3QR8A

Crystal structure of the bacteriophage p2 membrane-piercing protein gpv
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
157
structure length
157
Chain Sequence
IQELARALRNMIRTGIIVETDLNAGRCRVQTGGMCTDWLQWLTHRAGRSRTWWAPSVGEQVLILAVGGELDTAFVLPGIYSGDNPSPSVSADALHIRFPDGAVIEYEPETSALTVSGIKTASVTASGSVTATVPVVMVKASTRVTLDTPEVVCTNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Baseplate assembly protein V
publication title Phage pierces the host cell membrane with the iron-loaded spike.
pubmed doi rcsb
source organism Enterobacteria phage p2
total genus 15
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04717 Phage_base_V Type VI secretion system, phage-baseplate injector
A PF18715 Phage_spike Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.230 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Gp5 N-terminal domain 3qr8A01
2.60.220.40 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Chondroitinase Ac; Chain A, domain 3 3qr8A02
3QR8A 4MTKA 3PQIA 2P5ZX 4UHVA
chains in the Genus database with same CATH superfamily
5E3FA 1WTXA 4TKOB 1KNEA 5C3EH 3OWEB 1CSQA 2NN6G 2WFWA 3OIPA 1XX8A 4UP8A 1CA5A 1X1JA 5IE8A 1MGSA 2VB3X 2Q2TA 5IT9E 4IN3A 3UD1A 4KY6A 2B2UA 1WTWA 3ND8A 5C44H 2ATWA 3A74A 2HT1A 4QB4A 2EY2A 3QB3A 4RG1A 1B9MA 4HCEA 3RUZA 3TSSA 4DV4L 1QZHA 2B3GA 1L1OC 1KIXA 4RWSC 1J5EL 2VW9A 5LL6X 4FXKC 2R92H 2AQ3B 4DAYA 1IHZA 2B8FA 5CORA 1RKNA 1AW7A 1LTSD 1U5KA 2EY6A 1LTAD 5G3LF 3I4NB 4AQYQ 1VQHA 2RHSB 1AE2A 3EQLC 3SVMA 4DA2A 1X55A 3KYHC 2I5HA 5BR8Q 2Z0SA 2BH2A 1B1ZA 1HR0Q 3CQZB 3MVVA 3U4ZA 1S72A 1EY4A 2IHEA 4YCVA 4A75A 5DM73 4DN4M 3DEOA 3OMGA 5ELOA 4GS3A 1T5XD 1HMWA 4XT3B 4I65A 3E3XA 1HA5A 4K14A 3NENA 3J80L 5IYCH 5HGQA 4PG3A 1GJXA 3TZUA 3I4MB 4KY7A 1I6HB 1SE8A 4DV2L 4LFCL 5ISRA 4OGQC 4PMWA 2IPKD 5CMDA 5EJWA 4DR2L 5C4XB 1SNCA 2A6HC 3EROA 3Q0AA 1PH8A 1A3TA 1LTBD 3F8TA 4X65L 3S16H 3K8AA 3S16B 4JYAQ 2EJGC 3OTOQ 1HZAA 2MFIA 4Y7NH 1I4RA 1Y1WH 4IFDH 4WJ3M 1EY8A 5GAGC 4YHHL 1UWVA 2F0VA 1E1OA 1JR0D 1RWFA 1TVXA 5EQ0A 2F0QA 1GO3E 1PYBA 2F1MA 2GA4B 1PXUA 3AYHB 4X64L 2RDFA 5M5XB 1RTNA 4J6HA 2Q8IB 2IX3A 5DEHA 2SEBD 4ZQ3A 1QVFA 1HH2P 2RCNA 3MFYA 1F1SA 3X3NA 2EZVA 2DNEA 3PCOB 1VF5C 1N33Q 1HTPA 3F2BA 4A3DH 4V190 2F0UA 4GN5A 4JK1C 2UXCL 4FNFA 4DXGA 1Y69U 2WAQB 2EXDA 1HNZQ 4CHTB 2R7ZB 4OONA 3NEMA 4OO1H 2CWAA 5LMNL 4LF7Q 1QJOA 1MBYA 4A3JG 3NHHA 1FGUA 2WMKA 3PUYA 1XJVA 4JI2Q 5CR3A 3J81L 4EQPA 2WCOA 1O7LA 2K52A 3K0YA 3RD4A 1YITA 2A68D 4KTAA 2UUCL 3M9BA 4DNTB 4UP7A 2X69A 1EY5A 2EE1A 1XPUA 4HMIA 1CK1A 4LW1A 4HJ5A 2IY5B 1YEZA 1AEXA 5JPMC 1IBLQ 1PH5A 2NVYB 3NQIA 1U9RA 3FVQA 4C3JG 2NZ1D 1VMCA 3V2TA 2NN6H 2F0EA 3GQBA 3DXJC 3SR1A 4B3RQ 1IBMQ 4LF5Q 4G7ZC 4B3SQ 4F87A 4X3KA 5HY6A 1G8ZD 1JB3A 5FLXL 2JA9A 1K73C 4HEDA 4JBKA 5D3IB 5IYBG 1VMPA 3UD2A 1X65A 5FJ8G 3K7UC 3FRPB 1OXVA 4O1NA 2B2VA 4NDXA 3J81j 1XYIA 3RN5A 1LABA 4K0KL 4IZ8A 3R2TA 3M4OB 1NJIC 2F3WA 2NB0A 5L37A 1JICA 5ELNA 1VQDA 4A3EG 1X3QA 2AMCB 4P75A 3T1HQ 3SXHA 4QUCA 2EPBA 1HQMC 2QDLA 2DY8A 4QL5A 2WMGA 3PO3B 3KF6B 1E1TA 3M7GA 3NXWA 1TWAH 4KHVA 2A5HA 1STHA 4QQBX 4LUZA 3VA7A 3HOYB 3VR3A 1GKHA 1LT6D 2MUYA 2ZT9C 4L63B 4PMCA 4KK7A 2DN8A 4IPCA 4NXNL 3E5SA 2B2YA 3NQTA 4N9PA 5EKLA 2L11A 4DR1L 1CA6A 3I4OA 1UUPA 2ZTCA 2MGSA 1JWSD 2HDMA 2A1AA 3HG9A 3MC0B 4RHRA 2WKCA 3OPOA 3WDNA 5FO8B 1AN8A 5J1ZA 1B9NA 5LMNW 5FK9C 1AP0A 1SNQA 3KF6A 4DUYQ 4GZYC 5KNBA 1L2FA 4GKKL 3ITPA 3PF4A 4DLQA 1ET6A 2ALYB 5A2QE 3FPUB 1AH9A 4A3KB 3S24A 1QOHA 3U9SA 4DUZQ 3SEBA 5I2XA 3MXGA 1WI5A 1W6JA 2Y0SB 1CQFA 3UE0A 1JWMD 1D8LA 3GV6A 3HKZE 3NELA 3S1MB 3EIVA 4HIKA 3K5NA 1N32Q 1YJNA 4APVA 2GVBA 4ZUIA 4AYBG 2B2WC 4A3JH 4LK1C 3M85A 4HAEA 4YCWA 4PV1C 3CCJA 1R9TH 1H9RA 1I4XA 2D2CC 1STEA 3CCVA 4XIGS 4XQQA 4QF4A 1A6XA 1F9PA 1VQLA 1YHQA 2ZTEA 2I07B 2WP8J 4GLVB 3VYSA 4DF7A 2F0SA 5IT9L 2DNCA 2KA7A 2E76C 1N36Q 5CGKA 3H3VH 3BVMA 1GUNA 4C3JH 2LMCB 2UUAL 4M8AA 4OX9Q 2MQHA 4A76A 5C4JH 3EBEA 3UI2A 1F9RA 4HIDA 2CQOA 4CJ0B 4EVOA 5KYIA 4IUQA 4WORA 3A7AB 3J7A5 3I56A 4P74A 4U68A 2E5LQ 1SDFA 2E2HB 4DK0A 3K7AB 1BBUA 2BA1A 2JK8A 2LXKA 2CQAA 1XWEA 1LTGD 2YU9B 4EQNA 4BA1I 5IYBH 1EZ6A 5FJ8H 1OXSC 3EJIA 4A3FG 3K58A 4JOIA 4IJHA 3DUZA 2OCEA 1JWUD 4K2LA 1VQAA 4ZCKA 2NVXB 4R4OA 1YNXA 4C1NK 1PFSA 1BXTA 4DAPA 2WB1B 2FHTA 4YWKA 5J3BA 2A74C 4WJ4A 4A3EH 3GTMB 2Q8TA 1VQ4A 1EY0A 1SLJA 2QILA 1LT3D 5M5WB 3E9IA 4A3EB 4X66L 1EU4A 4EQOA 3FKIG 5E4XA 1PHJA 2YYZA 1ENCA 3CCMA 2JA5G 1SRUA 3HEJA 1PA6A 1CQVA 3BVGA 4POFA 4BBSG 1H9KA 5D3DA 1CTMA 3MA2B 1K8GA 4XQJA 2RKSA 5KEEA 1L1OA 1WD0A 4KHPQ 1RTOA 3BDCA 1E2VA 1NSNS 1KD1C 1A62A 4ID6A 1B44D 1U0LA 1EY7A 2VS1A 1XMOL 2IHFA 3OWFA 4MZ9A 2D9UA 3PUZA 5GAEC 1EIHA 2I5LX 4CDCC 2N88A 4IPDA 3S14B 1RIPA 3DWQA 1VQGA 1Q90A 5E7NA 1GHJA 1D1KA 1WCMG 4HSVA 2KCCA 4DR6Q 1W2BA 5IGCA 4ODGA 3S17H 3H6MA 3P7JA 1EWIA 3W3AA 3PQIA 3ER0A 2B2VC 1KRTA 1H9JA 3TBIB 1CM9A 2AKWB 5LL6S 3G7LA 2E2IH 1YJWA 4S3SA 3GTQH 5C0XI 1HTLD 3MAQA 3LX0A 4DV5Q 2EY5A 4JI4Q 1JCKB 5JOBA 4OEMB 4BBRG 4DLOA 2WMHA 4LFAL 1GD7A 1B7YB 5EBCA 5ELBA 2Q2UA 3NBHB 2PZUA 2HDLA 4JI3Q 1B2TA 3T1YQ 2TMPA 1TWGH 1NR4A 2EJFC 1LUZA 1BO0A 2F0WA 1F9QA 5IP9G 4AYBB 4U673 2BDNA 1AZPA 2HIXA 5C3WA 3ICEA 1LOHA 1A2TA 4O42A 2M00A 5CC4A 4DXFA 1TIID 5JVG3 1D7QA 3MWYW 1KAAA 1PZJD 2RHQB 3NUCA 2B63G 3SK5A 3PO2G 2B2YC 1SMXA 5EKKA 1KDBA 3K5MA 3K59A 4CKCA 2JA8G 2RDGA 1PFBA 3PV0A 4R4IA 3ZJYC 1SNPA 1UNSA 1V1QA 1EFID 1LTID 2RA4A 1DD2A 5IWAQ 5M3MG 4LNQA 1H95A 1DJRD 5DAUA 1N9WA 1A3VA 2WAQE 1C8CA 4NKLA 3S9WA 2R93B 1JT8A 1SE3A 4TQUS 2QCPX 4LAAA 5T1IA 2IX0A 4DV4Q 5KYLA 1J5EQ 3TDQA 2CKZB 1K8OA 2PQAB 4G57A 3HZXA 1ZXTA 2Z4HA 3RZOH 4DV3L 3C1EA 2JA7G 1PZID 2N78A 5J39A 3GTPB 2I46A 3G6JB 4A3FH 4JC0A 3RLOA 1I5FA 5IY0A 1ML0D 4L5RC 4L5TA 5C3XA 3RN2A 5ELCA 3L2PA 1IYJB 4JV5L 2AHOB 4DR5L 1VQ7A 3HOVB 1BUVT 2AUJD 2VUMG 4RGOS 1IYUA 2F0IA 2R7DA 5EKIA 4D1JA 1NMGA 3FKIH 4P72A 2O5JC 3T13A 3QG1A 1TWCB 2FINB 1YNJC 3W1BA 1XNRL 3UE1A 4A4IA 4DV2Q 2JA5H 4LFCQ 1BCPB 2HIVA 2K5QA 1YNNC 4DR2Q 1GVPA 4BBSH 1NBWA 2PQAA 4X65Q 2A6HD 1LO5D 5CV8A 2NVTH 1VQCA 1HMUA 3HFZB 5JJZA 4X3UA 1F9SA 1AE3A 2ZM6L 2XN9C 2PI2A 3D6CA 4QY7A 1J0NA 2FFKB 2P5ZX 1I4GA 3D4WA 4M1UB 3S1NB 1QWYA 1RD9D 3K5OA 4K6LA 2E22A 5A2QL 4X64Q 2OWOA 1IKLA 3I90A 3J7AF 1CKMA 1OXUA 1WCMH 2KQ3A 1SN8A 2V1CC 1BCPF 2J7ZA 3CCSA 4FF1A 3KK7A 1NE3A 1VQMA 4HJ8A 3F1ZA 2Z6BA 1PH9A 4RCOA 5EAYA 2B8GA 2BRPA 2KXSA 1F2LA 3A0JA 2N3SA 3A8KE 1ASZA 1VQ9A 2RQXA 1IZ6A 3HOUB 1I3QH 4NB3A 4D6HA 4BBRH 1MHWC 3MZ5A 5JAVA 1E2WA 1I3QB 1NTGA 4DR7L 1VQKA 3S2DH 1PYWD 4A3CG 1PRTB 3H3VC 4JCVE 3J80c 2MNAA 3NBIA 4D6JA 2BH8A 2UXDL 5C3EB 2CH4W 2K5WA 2UUCQ 4TVAB 1TS2A 5IP9H 2K7VA 1EQQA 4IUTA 1K0SA 2HCIA 1KLGD 1E24A 2HHHL 1U4MA 1V43A 4DR3L 5C44B 1TR5A 2B63H 3M3YH 1CFMA 4OHJA 3PO2H 2JA8H 2JXMB 5IGFA 4ULLA 1II3A 3M3YB 3PO2B 2I5MX 2R92B 2BCOA 2NWGA 3CC2A 1A0IA 3I3CA 5M3MH 2Y0SE 2HCCA 1WTOA 5M3FG 1XNQQ 1GM5A 1TKWB 3KJPA 1RF2D 1WTHA 1ET9A 3BZDB 4IFDI 4NXML 1QVCA 4MTNA 3I70A 5NUCA 1LYLA 4N9TA 1F9GA 2X6LA 4A93G 3B6YA 3AQQA 4BY1G 1Y8OB 1CB8A 3FPPA 5JEAH 1Q7YC 4JG2A 2ES2A 5ELEA 2B2WA 4ZUJA 3G48A 3GD7A 2JA7H 4K0KQ 1HFNA 4LF9L 2KENA 5KIXA 1EYDA 2ZXRA 5JPNC 3NK9A 2UXBQ 1BKBA 4QUFA 1WJJA 1N8RC 1GUSA 1SBBB 2YTVA 1GUOA 2IW3A 1EL0A 3CAMA 3G6EA 3PGZA 4YWMA 5J22A 1KC8C 3CF5A 2XRQD 1HN0A 1BVSA 1FYCA 3CU7A 1Q12A 3J81c 1I6VC 1ILPA 2VNUD 1VQFA 5ELDA 2VUMH 3S1QH 5FO9B 3TP5A 4DV0L 2FJ2A 3CCQA 4Y7NB 4JBMA 1Y1WB 4NXNQ 5IOCA 2ZXOA 1FL0A 3Q8DA 4JBJA 4RCNA 2F0OA 2RVLA 3NTIA 1O80A 4F7XA 1STGA 3C46A 4RKLA 2VZAA 1M8AA 5TSSA 4F8MA 3S2HH 4L8JA 2KVMA 3U50C 4JI1Q 4JI5Q 2WB1E 2NN6I 4D72A 4B3MQ 2X6GA 4GKJL 4DR4L 1RWGA 4A3BG 4A3DB 5FLXc 1NCVA 1Y1VG 3K6OA 2L5TA 1DXMA 1EU3A 3D3RA 4IOCA 2VQFQ 2JEBI 3CW2C 4UHVA 1N34L 1K0RA 4GKKQ 4OIJA 3PF5A 3H0GG 5T1GA 3VDYA 1TWHH 2EYPA 1CT1D 2EY1A 4LF4Q 4CGYB 3A5UA 3S15H 3I7FA 2MP1A 2AWOA 3LGJA 3E9HA 4GOPC 5G3LD 2PPBC 1EIFA 1SYDA 2UU9L 3CXCA 4B9WA 4RGNA 5IYDG 4I7ZC 2A6EC 3F2UA 1TXYA 1IBKQ 3CC7A 1X54A 1STAA 3BZCA 4V0BA 4LF6L 3RR5A 2ZJQA 2WMFA 2IL8A 4A3CH 3NTKA 5COYA 3MFGA 2JE6I 5FLMG 1OJNA 4ZYSA 2G9HD 4R4CA 2F0HA 3ND9A 1C9OA 1RODA 2K28A 2AUKA 4K8JA 4A3IG 1O7YA 1LLRD 2NVQH 3TP7A 4D6GA 3KFUA 3PSIA 4UDUC 4EX5A 1Q81C 3DEPA 1S5FD 4P73A 3DHQA 3N52A 4ME3A 1P16A 2EXZA 5D65A 2F03A 4B9XA 4XYQA 1IKMA 1SJHD 2WDAA 4CKBA 5BR8L 4B3TL 4C2MH 2QEJC 1HR0L 3U7VA 1P8LA 5M3FH 3HOZG 5H1SE 1HNXQ 1Z7TA 4A3LG 4EGVA 1SMYC 1IL8A 1BBXC 5M3FB 2E74C 3TREA 2ASBA 1D5XC 4JI8L 4A93H 3CHBD 3CMAA 4BY1H 1WFQA 4JI7L 3CKIB 4TRDA 4Y52H 5JEAJ 1V1PB 2F3IA 5JJKA 2RCFA 4DV6L 2K32A 1BCPC 1TWAB 5IP7G 1L0WA 2YTYA 3FMCA 2XVSA 4FF3A 1CKOA 3OW2A 2O4XA 2VB2X 3GV3A 4OWWB 3J80i 2A69C 2EJMA 4OXPA 4JW0A 4PNYA 3FHWA 2A19A 2CFMA 4KHZA 3Q22A 4JYAL 2O5IC 4C3IG 1QNUA 3TEHB 1X9NA 1ONLA 1LTTD 1HZCA 4HIOA 3D4DA 1OO9B 1HZBA 4CBVA 1KXLA 2XTIA 4BY7G 3W2DA 1VQ5A 4DV7Q 4D6FA 5IGBA 3S1RH 1A63A 1V1PA 4D1IA 1XMOQ 5EGTA 2WKDA 1LT4D 1N7RA 3HOWG 2PI2E 5M5YH 4HJ9A 4JBWA 4IO9A 1LXKA 2Q2HA 1KRSA 2NYZD 3SDZA 3H3VI 2AQ1B 1N33L 1FGBD 2JA6G 3ERQA 4D6EA 3GTJH 1SAPA 5D14A 3Q24A 1SJED 4L6TB 4NW2A 1BDOA 4A3BH 4RMFA 2F0LA 4CDFC 2Q2IA 1A2UA 1Y1VH 4NP5A 3T16A 2BRWA 4XQNA 1PRTC 3IKJA 3GTGH 2K03A 3LNNA 2PNRC 3L7ZC 2KHJA 3H0GH 1QVGA 3I91A 3T56B 1JOQA 2J4XA 4A3JB 2F52A 1R9TB 1EEID 1EFWA 3H94A 1O7ZA 3MTSA 2Z4IA 3AEVA 4KJOA 2TSSA 3J81i 5IYDH 3KBGA 3TRZA 2BRVX 1X1HA 3C3LA 3K0XA 2KXRA 2E24A 4B3RL 4GNXC 4C3HG 4C3JB 1WTRA 4DKAC 1IBML 5JJIA 4B3SL 3D0FA 4MHEA 1FNVA 1V8QA 1WOCA 2Z6KC 3STBC 5C4JB 1E3PA 5BN3A 5FLMH 1H9MA 1STBA 1KNAA 1PH1A 1CI3M 3G4SA 5DLQE 2JEAI 1N7PA 4UPAA 2B2TA 3JAMc 4DK1A 3WOEA 4A3IH 1NR2A 5C0XG 3E0EA 4BS9A 1TT2A 4K8IA 2OXPA 1SNDA 1I50H 3BYYB 4LFBQ 3WOFA 3HOXG 1LACA 2RBMA 1F2ZA 1JC7A 4KKUA 4JI6L 3WWVA 2EYLA 3R2IA 4YY3L 1HUMA 3MXPA 4CDEC 5A35A 4FXGC 3T1HL 2K14A 3HOZH 4A3GG 2XSCA 4A3LH 3UDXA 4UY8C 4DPGA 1ZKOA 2GN5A 3GO5A 4MNOA 1Q86C 1M1KC 1EYAA 4QGUA 1TY2A 4K2KA 3LWUA 2OQKA 2F4VL 1PH4A 1EYGA 3BZKA 3HGBA 5JVH3 1VS0A 2R7FA 3HKZG 4R8IA 3IFDA 4YIJA 1JE4A 1Q3LA 2LFNA 5IP7H 4JV5Q 1PTOH 4RFBA 2I0QA 1EGUA 2UUBL 3CRLC 1WTVA 1VQPA 1MIUA 3MHBA 2L15A 1HNWL 1PTOB 1GUTA 2SOBA 1WD1A 1J0MA 4F88A 1MJCA 4KJNA 4L5QA 4KN4C 5ELFA 1WVLA 2NTSA 1XNRQ 1Q8KA 4C3IH 2XRSD 3QIAA 1QB5D 2IT1A 1JOKA 3A8IE 1YNND 1SE2A 2GVAA 3TMEA 2MO1A 5I9OA 2F0KA 4BY7H 1ZYRC 4EQ5A 2NZOA 1Z6HA 2A8VA 4DUYL 1PFNA 5FO7B 3DM3A 4BY7B 1UE1A 4J15A 5IIFA 1JE5A 3A54A 3HOWH 3K80C 3S17B 3KLRA 1HA6A 1KAWA 3RMHA 3AB9A 1VQEA 1N7QA 1HPCA 5GROA 3GTLH 2C5CA 1HQRD 2E2IB 4DUZL 1EQVA 2JA6H 1A3UA 3GTQB 4J1MA 1Q1BA 3VR2A 5I6WA 2N8NA 4FDBA 4UAIA 1N32L 1X3EA 1FD7D 3SHLA 5IGEA 1UAPA 1W3YA 1TWGB 1KLUD 1VQ8A 3L9AX 4HMJA 2X03A 1QG7A 4GOPB 4X6AH 2L9HA 2JYOA 2K01A 1PYSB 3C1FA 1HZ9A 3I8ZA 3F2DA 3DMUA 1HRJA 2EYMA 3PIOA 3NPPA 1N36L 3KLWA 3GTOH 1EEFD 2EQSA 2CWPA 2QGQA 2BE5C 1RCVD 1N7NA 4OX9L 4K5WA 2OQ0A 2OTJA 1FVIA 5AJ3L 1EQRA 5EPLA 4C3HH 3MXNB 5EPJA 2HHHQ 3T4AC 3I4NG 1E0BA 1KDAA 3NBHA 4DNIA 5JEAG 1SYGA 3HS0C 1STNA 4LF8L 1SEBD 5FOBB 4O0AA 4UP9A 4ABNA 4L5SA 5C0XH 2PYKA 2QKIC 1X56A 4QMGA 5GADC 3RZOB 4R9WA 2CVRA 4DV1L 1DYQA 1G51A 3HOXH 5CV6A 4GOPA 4FF2A 4A3FB 2A73B 1HHVA 1HCZA 4MIUA 4JI0L 1LTRD 3HP3A 1EY9A 1J6QA 4HTHA 2KBNA 3SE0A 5DNFA 2LS01 3GTKH 2VY3A 1L0XB 3I4MG 2EYJA 4A3GH 3DLLA 3M4YA 4JPBW 2RSNA 4TSSA 3GTKB 1YZ6A 4LF9Q 1X3GA 1X32A 5C4XG 2VQEL 5KGUA 1I94L 4PQXA 3MXNA 1HJPA 1L0YB 3FKIB 5BN4A 3PUVA 1TWFH 3K57A 3VA5A 1Q46A 2JA5B 1UEBA 4DAVA 4G7HC 5LMUL 2K5NA 3HRZC 4BBSB 2Q1FA 2F0NA 1K83H 4XT1B 1XMQL 2R3ZA 1B3AA 1IW7C 1KDCA 1K8AC 1I4PA 3CPWA 2NVTB 4ALPA 1YVCA 1YBYA 5DM63 4YHHQ 1ENFA 2LKVA 1G6ZA 1FJGL 3RZDH 3R3OA 3JAMi 2OT2A 3RZDB 1YHAA 2ZTDA 2YTXA 3AU7A 5CV5A 3K81C 2K5DA 3P75A 2G5DA 2B2TC 5C4ZA 2DJGC 3A56A 3BS1A 1B50A 5C5MA 1WCMB 1DGSA 2R7ZG 2KCTA 4FXDA 1O7IA 1S5BD 4R4QA 3VR5A 4ZLTF 1Q82C 2UXCQ 4H02A 1STYA 2K33A 4WFN3 1C4QA 4DV5L 3W1GA 4RAUC 3URYA 3H91A 2XGTA 4DU9A 1F2MA 5LMNQ 1VQNA 4DK6C 2HUGA 4JI3L 4K5VA 1U4PA 3QR8A 3T1YL 2RF4A 4KD3A 4C1NI 3C2PA 1K28A 4BBRB 2L1BA 2JJQA 3S2DB 2FMMA 2PMZB 3OIQA 4N8X1 5CYUA 1DONA 2D0PA 1Z9FA 4RGTA 5M9OA 3J7YW 3CRKC 2UU9Q 5GQOA 1YIJA 1EQTA 4R4TA 5LHY1 3PIO3 4DNRB 5CBEE 4CDDC 3VR6A 3KLSX 1F77A 2CHBD 2BA0A 1EWCA 2WV6D 3MEFA 4ZAIA 3FDTA 2A6ED 4OIKA 1SYBA 5FKAC 4X62L 1SR3A 4LF6Q 2B63B 1W3SA 4J8QA 2JA8B 2DJFC 2E2DC 4MTKA 4HJAA 1S3OA 3F59A 3NP8A 3CCRA 4DAMA 5IWAL 4IUUA 4GNXB 5I6YA 3PUWA 1VQIA 1XPOA 5M3MB 1UE5A 2KEDA 3U9OA 1CUKA 1F2YA 1PRTF 2EYHA 3HKSA 1B3QA 2F0GA 1HM2A 5EBDA 2K05A 3I4NH 1A15A 2MJ8A 1RL2A 1D5MC 2Z8LA 4RHSA 3F2CA 3I73A 1RDPD 3CQZH 3VYUA 1KHIA 3EFXD 4P71A 5C0XJ 4FYDA 1VQJA 4B3TQ 2DY7A 2JA7B 4A3MG 4KLKA 4FVMA 2JQOA 1WYDA 3PO3G 4QIWB 3L0OA 1IL2A 4IPHA 1QUQB 4PMBA 1OJMA 1SMYD 2E8GA 4JI8Q 1CKNB 3CD6A 3HOYG 1PTOC 1DOMA 2KEEA 5HGTA 4JI7Q 2JN4A 1LT5D 3I4MH 4OO1I 1IYVA 1D6EC 2ZXPA 2M2LA 4NPSA 3SK4A 4DV6Q 1I6HH 3JC66 3BU2A 3ONAB 1SSOA 4KV6A 4GNXA 1HFGA 2ZJPA 2BDOA 5C4XH 2AQ2B 1BCPD 2Z6KA 3UDFA 5C5LA 4ME5A 4WRDA 3S1QB 2VUMB 2JP1A 1I4QA 2R6GA 3ULPA 5IODA 5EPKA 3E0JA 1QILA 3A7LA 1G2SA 3I72A 1OTCA 4QJFA 1SFOH 3VYRA 4DR1Q 3M7NA 3A55A 1QCBD 3NWSA 3OMCA 4FF4A 1A8VA 2A69D 1SFOB 4IUVA 3M4PA 4KI0A 3X3MA 1FNUA 2D62A 4GLAC 1RJTA 3JAME 2HD3A 3CC4A 1N7OA 3S2HB 2F0JA 4P2CB 1QUQA 5M5XH 2NUCA 1CKNA 4BXXG 1I8QA 1OXTA 1PFMA 3VYTA 2CW0C 4A3KG 3KUPA 2EIFA 2K50A 2Y0SG 3PUXA 2H4OA 1X3PA 2XWBB 1RW9A 1EWHA 1QE6A 2R7ZH 5CV4A 1NUCA 1TWHB 1G91A 2EVBA 2KHIA 3Q6SA 5IGDA 1K3RA 2PNHA 3I2ZA 2N55A 3S15B 4JVZA 3OSOA 3KDFB 1S4ZA 4IQZA 4KKSA 1ESFA 1PH3A 1LTLA 1X6OA 2QEXA 2QA4A 1PRTD 2WMIB 1TS4A 1DCZA 5JJLA 2IJ0A 2AWNA 2WMJA 2DGYA 2NVYH 1EUJA 2WACA 3OYYA 5CV7A 2C9OA 3R8BA 3ZYYX 4HIMA 2OTLA 3RNUA 3RLNA 4RA8A 2UUAQ 2HQEA 2NVQB 1C48A 4AQYL 3BDOA 3OW7A 1AZQA 3ULJA 3U58A 1B8AA 2D0OA 3CMEA 1XNQL 1RWCA 1UEAB 3STBD 4LMQD 3KDFA 2B39A 3W5OA 2F3VA 4C2MB 2Z1CA 3A5ZB 3QWNA 4E6IA 1K8MA 1MSGA 3K5LA 3TN2A 2Q8RE 2WMIA 2VL6A 4D71A 1E7ZA 4O2DA 2CCZA 2ZJRA 3KBTC 5CV9A 3M4OH 1GHKA 3TQYA 2QF7A 4AYBE 1Y8NB 4A93B 4BY1B 2WB1G 1DM0B 3FEWX 4CKEA 1SYCA 2PW5A 4JI6Q 1EOTA 3U4VA 4YY3Q 4DGZA 2E2JH 1M90C 2UXBL 4LUOA 2LXJA 4A3MH 1ENAA 1NNXA 2E2JB 3PO3H 2PCFB 4HR7B 1FNWA 4BA2I 1W6KA 1C82A 4A3MB 4DK3C 2R61A 1ASYA 4RGMA 1WTQA 1G2TA 1EOVA 4X66Q 3HOYH 4KD4A 4B08A 4IURA 3I4LA 4XYOA 1OJOA 4G7OC 1GXDC 2F4VQ 1JB7A 3E6ZX 3OTOL 1VCIA 4ZKBB 2LY7A 1GUGA 1TY0A 1JJGA 5E4WC 4PZ7A 2F0FA 2UUBQ 3R93A 2QDBA 1E22A 3DWPA 5IT9c 1HNWQ 2WIIB 2F4IA 1ZEQX 3S1RB 1BNZA 2G9DA 1G6PA 3PIPA 3CP0A 4HSPA 2F0MA 5M5YB 5C6AA 2K6AA 5KNDA 4IFDJ 2B2UC 1CHPD 4JI1L 4JI5L 4B3ML 1O78A 3OOCA 1HNZL 1EIYB 3GTJB 3GP7A 1KQSA 2RSOA 4BXXH 1ZYRD 2VXWA 1SNOA 2VQFL 3NE5B 1SNMA 3O13A 4LF7L 4A3BB 5HURA 4ILWA 1LXMA 3V05A 2EYFA 1Y1VB 4A3KH 4JI2L 1K3BC 4X3SA 1V1OA 1TQOA 2A68C 1M4VA 4LF4L 3GTGB 3CCEA 3H0GB 4IPGA 3S1MH 2SNMA 2IWHA 4LFAQ 2BOSA 1QNKA 4K5XA 1UE6A 1IBLL 1VDZA 1HXYD 4LWCA 1IBKL 2NTTA 1VF7A 1YHBA 3D31A 2MO0A 4D6DA 4Q0FA 3H09A 3PMFA 1PH2A 1C7YA 1HR0W 1VQ6A 3EA6A 4LF5L 1R4PB 2ICIA 2OF1A 1KTKA 1EYCA 1BOSA 2XWJB 3RLFA 4GLXA 2WINB 5C4HA 2FMCA 3D8GA 4Z9CB 3IRBA 4IUPA 1UE7A 4FO2A 1MKHA 2EOTA 2R93G 4H0LC 4A3IB 4CJ1B 3CPFA 3SK8A 1JJCB 2BE5D 2E2HH 5AJ3Q 3K7AH 3H15A 1I50B 3J7AV 4H13C 1YI2A 2PZWA 4IJLA 1EIGA 2L12A 2YU9H 5E1FA 1E2ZA 2V4DA 1HNXL 4KKTA 2FXQA 2SDFA 1L1OB 4LF8Q 1PH6A 4DV3Q 2C35B 3HOZB 4YCUA 4KN7C 3KBUC 2PMZE 2IX1A 5K36G 1JQYD 3MXUA 4DV1Q 2NVXH 3D4RA 3TZDA 1CZWA 1X1IA 1CZGA 1Q1EA 4JI0Q 1V9PA 3Q23A 3GTMH 2KCNA 1CHQD 5M5WH 3HOVG 3J80E 1S40A 1KL9A 4MN3A 2ENBA 2KHSA 2YV5A 1SROA 1FR3A 4DR5Q 1IXRA 2MHVA 3OHXC 1Y8PB 4D8OA 1NY4A 2VQEQ 4HN7A 1I94Q 1S5ED 1K9MC 2LSSA 5AFWA 3EN2A 3AFQA 1YNJD 1JOOA 1XXGA 4H44C 2F0DA 1X3FA 3TP6A 2E75C 4C3IB 4YWLA 4XXEA 5LMUQ 4C56C 3JAML 2H1EA 5CBAE 4PZ6A 5GAHC 1XMQQ 4KMUC 1EZ8A 4DV7L 1B70B 1QZGA 3QOJA 1PH7A 1OJPA 1IW7D 2ZM6Q 3PIP3 3DWAA 3S14H 2KJXA 4QCLA 3D6WA 1D2BA 2L55A 4DFAA 3UDIA 1BR9A 2KCMA 1FJGQ 3AFPA 4QIWE 3HOWB 5KNCA 1D1IA 1PTOF 2EDGA 3GDEA 3UDGA 3AMUA 1YJ9A 3A8JE 3SGIA 3GTLB 1PZKD 1RHPA 2JA6B 4IALA 5BN5A 1ICWA 2L0CA 4XDXA 4R1JA 2NBFA 4Q5VA 1ESRA 3BYTB 3DM1A 4GN3B 2KUMA 1Z47A 3BG3A 3I55A 2H5XA 1J9OA 2KOLA 3HOUG 3MEHA 1XPRA 1JORA 4KY5A 2EYOA 4OWXB 2K5HA 1PV4A 3EVQA 3J81E 2PW7A 1RWAA 3N6RA 2Z9HA 5C3EG 3KLSA 3BJUA 4DR7Q 5I9PA 3KOJA 4K6DA 1NAPA 3NWTA 2UXDQ 5F2DA 1MSHA 1MJEA 3J7ZC 3V96A 3GTOB 1AFPA 2PQEA 1KABA 5K5PA 5C44G 3T51B 1JJ2A 2K1BA 4RKBA 1EY6A 1PLFA 1XTDA 4DR3Q 2E5LL 2DUDA 2N49A 5I4DA 1Q8IA 4C3HB 2R92G 2OEOA 1VQOA 3P1HA 1DZ1A 4X62Q 1MD2D 2CH4A 1SYFA 5FLXE 2PZTA 1I4HA 2RDHA 2R93H 1WTPA 1JMCA 1S5CD 1DOLA 3L3OC 3ERSX 4LFBL 4WJWA 5KRUA 2F0TA 4GN4B 2MPMA 3VR4A 1H9SB 1GUWA 1G291 2K5VA 3LWEA 2B29A 4NXMQ 4AH6A 3TS0A 3HOXB 1TS3A 1NMFA 2NZHA 3GTPH 4OELB 3SK6A 1B53A 3G71A 1XTCD 5IYCG 3NTHA 3TP8A 4HJ7A 4A3GB 2L4NA 3T53B 5K36H 2M9VA 1PDQA 3BVZA 3QJYA 2F0PA 1U4LA 4BWGB 3QOLA 2K4KA 3FP9A 1HUNA 2XNAC 1CSPA 1T9HA 3IFTA 2JSOA 2PO4A 3HOVH 1TWFB 1BF4A 4KHPL 3HKZB 4OWTB 4D6IA 1PTOD 2O2LD 3CCLA 4X3TA 1TWCH 2QW7A 1Y14B 1LM0A 1Y1WG 4IFDG 1K83B 1SE4A 3P20A 1ILQA 1H9SA 4DV0Q 3IAYA 4H7BA 4HCSA 4LJZC 2D5DA 3KF8B 1BBWA 4ZKCB 4ZK9B 1J8IA 4I7AA 1R4QB 4R8NA 3ULLA 4DR6L 1T5EA 2J0TD 2K75A 1D5ZC 5IGGA 1HM3A 4NMZA 3QO2A 4OL7A 1SYEA 1VQBA 3S1NH 1B4OA 1LV9A 2WAQG 4A3DG 1GOZA 5I2YA 4POGA 4IUNA 4G4KA 4XTCS 3KJOA 1ICFB 4D6CA 4GKJQ 2ID0A 2K04A 4DR4Q 2KECA 4IOAA 4OO1G 1PMRA 1U4RA 2XIWA 1RWHA 1PVOA 3CCUA 4JI4L 4N8FA 4PZ8A 1BQQT 1TS5A 1SXTA 1N34Q 3TS2A 2ICEC 2SNSA 2CW0D 3KBXA 4RH6A 1DOKA 1TU2B 4ZRZA 4CJ2C 4DAYB 4JOIC 3M4QA 2HQLA 1S5DD 3KF8A 3BDLA 1MI2A 3HOUH 3NSWA 3IL8A 4FP5D 4AIMA 1C0AA 4LUVA 1OXXK
chains in the Genus database with same CATH topology
2KXSA 4D8OA 4DLOA 3UD1A 3QR8A 4MTKA 3PQIA 3F59A 2P5ZX 3KBUC 2KXRA 3UD2A 3KBTC 4DLQA 4UHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QR8 A;  4MTK A;  3PQI A;  2P5Z X;  4UHV A; 
#chains in the Genus database with same CATH topology
 5E3F A;  1WTX A;  4TKO B;  1KNE A;  5C3E H;  3OWE B;  1CSQ A;  2NN6 G;  2WFW A;  3OIP A;  1XX8 A;  4UP8 A;  1CA5 A;  1X1J A;  5IE8 A;  1MGS A;  2VB3 X;  2Q2T A;  5IT9 E;  4IN3 A;  3UD1 A;  4KY6 A;  2B2U A;  1WTW A;  3ND8 A;  5C44 H;  2ATW A;  3A74 A;  2HT1 A;  4QB4 A;  2EY2 A;  3QB3 A;  4RG1 A;  1B9M A;  4HCE A;  3RUZ A;  3TSS A;  4DV4 L;  1QZH A;  2B3G A;  1L1O C;  1KIX A;  4RWS C;  1J5E L;  2VW9 A;  5LL6 X;  4FXK C;  2R92 H;  2AQ3 B;  4DAY A;  1IHZ A;  2B8F A;  5COR A;  1RKN A;  1AW7 A;  1LTS D;  1U5K A;  2EY6 A;  1LTA D;  5G3L F;  3I4N B;  4AQY Q;  1VQH A;  2RHS B;  1AE2 A;  3EQL C;  3SVM A;  4DA2 A;  1X55 A;  3KYH C;  2I5H A;  5BR8 Q;  2Z0S A;  2BH2 A;  1B1Z A;  1HR0 Q;  3CQZ B;  3MVV A;  3U4Z A;  1S72 A;  1EY4 A;  2IHE A;  4YCV A;  4A75 A;  5DM7 3;  4DN4 M;  3DEO A;  3OMG A;  5ELO A;  4GS3 A;  1T5X D;  1HMW A;  4XT3 B;  4I65 A;  3E3X A;  1HA5 A;  4K14 A;  3NEN A;  3J80 L;  5IYC H;  5HGQ A;  4PG3 A;  1GJX A;  3TZU A;  3I4M B;  4KY7 A;  1I6H B;  1SE8 A;  4DV2 L;  4LFC L;  5ISR A;  4OGQ C;  4PMW A;  2IPK D;  5CMD A;  5EJW A;  4DR2 L;  5C4X B;  1SNC A;  2A6H C;  3ERO A;  3Q0A A;  1PH8 A;  1A3T A;  1LTB D;  3F8T A;  4X65 L;  3S16 H;  3K8A A;  3S16 B;  4JYA Q;  2EJG C;  3OTO Q;  1HZA A;  2MFI A;  4Y7N H;  1I4R A;  1Y1W H;  4IFD H;  4WJ3 M;  1EY8 A;  5GAG C;  4YHH L;  1UWV A;  2F0V A;  1E1O A;  1JR0 D;  1RWF A;  1TVX A;  5EQ0 A;  2F0Q A;  1GO3 E;  1PYB A;  2F1M A;  2GA4 B;  1PXU A;  3AYH B;  4X64 L;  2RDF A;  5M5X B;  1RTN A;  4J6H A;  2Q8I B;  2IX3 A;  5DEH A;  2SEB D;  4ZQ3 A;  1QVF A;  1HH2 P;  2RCN A;  3MFY A;  1F1S A;  3X3N A;  2EZV A;  2DNE A;  3PCO B;  1VF5 C;  1N33 Q;  1HTP A;  3F2B A;  4A3D H;  4V19 0;  2F0U A;  4GN5 A;  4JK1 C;  2UXC L;  4FNF A;  4DXG A;  1Y69 U;  2WAQ B;  2EXD A;  1HNZ Q;  4CHT B;  2R7Z B;  4OON A;  3NEM A;  4OO1 H;  2CWA A;  5LMN L;  4LF7 Q;  1QJO A;  1MBY A;  4A3J G;  3NHH A;  1FGU A;  2WMK A;  3PUY A;  1XJV A;  4JI2 Q;  5CR3 A;  3J81 L;  4EQP A;  2WCO A;  1O7L A;  2K52 A;  3K0Y A;  3RD4 A;  1YIT A;  2A68 D;  4KTA A;  2UUC L;  3M9B A;  4DNT B;  4UP7 A;  2X69 A;  1EY5 A;  2EE1 A;  1XPU A;  4HMI A;  1CK1 A;  4LW1 A;  4HJ5 A;  2IY5 B;  1YEZ A;  1AEX A;  5JPM C;  1IBL Q;  1PH5 A;  2NVY B;  3NQI A;  1U9R A;  3FVQ A;  4C3J G;  2NZ1 D;  1VMC A;  3V2T A;  2NN6 H;  2F0E A;  3GQB A;  3DXJ C;  3SR1 A;  4B3R Q;  1IBM Q;  4LF5 Q;  4G7Z C;  4B3S Q;  4F87 A;  4X3K A;  5HY6 A;  1G8Z D;  1JB3 A;  5FLX L;  2JA9 A;  1K73 C;  4HED A;  4JBK A;  5D3I B;  5IYB G;  1VMP A;  3UD2 A;  1X65 A;  5FJ8 G;  3K7U C;  3FRP B;  1OXV A;  4O1N A;  2B2V A;  4NDX A;  3J81 j;  1XYI A;  3RN5 A;  1LAB A;  4K0K L;  4IZ8 A;  3R2T A;  3M4O B;  1NJI C;  2F3W A;  2NB0 A;  5L37 A;  1JIC A;  5ELN A;  1VQD A;  4A3E G;  1X3Q A;  2AMC B;  4P75 A;  3T1H Q;  3SXH A;  4QUC A;  2EPB A;  1HQM C;  2QDL A;  2DY8 A;  4QL5 A;  2WMG A;  3PO3 B;  3KF6 B;  1E1T A;  3M7G A;  3NXW A;  1TWA H;  4KHV A;  2A5H A;  1STH A;  4QQB X;  4LUZ A;  3VA7 A;  3HOY B;  3VR3 A;  1GKH A;  1LT6 D;  2MUY A;  2ZT9 C;  4L63 B;  4PMC A;  4KK7 A;  2DN8 A;  4IPC A;  4NXN L;  3E5S A;  2B2Y A;  3NQT A;  4N9P A;  5EKL A;  2L11 A;  4DR1 L;  1CA6 A;  3I4O A;  1UUP A;  2ZTC A;  2MGS A;  1JWS D;  2HDM A;  2A1A A;  3HG9 A;  3MC0 B;  4RHR A;  2WKC A;  3OPO A;  3WDN A;  5FO8 B;  1AN8 A;  5J1Z A;  1B9N A;  5LMN W;  5FK9 C;  1AP0 A;  1SNQ A;  3KF6 A;  4DUY Q;  4GZY C;  5KNB A;  1L2F A;  4GKK L;  3ITP A;  3PF4 A;  4DLQ A;  1ET6 A;  2ALY B;  5A2Q E;  3FPU B;  1AH9 A;  4A3K B;  3S24 A;  1QOH A;  3U9S A;  4DUZ Q;  3SEB A;  5I2X A;  3MXG A;  1WI5 A;  1W6J A;  2Y0S B;  1CQF A;  3UE0 A;  1JWM D;  1D8L A;  3GV6 A;  3HKZ E;  3NEL A;  3S1M B;  3EIV A;  4HIK A;  3K5N A;  1N32 Q;  1YJN A;  4APV A;  2GVB A;  4ZUI A;  4AYB G;  2B2W C;  4A3J H;  4LK1 C;  3M85 A;  4HAE A;  4YCW A;  4PV1 C;  3CCJ A;  1R9T H;  1H9R A;  1I4X A;  2D2C C;  1STE A;  3CCV A;  4XIG S;  4XQQ A;  4QF4 A;  1A6X A;  1F9P A;  1VQL A;  1YHQ A;  2ZTE A;  2I07 B;  2WP8 J;  4GLV B;  3VYS A;  4DF7 A;  2F0S A;  5IT9 L;  2DNC A;  2KA7 A;  2E76 C;  1N36 Q;  5CGK A;  3H3V H;  3BVM A;  1GUN A;  4C3J H;  2LMC B;  2UUA L;  4M8A A;  4OX9 Q;  2MQH A;  4A76 A;  5C4J H;  3EBE A;  3UI2 A;  1F9R A;  4HID A;  2CQO A;  4CJ0 B;  4EVO A;  5KYI A;  4IUQ A;  4WOR A;  3A7A B;  3J7A 5;  3I56 A;  4P74 A;  4U68 A;  2E5L Q;  1SDF A;  2E2H B;  4DK0 A;  3K7A B;  1BBU A;  2BA1 A;  2JK8 A;  2LXK A;  2CQA A;  1XWE A;  1LTG D;  2YU9 B;  4EQN A;  4BA1 I;  5IYB H;  1EZ6 A;  5FJ8 H;  1OXS C;  3EJI A;  4A3F G;  3K58 A;  4JOI A;  4IJH A;  3DUZ A;  2OCE A;  1JWU D;  4K2L A;  1VQA A;  4ZCK A;  2NVX B;  4R4O A;  1YNX A;  4C1N K;  1PFS A;  1BXT A;  4DAP A;  2WB1 B;  2FHT A;  4YWK A;  5J3B A;  2A74 C;  4WJ4 A;  4A3E H;  3GTM B;  2Q8T A;  1VQ4 A;  1EY0 A;  1SLJ A;  2QIL A;  1LT3 D;  5M5W B;  3E9I A;  4A3E B;  4X66 L;  1EU4 A;  4EQO A;  3FKI G;  5E4X A;  1PHJ A;  2YYZ A;  1ENC A;  3CCM A;  2JA5 G;  1SRU A;  3HEJ A;  1PA6 A;  1CQV A;  3BVG A;  4POF A;  4BBS G;  1H9K A;  5D3D A;  1CTM A;  3MA2 B;  1K8G A;  4XQJ A;  2RKS A;  5KEE A;  1L1O A;  1WD0 A;  4KHP Q;  1RTO A;  3BDC A;  1E2V A;  1NSN S;  1KD1 C;  1A62 A;  4ID6 A;  1B44 D;  1U0L A;  1EY7 A;  2VS1 A;  1XMO L;  2IHF A;  3OWF A;  4MZ9 A;  2D9U A;  3PUZ A;  5GAE C;  1EIH A;  2I5L X;  4CDC C;  2N88 A;  4IPD A;  3S14 B;  1RIP A;  3DWQ A;  1VQG A;  1Q90 A;  5E7N A;  1GHJ A;  1D1K A;  1WCM G;  4HSV A;  2KCC A;  4DR6 Q;  1W2B A;  5IGC A;  4ODG A;  3S17 H;  3H6M A;  3P7J A;  1EWI A;  3W3A A;  3PQI A;  3ER0 A;  2B2V C;  1KRT A;  1H9J A;  3TBI B;  1CM9 A;  2AKW B;  5LL6 S;  3G7L A;  2E2I H;  1YJW A;  4S3S A;  3GTQ H;  5C0X I;  1HTL D;  3MAQ A;  3LX0 A;  4DV5 Q;  2EY5 A;  4JI4 Q;  1JCK B;  5JOB A;  4OEM B;  4BBR G;  4DLO A;  2WMH A;  4LFA L;  1GD7 A;  1B7Y B;  5EBC A;  5ELB A;  2Q2U A;  3NBH B;  2PZU A;  2HDL A;  4JI3 Q;  1B2T A;  3T1Y Q;  2TMP A;  1TWG H;  1NR4 A;  2EJF C;  1LUZ A;  1BO0 A;  2F0W A;  1F9Q A;  5IP9 G;  4AYB B;  4U67 3;  2BDN A;  1AZP A;  2HIX A;  5C3W A;  3ICE A;  1LOH A;  1A2T A;  4O42 A;  2M00 A;  5CC4 A;  4DXF A;  1TII D;  5JVG 3;  1D7Q A;  3MWY W;  1KAA A;  1PZJ D;  2RHQ B;  3NUC A;  2B63 G;  3SK5 A;  3PO2 G;  2B2Y C;  1SMX A;  5EKK A;  1KDB A;  3K5M A;  3K59 A;  4CKC A;  2JA8 G;  2RDG A;  1PFB A;  3PV0 A;  4R4I A;  3ZJY C;  1SNP A;  1UNS A;  1V1Q A;  1EFI D;  1LTI D;  2RA4 A;  1DD2 A;  5IWA Q;  5M3M G;  4LNQ A;  1H95 A;  1DJR D;  5DAU A;  1N9W A;  1A3V A;  2WAQ E;  1C8C A;  4NKL A;  3S9W A;  2R93 B;  1JT8 A;  1SE3 A;  4TQU S;  2QCP X;  4LAA A;  5T1I A;  2IX0 A;  4DV4 Q;  5KYL A;  1J5E Q;  3TDQ A;  2CKZ B;  1K8O A;  2PQA B;  4G57 A;  3HZX A;  1ZXT A;  2Z4H A;  3RZO H;  4DV3 L;  3C1E A;  2JA7 G;  1PZI D;  2N78 A;  5J39 A;  3GTP B;  2I46 A;  3G6J B;  4A3F H;  4JC0 A;  3RLO A;  1I5F A;  5IY0 A;  1ML0 D;  4L5R C;  4L5T A;  5C3X A;  3RN2 A;  5ELC A;  3L2P A;  1IYJ B;  4JV5 L;  2AHO B;  4DR5 L;  1VQ7 A;  3HOV B;  1BUV T;  2AUJ D;  2VUM G;  4RGO S;  1IYU A;  2F0I A;  2R7D A;  5EKI A;  4D1J A;  1NMG A;  3FKI H;  4P72 A;  2O5J C;  3T13 A;  3QG1 A;  1TWC B;  2FIN B;  1YNJ C;  3W1B A;  1XNR L;  3UE1 A;  4A4I A;  4DV2 Q;  2JA5 H;  4LFC Q;  1BCP B;  2HIV A;  2K5Q A;  1YNN C;  4DR2 Q;  1GVP A;  4BBS H;  1NBW A;  2PQA A;  4X65 Q;  2A6H D;  1LO5 D;  5CV8 A;  2NVT H;  1VQC A;  1HMU A;  3HFZ B;  5JJZ A;  4X3U A;  1F9S A;  1AE3 A;  2ZM6 L;  2XN9 C;  2PI2 A;  3D6C A;  4QY7 A;  1J0N A;  2FFK B;  2P5Z X;  1I4G A;  3D4W A;  4M1U B;  3S1N B;  1QWY A;  1RD9 D;  3K5O A;  4K6L A;  2E22 A;  5A2Q L;  4X64 Q;  2OWO A;  1IKL A;  3I90 A;  3J7A F;  1CKM A;  1OXU A;  1WCM H;  2KQ3 A;  1SN8 A;  2V1C C;  1BCP F;  2J7Z A;  3CCS A;  4FF1 A;  3KK7 A;  1NE3 A;  1VQM A;  4HJ8 A;  3F1Z A;  2Z6B A;  1PH9 A;  4RCO A;  5EAY A;  2B8G A;  2BRP A;  2KXS A;  1F2L A;  3A0J A;  2N3S A;  3A8K E;  1ASZ A;  1VQ9 A;  2RQX A;  1IZ6 A;  3HOU B;  1I3Q H;  4NB3 A;  4D6H A;  4BBR H;  1MHW C;  3MZ5 A;  5JAV A;  1E2W A;  1I3Q B;  1NTG A;  4DR7 L;  1VQK A;  3S2D H;  1PYW D;  4A3C G;  1PRT B;  3H3V C;  4JCV E;  3J80 c;  2MNA A;  3NBI A;  4D6J A;  2BH8 A;  2UXD L;  5C3E B;  2CH4 W;  2K5W A;  2UUC Q;  4TVA B;  1TS2 A;  5IP9 H;  2K7V A;  1EQQ A;  4IUT A;  1K0S A;  2HCI A;  1KLG D;  1E24 A;  2HHH L;  1U4M A;  1V43 A;  4DR3 L;  5C44 B;  1TR5 A;  2B63 H;  3M3Y H;  1CFM A;  4OHJ A;  3PO2 H;  2JA8 H;  2JXM B;  5IGF A;  4ULL A;  1II3 A;  3M3Y B;  3PO2 B;  2I5M X;  2R92 B;  2BCO A;  2NWG A;  3CC2 A;  1A0I A;  3I3C A;  5M3M H;  2Y0S E;  2HCC A;  1WTO A;  5M3F G;  1XNQ Q;  1GM5 A;  1TKW B;  3KJP A;  1RF2 D;  1WTH A;  1ET9 A;  3BZD B;  4IFD I;  4NXM L;  1QVC A;  4MTN A;  3I70 A;  5NUC A;  1LYL A;  4N9T A;  1F9G A;  2X6L A;  4A93 G;  3B6Y A;  3AQQ A;  4BY1 G;  1Y8O B;  1CB8 A;  3FPP A;  5JEA H;  1Q7Y C;  4JG2 A;  2ES2 A;  5ELE A;  2B2W A;  4ZUJ A;  3G48 A;  3GD7 A;  2JA7 H;  4K0K Q;  1HFN A;  4LF9 L;  2KEN A;  5KIX A;  1EYD A;  2ZXR A;  5JPN C;  3NK9 A;  2UXB Q;  1BKB A;  4QUF A;  1WJJ A;  1N8R C;  1GUS A;  1SBB B;  2YTV A;  1GUO A;  2IW3 A;  1EL0 A;  3CAM A;  3G6E A;  3PGZ A;  4YWM A;  5J22 A;  1KC8 C;  3CF5 A;  2XRQ D;  1HN0 A;  1BVS A;  1FYC A;  3CU7 A;  1Q12 A;  3J81 c;  1I6V C;  1ILP A;  2VNU D;  1VQF A;  5ELD A;  2VUM H;  3S1Q H;  5FO9 B;  3TP5 A;  4DV0 L;  2FJ2 A;  3CCQ A;  4Y7N B;  4JBM A;  1Y1W B;  4NXN Q;  5IOC A;  2ZXO A;  1FL0 A;  3Q8D A;  4JBJ A;  4RCN A;  2F0O A;  2RVL A;  3NTI A;  1O80 A;  4F7X A;  1STG A;  3C46 A;  4RKL A;  2VZA A;  1M8A A;  5TSS A;  4F8M A;  3S2H H;  4L8J A;  2KVM A;  3U50 C;  4JI1 Q;  4JI5 Q;  2WB1 E;  2NN6 I;  4D72 A;  4B3M Q;  2X6G A;  4GKJ L;  4DR4 L;  1RWG A;  4A3B G;  4A3D B;  5FLX c;  1NCV A;  1Y1V G;  3K6O A;  2L5T A;  1DXM A;  1EU3 A;  3D3R A;  4IOC A;  2VQF Q;  2JEB I;  3CW2 C;  4UHV A;  1N34 L;  1K0R A;  4GKK Q;  4OIJ A;  3PF5 A;  3H0G G;  5T1G A;  3VDY A;  1TWH H;  2EYP A;  1CT1 D;  2EY1 A;  4LF4 Q;  4CGY B;  3A5U A;  3S15 H;  3I7F A;  2MP1 A;  2AWO A;  3LGJ A;  3E9H A;  4GOP C;  5G3L D;  2PPB C;  1EIF A;  1SYD A;  2UU9 L;  3CXC A;  4B9W A;  4RGN A;  5IYD G;  4I7Z C;  2A6E C;  3F2U A;  1TXY A;  1IBK Q;  3CC7 A;  1X54 A;  1STA A;  3BZC A;  4V0B A;  4LF6 L;  3RR5 A;  2ZJQ A;  2WMF A;  2IL8 A;  4A3C H;  3NTK A;  5COY A;  3MFG A;  2JE6 I;  5FLM G;  1OJN A;  4ZYS A;  2G9H D;  4R4C A;  2F0H A;  3ND9 A;  1C9O A;  1ROD A;  2K28 A;  2AUK A;  4K8J A;  4A3I G;  1O7Y A;  1LLR D;  2NVQ H;  3TP7 A;  4D6G A;  3KFU A;  3PSI A;  4UDU C;  4EX5 A;  1Q81 C;  3DEP A;  1S5F D;  4P73 A;  3DHQ A;  3N52 A;  4ME3 A;  1P16 A;  2EXZ A;  5D65 A;  2F03 A;  4B9X A;  4XYQ A;  1IKM A;  1SJH D;  2WDA A;  4CKB A;  5BR8 L;  4B3T L;  4C2M H;  2QEJ C;  1HR0 L;  3U7V A;  1P8L A;  5M3F H;  3HOZ G;  5H1S E;  1HNX Q;  1Z7T A;  4A3L G;  4EGV A;  1SMY C;  1IL8 A;  1BBX C;  5M3F B;  2E74 C;  3TRE A;  2ASB A;  1D5X C;  4JI8 L;  4A93 H;  3CHB D;  3CMA A;  4BY1 H;  1WFQ A;  4JI7 L;  3CKI B;  4TRD A;  4Y52 H;  5JEA J;  1V1P B;  2F3I A;  5JJK A;  2RCF A;  4DV6 L;  2K32 A;  1BCP C;  1TWA B;  5IP7 G;  1L0W A;  2YTY A;  3FMC A;  2XVS A;  4FF3 A;  1CKO A;  3OW2 A;  2O4X A;  2VB2 X;  3GV3 A;  4OWW B;  3J80 i;  2A69 C;  2EJM A;  4OXP A;  4JW0 A;  4PNY A;  3FHW A;  2A19 A;  2CFM A;  4KHZ A;  3Q22 A;  4JYA L;  2O5I C;  4C3I G;  1QNU A;  3TEH B;  1X9N A;  1ONL A;  1LTT D;  1HZC A;  4HIO A;  3D4D A;  1OO9 B;  1HZB A;  4CBV A;  1KXL A;  2XTI A;  4BY7 G;  3W2D A;  1VQ5 A;  4DV7 Q;  4D6F A;  5IGB A;  3S1R H;  1A63 A;  1V1P A;  4D1I A;  1XMO Q;  5EGT A;  2WKD A;  1LT4 D;  1N7R A;  3HOW G;  2PI2 E;  5M5Y H;  4HJ9 A;  4JBW A;  4IO9 A;  1LXK A;  2Q2H A;  1KRS A;  2NYZ D;  3SDZ A;  3H3V I;  2AQ1 B;  1N33 L;  1FGB D;  2JA6 G;  3ERQ A;  4D6E A;  3GTJ H;  1SAP A;  5D14 A;  3Q24 A;  1SJE D;  4L6T B;  4NW2 A;  1BDO A;  4A3B H;  4RMF A;  2F0L A;  4CDF C;  2Q2I A;  1A2U A;  1Y1V H;  4NP5 A;  3T16 A;  2BRW A;  4XQN A;  1PRT C;  3IKJ A;  3GTG H;  2K03 A;  3LNN A;  2PNR C;  3L7Z C;  2KHJ A;  3H0G H;  1QVG A;  3I91 A;  3T56 B;  1JOQ A;  2J4X A;  4A3J B;  2F52 A;  1R9T B;  1EEI D;  1EFW A;  3H94 A;  1O7Z A;  3MTS A;  2Z4I A;  3AEV A;  4KJO A;  2TSS A;  3J81 i;  5IYD H;  3KBG A;  3TRZ A;  2BRV X;  1X1H A;  3C3L A;  3K0X A;  2KXR A;  2E24 A;  4B3R L;  4GNX C;  4C3H G;  4C3J B;  1WTR A;  4DKA C;  1IBM L;  5JJI A;  4B3S L;  3D0F A;  4MHE A;  1FNV A;  1V8Q A;  1WOC A;  2Z6K C;  3STB C;  5C4J B;  1E3P A;  5BN3 A;  5FLM H;  1H9M A;  1STB A;  1KNA A;  1PH1 A;  1CI3 M;  3G4S A;  5DLQ E;  2JEA I;  1N7P A;  4UPA A;  2B2T A;  3JAM c;  4DK1 A;  3WOE A;  4A3I H;  1NR2 A;  5C0X G;  3E0E A;  4BS9 A;  1TT2 A;  4K8I A;  2OXP A;  1SND A;  1I50 H;  3BYY B;  4LFB Q;  3WOF A;  3HOX G;  1LAC A;  2RBM A;  1F2Z A;  1JC7 A;  4KKU A;  4JI6 L;  3WWV A;  2EYL A;  3R2I A;  4YY3 L;  1HUM A;  3MXP A;  4CDE C;  5A35 A;  4FXG C;  3T1H L;  2K14 A;  3HOZ H;  4A3G G;  2XSC A;  4A3L H;  3UDX A;  4UY8 C;  4DPG A;  1ZKO A;  2GN5 A;  3GO5 A;  4MNO A;  1Q86 C;  1M1K C;  1EYA A;  4QGU A;  1TY2 A;  4K2K A;  3LWU A;  2OQK A;  2F4V L;  1PH4 A;  1EYG A;  3BZK A;  3HGB A;  5JVH 3;  1VS0 A;  2R7F A;  3HKZ G;  4R8I A;  3IFD A;  4YIJ A;  1JE4 A;  1Q3L A;  2LFN A;  5IP7 H;  4JV5 Q;  1PTO H;  4RFB A;  2I0Q A;  1EGU A;  2UUB L;  3CRL C;  1WTV A;  1VQP A;  1MIU A;  3MHB A;  2L15 A;  1HNW L;  1PTO B;  1GUT A;  2SOB A;  1WD1 A;  1J0M A;  4F88 A;  1MJC A;  4KJN A;  4L5Q A;  4KN4 C;  5ELF A;  1WVL A;  2NTS A;  1XNR Q;  1Q8K A;  4C3I H;  2XRS D;  3QIA A;  1QB5 D;  2IT1 A;  1JOK A;  3A8I E;  1YNN D;  1SE2 A;  2GVA A;  3TME A;  2MO1 A;  5I9O A;  2F0K A;  4BY7 H;  1ZYR C;  4EQ5 A;  2NZO A;  1Z6H A;  2A8V A;  4DUY L;  1PFN A;  5FO7 B;  3DM3 A;  4BY7 B;  1UE1 A;  4J15 A;  5IIF A;  1JE5 A;  3A54 A;  3HOW H;  3K80 C;  3S17 B;  3KLR A;  1HA6 A;  1KAW A;  3RMH A;  3AB9 A;  1VQE A;  1N7Q A;  1HPC A;  5GRO A;  3GTL H;  2C5C A;  1HQR D;  2E2I B;  4DUZ L;  1EQV A;  2JA6 H;  1A3U A;  3GTQ B;  4J1M A;  1Q1B A;  3VR2 A;  5I6W A;  2N8N A;  4FDB A;  4UAI A;  1N32 L;  1X3E A;  1FD7 D;  3SHL A;  5IGE A;  1UAP A;  1W3Y A;  1TWG B;  1KLU D;  1VQ8 A;  3L9A X;  4HMJ A;  2X03 A;  1QG7 A;  4GOP B;  4X6A H;  2L9H A;  2JYO A;  2K01 A;  1PYS B;  3C1F A;  1HZ9 A;  3I8Z A;  3F2D A;  3DMU A;  1HRJ A;  2EYM A;  3PIO A;  3NPP A;  1N36 L;  3KLW A;  3GTO H;  1EEF D;  2EQS A;  2CWP A;  2QGQ A;  2BE5 C;  1RCV D;  1N7N A;  4OX9 L;  4K5W A;  2OQ0 A;  2OTJ A;  1FVI A;  5AJ3 L;  1EQR A;  5EPL A;  4C3H H;  3MXN B;  5EPJ A;  2HHH Q;  3T4A C;  3I4N G;  1E0B A;  1KDA A;  3NBH A;  4DNI A;  5JEA G;  1SYG A;  3HS0 C;  1STN A;  4LF8 L;  1SEB D;  5FOB B;  4O0A A;  4UP9 A;  4ABN A;  4L5S A;  5C0X H;  2PYK A;  2QKI C;  1X56 A;  4QMG A;  5GAD C;  3RZO B;  4R9W A;  2CVR A;  4DV1 L;  1DYQ A;  1G51 A;  3HOX H;  5CV6 A;  4GOP A;  4FF2 A;  4A3F B;  2A73 B;  1HHV A;  1HCZ A;  4MIU A;  4JI0 L;  1LTR D;  3HP3 A;  1EY9 A;  1J6Q A;  4HTH A;  2KBN A;  3SE0 A;  5DNF A;  2LS0 1;  3GTK H;  2VY3 A;  1L0X B;  3I4M G;  2EYJ A;  4A3G H;  3DLL A;  3M4Y A;  4JPB W;  2RSN A;  4TSS A;  3GTK B;  1YZ6 A;  4LF9 Q;  1X3G A;  1X32 A;  5C4X G;  2VQE L;  5KGU A;  1I94 L;  4PQX A;  3MXN A;  1HJP A;  1L0Y B;  3FKI B;  5BN4 A;  3PUV A;  1TWF H;  3K57 A;  3VA5 A;  1Q46 A;  2JA5 B;  1UEB A;  4DAV A;  4G7H C;  5LMU L;  2K5N A;  3HRZ C;  4BBS B;  2Q1F A;  2F0N A;  1K83 H;  4XT1 B;  1XMQ L;  2R3Z A;  1B3A A;  1IW7 C;  1KDC A;  1K8A C;  1I4P A;  3CPW A;  2NVT B;  4ALP A;  1YVC A;  1YBY A;  5DM6 3;  4YHH Q;  1ENF A;  2LKV A;  1G6Z A;  1FJG L;  3RZD H;  3R3O A;  3JAM i;  2OT2 A;  3RZD B;  1YHA A;  2ZTD A;  2YTX A;  3AU7 A;  5CV5 A;  3K81 C;  2K5D A;  3P75 A;  2G5D A;  2B2T C;  5C4Z A;  2DJG C;  3A56 A;  3BS1 A;  1B50 A;  5C5M A;  1WCM B;  1DGS A;  2R7Z G;  2KCT A;  4FXD A;  1O7I A;  1S5B D;  4R4Q A;  3VR5 A;  4ZLT F;  1Q82 C;  2UXC Q;  4H02 A;  1STY A;  2K33 A;  4WFN 3;  1C4Q A;  4DV5 L;  3W1G A;  4RAU C;  3URY A;  3H91 A;  2XGT A;  4DU9 A;  1F2M A;  5LMN Q;  1VQN A;  4DK6 C;  2HUG A;  4JI3 L;  4K5V A;  1U4P A;  3QR8 A;  3T1Y L;  2RF4 A;  4KD3 A;  4C1N I;  3C2P A;  1K28 A;  4BBR B;  2L1B A;  2JJQ A;  3S2D B;  2FMM A;  2PMZ B;  3OIQ A;  4N8X 1;  5CYU A;  1DON A;  2D0P A;  1Z9F A;  4RGT A;  5M9O A;  3J7Y W;  3CRK C;  2UU9 Q;  5GQO A;  1YIJ A;  1EQT A;  4R4T A;  5LHY 1;  3PIO 3;  4DNR B;  5CBE E;  4CDD C;  3VR6 A;  3KLS X;  1F77 A;  2CHB D;  2BA0 A;  1EWC A;  2WV6 D;  3MEF A;  4ZAI A;  3FDT A;  2A6E D;  4OIK A;  1SYB A;  5FKA C;  4X62 L;  1SR3 A;  4LF6 Q;  2B63 B;  1W3S A;  4J8Q A;  2JA8 B;  2DJF C;  2E2D C;  4MTK A;  4HJA A;  1S3O A;  3F59 A;  3NP8 A;  3CCR A;  4DAM A;  5IWA L;  4IUU A;  4GNX B;  5I6Y A;  3PUW A;  1VQI A;  1XPO A;  5M3M B;  1UE5 A;  2KED A;  3U9O A;  1CUK A;  1F2Y A;  1PRT F;  2EYH A;  3HKS A;  1B3Q A;  2F0G A;  1HM2 A;  5EBD A;  2K05 A;  3I4N H;  1A15 A;  2MJ8 A;  1RL2 A;  1D5M C;  2Z8L A;  4RHS A;  3F2C A;  3I73 A;  1RDP D;  3CQZ H;  3VYU A;  1KHI A;  3EFX D;  4P71 A;  5C0X J;  4FYD A;  1VQJ A;  4B3T Q;  2DY7 A;  2JA7 B;  4A3M G;  4KLK A;  4FVM A;  2JQO A;  1WYD A;  3PO3 G;  4QIW B;  3L0O A;  1IL2 A;  4IPH A;  1QUQ B;  4PMB A;  1OJM A;  1SMY D;  2E8G A;  4JI8 Q;  1CKN B;  3CD6 A;  3HOY G;  1PTO C;  1DOM A;  2KEE A;  5HGT A;  4JI7 Q;  2JN4 A;  1LT5 D;  3I4M H;  4OO1 I;  1IYV A;  1D6E C;  2ZXP A;  2M2L A;  4NPS A;  3SK4 A;  4DV6 Q;  1I6H H;  3JC6 6;  3BU2 A;  3ONA B;  1SSO A;  4KV6 A;  4GNX A;  1HFG A;  2ZJP A;  2BDO A;  5C4X H;  2AQ2 B;  1BCP D;  2Z6K A;  3UDF A;  5C5L A;  4ME5 A;  4WRD A;  3S1Q B;  2VUM B;  2JP1 A;  1I4Q A;  2R6G A;  3ULP A;  5IOD A;  5EPK A;  3E0J A;  1QIL A;  3A7L A;  1G2S A;  3I72 A;  1OTC A;  4QJF A;  1SFO H;  3VYR A;  4DR1 Q;  3M7N A;  3A55 A;  1QCB D;  3NWS A;  3OMC A;  4FF4 A;  1A8V A;  2A69 D;  1SFO B;  4IUV A;  3M4P A;  4KI0 A;  3X3M A;  1FNU A;  2D62 A;  4GLA C;  1RJT A;  3JAM E;  2HD3 A;  3CC4 A;  1N7O A;  3S2H B;  2F0J A;  4P2C B;  1QUQ A;  5M5X H;  2NUC A;  1CKN A;  4BXX G;  1I8Q A;  1OXT A;  1PFM A;  3VYT A;  2CW0 C;  4A3K G;  3KUP A;  2EIF A;  2K50 A;  2Y0S G;  3PUX A;  2H4O A;  1X3P A;  2XWB B;  1RW9 A;  1EWH A;  1QE6 A;  2R7Z H;  5CV4 A;  1NUC A;  1TWH B;  1G91 A;  2EVB A;  2KHI A;  3Q6S A;  5IGD A;  1K3R A;  2PNH A;  3I2Z A;  2N55 A;  3S15 B;  4JVZ A;  3OSO A;  3KDF B;  1S4Z A;  4IQZ A;  4KKS A;  1ESF A;  1PH3 A;  1LTL A;  1X6O A;  2QEX A;  2QA4 A;  1PRT D;  2WMI B;  1TS4 A;  1DCZ A;  5JJL A;  2IJ0 A;  2AWN A;  2WMJ A;  2DGY A;  2NVY H;  1EUJ A;  2WAC A;  3OYY A;  5CV7 A;  2C9O A;  3R8B A;  3ZYY X;  4HIM A;  2OTL A;  3RNU A;  3RLN A;  4RA8 A;  2UUA Q;  2HQE A;  2NVQ B;  1C48 A;  4AQY L;  3BDO A;  3OW7 A;  1AZQ A;  3ULJ A;  3U58 A;  1B8A A;  2D0O A;  3CME A;  1XNQ L;  1RWC A;  1UEA B;  3STB D;  4LMQ D;  3KDF A;  2B39 A;  3W5O A;  2F3V A;  4C2M B;  2Z1C A;  3A5Z B;  3QWN A;  4E6I A;  1K8M A;  1MSG A;  3K5L A;  3TN2 A;  2Q8R E;  2WMI A;  2VL6 A;  4D71 A;  1E7Z A;  4O2D A;  2CCZ A;  2ZJR A;  3KBT C;  5CV9 A;  3M4O H;  1GHK A;  3TQY A;  2QF7 A;  4AYB E;  1Y8N B;  4A93 B;  4BY1 B;  2WB1 G;  1DM0 B;  3FEW X;  4CKE A;  1SYC A;  2PW5 A;  4JI6 Q;  1EOT A;  3U4V A;  4YY3 Q;  4DGZ A;  2E2J H;  1M90 C;  2UXB L;  4LUO A;  2LXJ A;  4A3M H;  1ENA A;  1NNX A;  2E2J B;  3PO3 H;  2PCF B;  4HR7 B;  1FNW A;  4BA2 I;  1W6K A;  1C82 A;  4A3M B;  4DK3 C;  2R61 A;  1ASY A;  4RGM A;  1WTQ A;  1G2T A;  1EOV A;  4X66 Q;  3HOY H;  4KD4 A;  4B08 A;  4IUR A;  3I4L A;  4XYO A;  1OJO A;  4G7O C;  1GXD C;  2F4V Q;  1JB7 A;  3E6Z X;  3OTO L;  1VCI A;  4ZKB B;  2LY7 A;  1GUG A;  1TY0 A;  1JJG A;  5E4W C;  4PZ7 A;  2F0F A;  2UUB Q;  3R93 A;  2QDB A;  1E22 A;  3DWP A;  5IT9 c;  1HNW Q;  2WII B;  2F4I A;  1ZEQ X;  3S1R B;  1BNZ A;  2G9D A;  1G6P A;  3PIP A;  3CP0 A;  4HSP A;  2F0M A;  5M5Y B;  5C6A A;  2K6A A;  5KND A;  4IFD J;  2B2U C;  1CHP D;  4JI1 L;  4JI5 L;  4B3M L;  1O78 A;  3OOC A;  1HNZ L;  1EIY B;  3GTJ B;  3GP7 A;  1KQS A;  2RSO A;  4BXX H;  1ZYR D;  2VXW A;  1SNO A;  2VQF L;  3NE5 B;  1SNM A;  3O13 A;  4LF7 L;  4A3B B;  5HUR A;  4ILW A;  1LXM A;  3V05 A;  2EYF A;  1Y1V B;  4A3K H;  4JI2 L;  1K3B C;  4X3S A;  1V1O A;  1TQO A;  2A68 C;  1M4V A;  4LF4 L;  3GTG B;  3CCE A;  3H0G B;  4IPG A;  3S1M H;  2SNM A;  2IWH A;  4LFA Q;  2BOS A;  1QNK A;  4K5X A;  1UE6 A;  1IBL L;  1VDZ A;  1HXY D;  4LWC A;  1IBK L;  2NTT A;  1VF7 A;  1YHB A;  3D31 A;  2MO0 A;  4D6D A;  4Q0F A;  3H09 A;  3PMF A;  1PH2 A;  1C7Y A;  1HR0 W;  1VQ6 A;  3EA6 A;  4LF5 L;  1R4P B;  2ICI A;  2OF1 A;  1KTK A;  1EYC A;  1BOS A;  2XWJ B;  3RLF A;  4GLX A;  2WIN B;  5C4H A;  2FMC A;  3D8G A;  4Z9C B;  3IRB A;  4IUP A;  1UE7 A;  4FO2 A;  1MKH A;  2EOT A;  2R93 G;  4H0L C;  4A3I B;  4CJ1 B;  3CPF A;  3SK8 A;  1JJC B;  2BE5 D;  2E2H H;  5AJ3 Q;  3K7A H;  3H15 A;  1I50 B;  3J7A V;  4H13 C;  1YI2 A;  2PZW A;  4IJL A;  1EIG A;  2L12 A;  2YU9 H;  5E1F A;  1E2Z A;  2V4D A;  1HNX L;  4KKT A;  2FXQ A;  2SDF A;  1L1O B;  4LF8 Q;  1PH6 A;  4DV3 Q;  2C35 B;  3HOZ B;  4YCU A;  4KN7 C;  3KBU C;  2PMZ E;  2IX1 A;  5K36 G;  1JQY D;  3MXU A;  4DV1 Q;  2NVX H;  3D4R A;  3TZD A;  1CZW A;  1X1I A;  1CZG A;  1Q1E A;  4JI0 Q;  1V9P A;  3Q23 A;  3GTM H;  2KCN A;  1CHQ D;  5M5W H;  3HOV G;  3J80 E;  1S40 A;  1KL9 A;  4MN3 A;  2ENB A;  2KHS A;  2YV5 A;  1SRO A;  1FR3 A;  4DR5 Q;  1IXR A;  2MHV A;  3OHX C;  1Y8P B;  4D8O A;  1NY4 A;  2VQE Q;  4HN7 A;  1I94 Q;  1S5E D;  1K9M C;  2LSS A;  5AFW A;  3EN2 A;  3AFQ A;  1YNJ D;  1JOO A;  1XXG A;  4H44 C;  2F0D A;  1X3F A;  3TP6 A;  2E75 C;  4C3I B;  4YWL A;  4XXE A;  5LMU Q;  4C56 C;  3JAM L;  2H1E A;  5CBA E;  4PZ6 A;  5GAH C;  1XMQ Q;  4KMU C;  1EZ8 A;  4DV7 L;  1B70 B;  1QZG A;  3QOJ A;  1PH7 A;  1OJP A;  1IW7 D;  2ZM6 Q;  3PIP 3;  3DWA A;  3S14 H;  2KJX A;  4QCL A;  3D6W A;  1D2B A;  2L55 A;  4DFA A;  3UDI A;  1BR9 A;  2KCM A;  1FJG Q;  3AFP A;  4QIW E;  3HOW B;  5KNC A;  1D1I A;  1PTO F;  2EDG A;  3GDE A;  3UDG A;  3AMU A;  1YJ9 A;  3A8J E;  3SGI A;  3GTL B;  1PZK D;  1RHP A;  2JA6 B;  4IAL A;  5BN5 A;  1ICW A;  2L0C A;  4XDX A;  4R1J A;  2NBF A;  4Q5V A;  1ESR A;  3BYT B;  3DM1 A;  4GN3 B;  2KUM A;  1Z47 A;  3BG3 A;  3I55 A;  2H5X A;  1J9O A;  2KOL A;  3HOU G;  3MEH A;  1XPR A;  1JOR A;  4KY5 A;  2EYO A;  4OWX B;  2K5H A;  1PV4 A;  3EVQ A;  3J81 E;  2PW7 A;  1RWA A;  3N6R A;  2Z9H A;  5C3E G;  3KLS A;  3BJU A;  4DR7 Q;  5I9P A;  3KOJ A;  4K6D A;  1NAP A;  3NWT A;  2UXD Q;  5F2D A;  1MSH A;  1MJE A;  3J7Z C;  3V96 A;  3GTO B;  1AFP A;  2PQE A;  1KAB A;  5K5P A;  5C44 G;  3T51 B;  1JJ2 A;  2K1B A;  4RKB A;  1EY6 A;  1PLF A;  1XTD A;  4DR3 Q;  2E5L L;  2DUD A;  2N49 A;  5I4D A;  1Q8I A;  4C3H B;  2R92 G;  2OEO A;  1VQO A;  3P1H A;  1DZ1 A;  4X62 Q;  1MD2 D;  2CH4 A;  1SYF A;  5FLX E;  2PZT A;  1I4H A;  2RDH A;  2R93 H;  1WTP A;  1JMC A;  1S5C D;  1DOL A;  3L3O C;  3ERS X;  4LFB L;  4WJW A;  5KRU A;  2F0T A;  4GN4 B;  2MPM A;  3VR4 A;  1H9S B;  1GUW A;  1G29 1;  2K5V A;  3LWE A;  2B29 A;  4NXM Q;  4AH6 A;  3TS0 A;  3HOX B;  1TS3 A;  1NMF A;  2NZH A;  3GTP H;  4OEL B;  3SK6 A;  1B53 A;  3G71 A;  1XTC D;  5IYC G;  3NTH A;  3TP8 A;  4HJ7 A;  4A3G B;  2L4N A;  3T53 B;  5K36 H;  2M9V A;  1PDQ A;  3BVZ A;  3QJY A;  2F0P A;  1U4L A;  4BWG B;  3QOL A;  2K4K A;  3FP9 A;  1HUN A;  2XNA C;  1CSP A;  1T9H A;  3IFT A;  2JSO A;  2PO4 A;  3HOV H;  1TWF B;  1BF4 A;  4KHP L;  3HKZ B;  4OWT B;  4D6I A;  1PTO D;  2O2L D;  3CCL A;  4X3T A;  1TWC H;  2QW7 A;  1Y14 B;  1LM0 A;  1Y1W G;  4IFD G;  1K83 B;  1SE4 A;  3P20 A;  1ILQ A;  1H9S A;  4DV0 Q;  3IAY A;  4H7B A;  4HCS A;  4LJZ C;  2D5D A;  3KF8 B;  1BBW A;  4ZKC B;  4ZK9 B;  1J8I A;  4I7A A;  1R4Q B;  4R8N A;  3ULL A;  4DR6 L;  1T5E A;  2J0T D;  2K75 A;  1D5Z C;  5IGG A;  1HM3 A;  4NMZ A;  3QO2 A;  4OL7 A;  1SYE A;  1VQB A;  3S1N H;  1B4O A;  1LV9 A;  2WAQ G;  4A3D G;  1GOZ A;  5I2Y A;  4POG A;  4IUN A;  4G4K A;  4XTC S;  3KJO A;  1ICF B;  4D6C A;  4GKJ Q;  2ID0 A;  2K04 A;  4DR4 Q;  2KEC A;  4IOA A;  4OO1 G;  1PMR A;  1U4R A;  2XIW A;  1RWH A;  1PVO A;  3CCU A;  4JI4 L;  4N8F A;  4PZ8 A;  1BQQ T;  1TS5 A;  1SXT A;  1N34 Q;  3TS2 A;  2ICE C;  2SNS A;  2CW0 D;  3KBX A;  4RH6 A;  1DOK A;  1TU2 B;  4ZRZ A;  4CJ2 C;  4DAY B;  4JOI C;  3M4Q A;  2HQL A;  1S5D D;  3KF8 A;  3BDL A;  1MI2 A;  3HOU H;  3NSW A;  3IL8 A;  4FP5 D;  4AIM A;  1C0A A;  4LUV A;  1OXX K; 
#chains in the Genus database with same CATH homology
 2KXS A;  4D8O A;  4DLO A;  3UD1 A;  3QR8 A;  4MTK A;  3PQI A;  3F59 A;  2P5Z X;  3KBU C;  2KXR A;  3UD2 A;  3KBT C;  4DLQ A;  4UHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...