LDCA 3PNZA 5A8MA 1MYRA 3MUXA 1DOSA 2RDXA 4O53A 3O9NA 3L4XA 2X42A 4Q8PA 2DH3A 2PTDA 3EBVA 2V81A 2WHMA 3DXIA 1M68A 5HMFA 5KZMA 2XVLA 3ZWSA 3OG2A 1KGXA 3RPDA 3M43A 1NM9A 3N25A 3MSRA 4GNKB 3V0TA 3MBFA 2QCLA 3IV3A 1XCFA 5BOOA 3AAMA 5A3HA 1EPVA 2X1RA 1U83A 4NP7A 1G5AA 1LT8A 3VAVA 4BHYA 4RDZA 1HJWA 1L9WA 4RE4A 3VNIA 2ZUUA 1HVXA 3MA8A 2DSVA 2VENA 1UR4A 5I78A 3TP4A 1YDOA 3C2FA 3LGEA 4ZOCA 4Y7EA 5E0KA 3UZWA 5A6BD 4C6LA 2P0OA 4JIQA 2DH2A 4K8GA 4JKLA 3CEPA 1E1CB 3FJNA 4FOJA 4LS0A 2QYGA 1W9DM 1QU4A 5K9CA 3WJZA 1MQPA 5AHFA 1CPUA 2Z2BA 1E5NA 4IOTA 2BASA 4IUOA 3PPFA 3WLLA 1GOQA 4LY8A 3XINA 2VUNA 4K38A 4P5UA 3N11A 1XLEA 4PL2A 3CH0A 5BYWA 1LL7A 3NEVA 4PYSA 2OX1A 2ZZ4A 5I3GA 1A80A 3NIYA 1UJQA 1ITXA 2E67A 4M6PA 3GC5A 1R3RA 4P7LA 1DIEA 7REQA 1NF0A 1X1OA 1WZKA 1GW9A 1PL9A 4ADTA 2QIWA 5DF0A 1FWNA 3TDFA 2PGEA 1D2KA 3WZ0E 1XR2A 4GQRA 3SAZA 4WX2A 4JQAA 2DUXA 3R12A 3G1DA 3CUGA 4LCSA 1BGAA 2FKPA 3BICA 4ROPA 3W7GA 2DZTA 2QF7A 3LU2A 4EPDC 4MG4A 4UIOA 4PODA 2YCLA 4RNFA 1K3UA 4EF8A 1KO0A 5J8LA 3QSTA 5JH1A 1H62A 1A0DA 5MF5A 4KF1A 4NKCA 1M3UA 3NZPA 3AMLA 1L6WA 3CYJA 1FWAC 1UMLA 2HVOA 2AKZA 4J27A 3QJAA 4FX8A 4LF2A 4UFMA 3COTA 4K68A 3CM4A 4X9SA 4MY1A 1QNVA 2Y85A 3TTQA 4I6VA 3UG8A 3ZR4A 1CXHA 2F9RA 3KW3A 3I6EA 2C7FA 3EDJA 1US3A 1VLIA 2P88A 3WBWA 3LGGA 4GWEA 5JIPA 2REQB 3ANYA 1SZGA 3PANA 1JL8A 3H2CA 3REQB 1VZWA 2X0YA 2D3NA 3S2MA 2VVNA 5C9WA 4HD5A 4BEUA 4Z0JA 5LNWA 4AZ5A 9XIMA 5LIUX 5TF0A 2Z25A 1KGWA 3CQJA 1TPUA 3W1UA 1TA3B 2VRKA 2OQHA 3QVQA 4UTJA 2CBUA 1H7WA 3A4AA 4D6EA 4ZOBA 2V3DA 1XUUA 2PZ0A 5FAGA 7ENLA 4UOQA 1HKJA 4MGGA 3LHVA 3GC4A 2Q3RA 3L68A 3DN5A 1TVNA 3VGGA 5AHEA 4W5ZA 3Q37A 4JY9A 2YLAA 1MRAA 5DX7A 4DBSA 3BURA 3TUUA 1KWKA 3LTYA 3N4FA 2GWGA 3BMWA 2A3LA 2R1LA 4I5RA 3ARYA 3UXLA 4BQ2A 1EXBA 3B8IA 1RLDA 4QIUA 4D1JA 3NVTA 1LQ0A 4QJ5B 2YL5A 1DJZA 3LCXA 5HMSA 3APYA 3ARUA 1V51A 1JYVA 2W63A 2I57A 4MZYA 1G9HA 3PFRA 3P2VA 4WVXA 1BYAA 4DUXA 1EYWA 3FOKA 4X22A 3VDGA 5D32A 4Q4MA 3QGKC 3OJGA 3PJTA 3C4UA 2D73A 2P1FA 1VPQA 3W29A 2J6VA 4FXFA 5CGQA 3VCCA 3IK2A 1J0NA 1HJSA 3SCUA 1UR8A 2Q3OA 3WDRA 1S2WA 2YBVA 3DECA 2QVNA 3BC9A 4ZVJA 3HQ1A 4RNHA 2ZVIA 4MVAA 1K70A 2XGZA 2GUUA 1KCKA 1J0YA 3LMYA 1M04A 5BW6A 1X6UA 1YLVA 2R1PA 3HU7A 3ATYA 4EXAA 4PMUA 2CLOA 2F2KA 4XG1A 3U2OA 4D1IA 2WBGA 3MCMA 4JTLA 2WQPA 1VYPX 2DZVA 4Q33A 3W7DA 2X30A 1R47A 1E9LA 4GCXA 1S2VA 5EFFA 1XIDA 2YW4A 3T40A 2FLIA 1EO5A 4I7WA 3DHPA 4IPJA 3M6DA 4DUOA 1PDYA 3LX9A 1MEWA 4Y6GA 2HPMA 2ZUWA 2WB5A 3SCVA 3JVAA 4H6RA 4CD5A 4K1GA 1HIZA 5KZEA 4F0HA 3CGTA 2ZXQA 1JNEA 1OFQA 3MI6A 4ADSA 1XXXA 2V2HA 3A5VA 1EEXA 2CXGA 4H01A 3PUDA 4GACA 4GH3A 1YTEA 3PPCA 2H9AA 1XIEA 3IRSA 1WXYA 3G8RA 2XIOA 3QR3A 4GJJA 3W1NA 4RDVA 3OZYA 5AVHA 2XZ7A 2E1DA 2XG9A 2PDBA 4J4KA 1NEYA 3KM8A 5I09A 1QBBA 3PUEA 3PB0A 1PAMA 4S3EA 3KBJA 4G1KA 5A8PA 3ITLA 2FB3A 4IFRA 1VFUA 1XV8A 1GQKA 1JJKA 4PE8A 4LNYA 3S1XA 1VBHA 3BANA 2IS7A 2ZTKA 3A6OA 3T2PA 3O0FA 4Z1YA 2ZVRA 1E9ZB 1I75A 3BQ5A 4HJFA 3ARSA 5AC6A 2VR4A 3B8SA 1P7TB 5F4WA 3U48A 3M0VA 1UD4A 3MHFA 1O94A 4JXCA 1PEZA 3GK0A 4ZQRA 4AXKA 2NT0A 2QAPA 4H8NA 3W73A 1CB8A 3L4YA 2Z1XA 1F61A 2CLMA 4KCUA 2Y6ZA 2P50A 4HOZA 1ZGDA 1HN1A 1NWRA 3QW4B 4GI9A 3GAKA 2CZFA 4DLMA 3DFNA 4WF7A 3TOYA 5FJTA 3N9RA 1J0MA 1ESWA 3GXNA 1DJIA 1EJVC 3N29A 4BI6A 3RRAA 1KFBA 1O66A 4EXQA 4MFEA 3R8RA 1Y65A 2VGGA 2ZUSA 1KM2A 4P8XA 1GOMA 1Q6LA 1F6KA 4JY8A 4IIBA 4YTRA 1M6JA 3NQEA 5G5IA 4CCZA 2OT1A 5H8MA 4HZ8A 3RCMA 2NUWA 1EP1A 3VIKA 4G1NA 1XKJA 4JHZA 4RCXA 3H2NA 4FLQA 3WBAA 2AQVA 5B80A 1Q4NX 3O06A 3GG1A 3K8MA 2A3HA 1UPMB 5IHRA 1E5JA 1RWHA 2V5LA 1HQTA 2Z24A 4ERAA 1OG0A 3VIPA 3WNNA 3CT7A 4HK5A 4W88A 1I8QA 1LCOA 2X05A 6TIMA 3RMJA 5I02A 4HYVA 2VX5A 4PTWA 1HJQA 2BXVA 5IBXA 4X9YA 1PCWA 2HTMA 3EXSA 4IQLA 1P6WA 2CZVA 5FEPA 3PWGA 1W56A 3IVSA 5HMDA 1BQGA 1XRTA 4LV4A 3VGHA 1W9PA 2VRJA 4EXBA 1Z32X 1VH7A 1QNRA 5HQMA 3W4RA 4M81A 4S2CA 4OBTA 3CHVA 4JX6A 2POTA 2UBPC 2Q8XA 1XLJA 1S5NA 3YPIA 3ITCA 3NZ1A 4US5A 1QCWA 3II1A 8TIMA 1GOXA 2V4IB 2GVEA 1TMHA 1SMDA 3PWAA 1R30A 1H0IA 1F4AA 2W3ZA 3O07A 4V15A 4M8UA 3WD0A 5C9UA 1IQ8A 4JN8A 4LS2A 5A6JA 1JYWA 4D8OA 1JI1A 1R9ZA 1HF6A 4NHVA 3SRFA 2CLLA 4XD5A 2VX4A 3STCA 4A2RA 1UP0A 2P3EA 3FAWA 3U9IA 4C91A 1DQWA 2EGZA 1W3KA 1QFEA 4Z2GA 1C3FA 4DZ5A 1ONXA 4Y9MA 5A69A 3SN0A 2XUCA 4DXVA 3USBA 4F0LA 3NPUA 3W24A 3UD1A 2W91A 4LEQA 4JIPA 1UWRA 4YVPA 4LUTA 3LCFA 4IF2A 5EMJA 1UYQA 5A1AA 2EPOA 1D9EA 2VTFA 1DE5A 1ZJIA 2X1TA 1N7QA 2R91A 4FA3A 3CUXA 4HN4A 3LNMA 1JGIA 3FDKA 2C15A 1XC4A 4C6CA 1WKDA 3AJ7A 4FHAA 4GIYA 4JTCA 4UFJA 1KM0A 1OCBA 1TX0A 3ARWA 4HU0A 1DPMA 2Y61A 1OX4B 1P0KA 1W2VA 3KUMA 4LB3A 7XIMA 2Z6JA 4DNMA 5CGTA 2HS6A 1KB3A 4NG3A 1JPKA 4G8TA 4WKAA 3STGA 2GFTA 3LI0A 4M6QA 1WUEA 5BCAA 2OXNA 1KLYA 5DY2A 1O5RA 4S23A 1RAKA 1ZL1A 2GJPA 2NZLA 2ZE0A 5I79A 3NXLA 3AYTA 4GUGA 3EX1A 4Q8OA 1Z41A 2PDHA 1US2A 1U22A 5A2AA 2BXYA 3WLOA 2OMAA 4MB5A 1FUYA 4LAUA 1BXCA 4G56A 1XGDA 2R9RA 4H6KA 5F4SA 4NAEA 3SCRA 5D2XA 3T0DA 4B4HA 1ZBWA 3SSZA 2A7NA 3N73A 4C6OA 4XBSA 3SDOA 4FXJA 1KFKA 5T91A 1X96A 4MAVA 2VEFA 3B05A 3MYPA 1L6FA 1XYMA 2ASHA 3A22A 3A12A 5G2HA 1GVEA 3VKBA 2ATMA 2WCSA 3UETA 4KMQA 5FF7A 2F38A 3STEA 4S3DA 5FF4A 4IP5A 1EHAA 4JNYA 3UY7A 3KRBA 2AAAA 1AFSA 4POCA 4LUYA 3S6TA 1FDYA 4GUJA 4NJGA 3BMXA 3QY7A 1MQRA 3INPA 3WLHA 1IWPA 3FA5A 3TQ0A 1Q65A 2BSLA 1RA5A 4RZ6A 4DX3A 2X41A 4AIOA 1VFOA 1TR1A 2IKJA 4UQAA 1M53A 2IPFA 1LWIA 1VPXA 1Q8JA 4HOWA 3KBUC 3F4VA 3PZMA 3KRSA 2FQIA 4L61A 3SUSA 3SR7A 5CZ0A 2OYLA 1UWIA 4JTQA 4D71A 1OJNA 3C8NA 1K9DA 2J24A 3W7QA 4ENLA 1AW5A 1QR7A 1E51A 2ZICA 3MMUA 4O8AA 1TJ2A 3A4JA 1EOMA 3VDAA 2WOQA 1EC7A 4Y96A 1UR2A 3NTYA 4YU1A 4A8IA 4WCJA 3TTEA 4Z2HA 1J8VA 1G94A 3T0CA 2WPGA 4W8AA 1KTCA 4A3YA 3KBNA 1J4EA 3PULA 1EDTA 4AY1A 2TSYA 4YCPA 4Z1DA 3CUIA 3TX9A 2CKRA 4NAFB 4MFDA 3KVKA 1PZ3A 2ONEA 3R0DA 3CLMA 1OFPA 4DN1A 2WMJA 4S3FA 4PSRA 4QEEA 4PMOA 3UCCA 2VEIA 3URAA 3W76A 4WDTA 2JALA 4GZJA 3KOWA 2BMBA 1KM1A 2AL1A 1XP3A 2DUZA 4NZ1A 1KCZA 3LUTA 2ZX8A 3SGZA 2GQAA 5A6MA 4Q8QA 1DQUA 3HURA 3CNYA 4IQDA 5E0CA 4XZNX 3DYMA 3AMKA 4KEMA 3WNPA 3H2EA 3FGCA 1KFWA 1ADOA 2Y5EA 4Y9OA 4YWSA 4U5IA 2V5JA 1HUVA 3GIQA 3PUOA 2QKFA 3FHQA 1TCMA 2VEKA 1LL6A 4S3GA 3VUSA 1DWAM 5C70A 4QSHA 3Q94A 1F3EA 1W9VA 4TX8A 1YDYA 2GUYA 3MV01 5HBFA 3A3XA 3VINA 3BW3A 6TAAA 4IIEA 1QATA 2FHFA 2AQWA 4GC4A 3V75A 3W9ZA 4HNVA 3FLUA 3ARRA 3TN5A 2YDQA 4KRZA 4LJ3A 3VNLA 1GJWA 3DHUA 1DWIM 2Z1SA 3MWCA 3HJEA 2CZ5A 4ECLA 2ZWYA 2PA6A 2Q02A 3GKFA 3CAQA 3CAWA 4RXGA 3OQ8A 4R7OA 4WXZA 5FSDC 1FWJC 1W3LA 2DIEA 3NURA 4HU3A 4BR1A 5HPCA 4U4MA 2QXWA 1OCJA 2ZA3A 4AYGA 5GJNA 4IL0A 2OG9A 3CV7A 1B3OA 4IG2A 3M0HA 2G96A 2YCKX 1W0MA 4L65A 3AISA 4FLOA 1UWTA 3NO3A 2O9RA 3LLFA 3D5HA 1QI2A 1E9YB 2ZFAA 1A5KC 2Z28A 3KVJA 3N15A 1GPWA 3NQFA 2J7FA 2E28A 3QKEA 2BWGA 3UWWA 4PEEA 2QUNA 3MS8A 3THUA 5I3FA 2BOFX 2PWFA 2WVVA 4Q6JA 3KOYA 2GQ9A 3QSRA 3GBEA 4OZOA 4ORIA 1X7IA 5AECA 3LZ5A 4GRSA 1MVYA 1GG0A 1LOHA 1KC7A 3KLLA 4A3QA 5BU9A 1X6LA 2JEPA 4W4QA 4YVXA 2YXGA 1DEDA 4O1CA 2XYLA 3G3MA 3P67A 1IHIA 1HFBA 4PRTA 1I45A 1BYDA 3ENLA 4ACZB 2AKMA 2ZUVA 5EBUA 4I9JA 2ZZ7A 3E0FA 3NQDA 3W23A 4LCRA 3BGGA 1P48A 1OY0A 1DJXA 4LH8A 3B06A 4ZQNA 2J7HA 2BRVX 3LSBA 4DJDC 2V8ZA 4WOZA 3VCRA 1AQ0A 3VKJA 4ML4A 2C1GA 1GW1A 1SSGA 3UA4A 4NT0A 2W27A 5LXEA 3ARVA 2J7DA 3H4WA 3THCA 2NUXA 1BSLA 1R7AA 3N1AA 3IGSA 2NX9A 3GNPA 1KFEA 3RM9A 5CPOA 1JCTA 5HMEA 2V3EA 1PB0A 2J9XA 1FVPA 3NPVA 1CGVA 1REQA 4S3AA 1HM2A 4WSJA 3HTWA 2JF7A 3CU2A 1C7SA 3QGAC 1QASA 1JG9A 3CYVA 1PHWA 4GI6A 4HCLA 3BLLA 4TUFA 4MB4A 1QI5A 3KWXA 4NU7A 1FFRA 3GB6A 3MI3A 3I6RA 3H70A 3RILA 2FDMA 4RX0A 5EB8A 4JFWA 3W2NA 3MUY1 3M9YA 3NOEA 1V6XA 3DGBA 4L4OA 1Q2SA 3E0IA 1F2JA 3W7IA 2BBFA 2CBVA 4FIQA 3E12A 3T1GA 1FP8A 4MMWA 1M9HA 4IPNB 1HT6A 3ZVHA 1W54A 2OFJA 3THDA 1E0VA 4GQBA 4WKFA 2VGFA 5C7VA 2WSQA 4GK8A 4CNNA 3W2UA 2INEA 3UZYA 3VVGA 2OPJA 3QV8A 5BWFA 2MANA 1HX0A 3LBMA 1RVKA 4YYFA 2TRSA 5FIPA 1JPHA 1KD0A 1GZ1A 2WZMA 5D30A 3GAYA 5D2TA 3MYOA 1AD4A 4O0QA 3UERA 3APTA 3V3WA 5LNUA 3ARQA 3N2TA 3N4AA 5I5RA 3AYRA 3WUFA 4B9YA 1YIXA 3SUWA 4GY7A 4PN2A 3P8IA 4PUNA 4GQQA 1YPXA 3R8HA 3ZVIA 1KRMA 2VXNA 5I00A 1JFHA 3XISA 2DT0A 5HPOA 5AC4A 1VIWA 3WK1A 3VDCA 1B4EA 3H54A 4QCFA 2XWEA 2YDSA 2HXTA 1PWMA 1FDZA 3W1XA 1DIKA 2ZKMX 2BODX 4PBEA 1TKKA 1O60A 1S1RA 2VFDA 4NRSA 2X0HA 5CBIA 2PPGA 3CHCA 1B54A 4KFNA 3B04A 1CXFA 1GORA 1YDVA 3W2KA 2E8YA 5K3VA 3FSUA 4W87A 3G1SA 3NQAA 6PTDA 3NYDA 3BDKA 1LG1A 4DY1A 5M17A 4UR9A 4JFUA 2PDKA 1SJCA 5FF3A 4ROQA 3FKRA 3QKZA 3HMCA 3FFSA 1ELSA 5DMNA 3W37A 3QN3A 1QUMA 2WJFA 1VIZA 3QZ6A 4HHPA 3SUTA 3R43A 3SGUA 2DU2A 3UF9A 4ZO8A 4CD7A 4DWDA 2YA0A 3NDOA 1CENA 3QFWA 3VOFA 4EE9A 2BHUA 4DBEA 1EJRC 1IWBA 4U28A 3CPGA 3NG3A 4XVDA 4KEZA 2VR2A 4LAZA 1FHVA 4S38A 3BL3A 3EMZA 4UOZA 3P62A 1QK2A 3VZXA 4DO6A 1AODA 3OZOA 2P8BA 3GDMA 3WF1A 5I3IA 4H3DA 1MZHA 3AXKA 2ZDRA 1OK6A 4HMDA 3PZVA 2PTWA 1HM3A 2A7PA 1TREA 1HKIA 1VF8A 2YA1A 2VQTA 3GRIA 2UV8G 4O4WA 5DEZA 1MUMA 1UR3M 3FNDA 4BF5A 2BVTA 1N7NA 1HG3A 5FJRA 1W3TA 1QI0A 4H9XA 3VD5A 1TTQA 1AW1A 3M0JA 1TX2A 1XUZA 4XZHA 5XIAA 3V5FA 2XIIA 5G1YA 4HNCA 1UA3A 1W9BM 4ZB0A 1SYTA 4DF2A 3KCOA 4J3SA 1QTWA 1ZCCA 4LC8A 2B7QA 5JBDA 1AA1B 1ZFJA 4ZFCA 4F4RA 1A0EA 1PZ0A 3ANVA 4O12A 2D3LA 2CW6A 3C3NA 3MVTA 4OHQA 4QFUA 4IJRA 3CMJA 5G1MA 1XQLA 3AFBA 3EWWA 4DM2A 4J7RA 4G2DA 3KP0A 3ZLHA 1GVFA 1TV3A 3DFYA 4UFIA 2BS9A 3CHEA 1AL8A 2RJHA 4QQ3A 2PDFA 5EMYA 3QQ0A 2Z00A 1HO1A 4H4IA 4DLQA 4W7UA 3PVFA 2YPIA 4OV4A 4FX7A 2INZA 2NQZA 4DJDD 3DFQA 2EXOA 2P5NA 3UD6A 4CVWA 4ZSUA 4IIDA 3STFA 5BWAA 4CNPA 3DUGA 1Q2RA 2JIEA 4FEZA 3PR2A 1V02A 5CC5A 1WPCA 4FAMA 1Q8AA 2CETA 3VILA 2RUSA 1V6UA 4O17A 1UKOA 3JR2A 1ECEA 1LRTA 2VZVA 3BTNA 2ZC1A 3OLEA 4JZ5A 4DPPA 2B81A 3G18A 3URBA 1H4PA 3R25A 1NTHA 1OEPA 3LTSA 5CPSA 1JCYA 4UUIA 2J74A 1OJOA 5LYRA 3S5ZA 1OT2A 4EAYA 1FH9A 4ERIA 4KFPA 3TSBA 4IIFA 2DQXA 1JQVA 1RJQA 1ZU8A 5FA5A 2Y7DA 4O57A 2V30A 1C9WA 3MP4A 3BPWA 5CSYA 3M07A 3VMNA 1EIBA 3WL1A 3S47A 2GK1B 3SY5A 3WF0A 1W3YA 3F5JA 4ACYA 4CQBA 1C91A 4FR1A 4CVUA 4AZBA 4Q8TA 2UY4A 3PK7A 3TJLA 2PLJA 1V6VA 4N6FA 1M01A 1K02A 1QPQA 4W89A 4JTFA 4FF7A 1OHLA 4UTTC 1AD1A 5HR6A 1W1YA 3UA3A 4EOUA 2OVLA 4JTKA 1DE6A 1F05A 3UVAA 1YE4A 3PN8A 4A35A 5IXEA 1WCGA 3WQWA 3TVAA 4AB4A 1E3ZA 4J9JA 5MHBA 3K5XA 2G4FA 1XJBA 1HP4A 3CPUA 5DBTA 1SFTA 3VX1A 3UCQA 1T40A 4UTHA 1RLCL 4HJWA 1R87A 3TCEA 3F4NA 1UR9A 2CKSA 4H19A 1GCYA 2EEXA 2IMRA 1K4GA 4W85A 4R88A 1W5MA 3O2LA 1YMYA 2R82A 5ABEA 3WQPA 4L6DA 3NGFA 1EXPA 5LNRA 2YEPB 3B9DA 3K4DA 4PEKA 3HZ3A 4W7VA 3GXTA 4AU0A 3IV8A 2HBXA 3HIJA 4Q8WA 2GSJA 2VOMA 1F76A 2ABAA 3IEBA 2VX7A 4JYDA 1ME7A 2FB2A 2ZRXA 4U3AA 3DFPA 4DI8A 5A95A 2IQ0A 3TWAA 1X97A 3THAA 5I6SA 3F4DA 2ZUTA 5HNTA 4DRSA 2ZQ0A 3G1VA 1JUKA 1JCJA 4RKAA 1TSIA 3AICA 4C90A 1FHDA 4GX8A 2OSWA 4J3ZA 3UD2A 3W85A 2HMCA 2WMIB 3OEXA 3S2NA 1EF2A 1JQXA 1XSJA 4ZL1A 1XWYA 3H7RA 3TSMA 3UPMA 5CG7A 4M56A 1OK4A 3NQCA 5I7GA 3RRXA 4JCLA 1MEHA 1R2RA 4KETA 2IUZA 4FS9A 4M5PA 5E0FA 1IGWA 4QJ1A 3A4WA 4ZXLA 3RX2A 5BRBA 2JKEA 2PE4A 5LA1A 3VO0A 1MXGA 3A4XA 4OUIA 1KCLA 1BRLB 4KGLA 4K8HA 3W72A 1EP2A 1S3HA 1TWWA 2J77A 2HROA 1OSEA 4RL3A 2W67A 1KXTA 1OGSA 1W1B1 3KZPA 1OJXA 4I8YA 2QPSA 4F2UA 2IKGA 3O8AA 3VTRA 5A8GA 1XIBA 4XZLX 2F6KA 4B92A 3PTDA 4DLOA 4PRRA 2O92A 1UWAA 4XD3A 3W6YA 1I60A 2ZX5A 3USZA 3L67A 3GNNA 2P76A 4QDMA 1RBOB 3LXCA 3DESA 1Z48A 2ISFA 1OX6A 4AD4A 1O5XA 4C6BA 3BJFA 1PE1A 1UROA 3ITOA 4Y9AA 5F1VA 1RZMA 2PGFA 4GVIA 4DXXA 4JTEA 5HDRA 4JOMA 4U2YA 3V0SA 3MI2A 3W01A 5FJOA 2X1UA 1K9FA 1Y8BA 4DEFA 4LRTA 2G3IA 2PBGA 4L1XA 2PTZA 3AIEA 3TYCA