3QR8A

Crystal structure of the bacteriophage p2 membrane-piercing protein gpv
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
157
structure length
157
Chain Sequence
IQELARALRNMIRTGIIVETDLNAGRCRVQTGGMCTDWLQWLTHRAGRSRTWWAPSVGEQVLILAVGGELDTAFVLPGIYSGDNPSPSVSADALHIRFPDGAVIEYEPETSALTVSGIKTASVTASGSVTATVPVVMVKASTRVTLDTPEVVCTNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baseplate assembly protein V
publication title Phage pierces the host cell membrane with the iron-loaded spike.
pubmed doi rcsb
source organism Enterobacteria phage p2
molecule tags Viral protein
total genus 15
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04717 Phage_base_V Type VI secretion system, phage-baseplate injector
A PF18715 Phage_spike Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.230 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Gp5 N-terminal domain 3qr8A01
2.60.220.40 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Chondroitinase Ac; Chain A, domain 3 3qr8A02
3PQIA 3QR8A 4MTKA 4UHVA 2P5ZX
chains in the Genus database with same CATH superfamily
2VQEL 1EWIA 4GKJQ 1FVIA 4TVAB 2NYZD 1OJPA 3F2UA 1KLGD 1KNAA 3RLOA 1SYEA 3LNNA 4DUYQ 3F2BA 1HCZA 5M3FB 2UU9Q 2B29A 3HKZG 3VYSA 4DR5Q 1TS3A 2JYOA 4KD4A 4UAIA 4YY3L 1MSHA 3CCRA 3T1HQ 4RWSC 3W5OA 4JPBW 2JA8G 3OOCA 3NQIA 4NKLA 4P75A 4ZKBB 1TS5A 3M7NA 2F03A 1TWFB 1PH9A 3CC7A 2OCEA 3SR1A 3DXJC 1EY7A 1IYJB 1K9MC 4B3SQ 3OSOA 1E2WA 2GVBA 2QDBA 1SNPA 2I0QA 2B2UC 2IL8A 2PZWA 1VCIA 3W1GA 1W3SA 1YJWA 1JICA 2Q8TA 1JR0D 3K0YA 1I50B 1H9SB 4KHPQ 1I3QB 2K05A 4CBVA 2A74C 3KJPA 1EQTA 1WI5A 2D9UA 1EEFD 1STGA 2QCPX 2C35B 1W3YA 5C3EG 5NUCA 4LNQA 1DOLA 3KBGA 1VS0A 4R4QA 4IUVA 3KF6B 2PQAA 5I9OA 2R7DA 3T1YQ 3KLSX 5HY6A 4KJNA 4JYAL 4JI8L 3V05A 4PZ8A 2XRSD 4DV0Q 3CQZB 1QILA 2P5ZX 4K6LA 4JI4L 3NE5B 3CU7A 5CORA 2F4VL 1TWGB 2R92G 3MXNB 3NXWA 1LTBD 1O7ZA 2LY7A 1V9PA 4I7AA 3KUPA 1N7RA 5FOBB 3NWSA 1VMCA 2L0CA 1DD2A 2RSOA 3O13A 2K5WA 1GHJA 3ULPA 2WB1E 1J5EQ 3HOXG 1BCPD 2FINB 4YWKA 5M5XH 1VQBA 4UP7A 1X1HA 2A6HC 1JB3A 1HNXQ 2Z4IA 1WYDA 1I4PA 1QB5D 3STBC 2NVXB 4KHZA 4P74A 3KOJA 3PV0A 2PO4A 4JG2A 2SNSA 3S15B 3I4NB 1MHWC 5I2YA 1VQOA 2J0TD 2F0EA 1HJPA 2PI2E 3I4LA 5LMNW 1BBUA 1SE3A 1VF7A 1EZ8A 3E5SA 4A4IA 2K28A 1TVXA 3P1HA 2C5CA 4A3EH 5IYDH 3RZDB 4QCLA 1EYDA 1P8LA 2WB1B 2F4IA 3FPUB 2O2LD 3MFYA 1WTRA 1Z9FA 1JJCB 3UDIA 4MTKA 3PF4A 1RWCA 2G5DA 2UXBQ 2A6ED 1RJTA 2SEBD 2WIIB 3ND8A 2UUCQ 4K5XA 5I6WA 3ICEA 2NVYH 3DWAA 5GQOA 2Z6BA 3PUXA 4A3FH 3KF8B 4JBJA 2GN5A 1I94L 2EY6A 4A3IB 3T56B 1DJRD 1SNOA 1ILPA 4H7BA 1JWMD 2X6GA 4UPAA 1BNZA 1TWCB 3OWEB 4EGVA 2A19A 3RLFA 2AWNA 4AQYL 1W2BA 1O78A 1GUWA 3EROA 2KQ3A 3IKJA 4DXGA 2R3ZA 2KCNA 1DOKA 4YCVA 4PZ6A 2UUBL 3E6ZX 3Q8DA 1YEZA 1EOTA 2QDLA 5IP9H 3GTGH 4X3TA 1VQLA 4EQNA 3I55A 1C48A 4A3LG 1XMQQ 1JC7A 1TY2A 2I5HA 2HHHQ 1I6HH 1B3QA 1LXKA 3I56A 3VA7A 4OWWB 5CV5A 3S1QH 4C2MB 1PZKD 3F1ZA 5JPNC 3S1NH 1UEBA 4GKKQ 2PQEA 3JC66 1L0WA 4XYQA 1NAPA 1BCPC 4C3IH 2E2DC 2MJ8A 5M3MG 1EOVA 1A3VA 2EXDA 1E2VA 3CPFA 1RF2D 4XXEA 2NZ1D 2JA7B 1RL2A 5CV6A 3RN2A 1SFOH 3RMHA 1GXDC 3D6CA 3MFGA 3E9IA 1JT8A 2VNUD 2R93H 4HSVA 1NY4A 1JOKA 4DR2L 4A93H 3EN2A 3GTKH 4LFCQ 4WJWA 3MA2B 3M9BA 5C6AA 1L1OB 5C5MA 2Z9HA 4ILWA 1D5XC 4K8JA 4AH6A 5D3IB 1EYGA 1I4HA 2K6AA 2JE6I 2IW3A 3CCQA 1LT4D 4IFDG 2DN8A 4DNRB 2EDGA 1Y8NB 1KABA 3CCMA 2ZTEA 3GDEA 4K2KA 1D6EC 1OO9B 3S17B 4DR4Q 4XTCS 4K2LA 3FKIG 2E5LL 1KC8C 3P20A 3IFTA 2A6EC 4MHEA 3VYTA 4P2CB 3CAMA 2JA8B 4DNTB 5ELOA 5KIXA 2NN6I 5DAUA 4B3RQ 3HOVH 2EZVA 4Y7NB 4DV5Q 2YV5A 1ONLA 3C1EA 1EY6A 4DV6Q 5IGDA 2EYJA 2F0SA 4ZQ3A 1BCPF 3S1RB 1I5FA 1NR4A 1Y1VG 2XGTA 1JCKB 2E22A 3S2HB 3I73A 4N9TA 3H15A 1I6VC 2Z8LA 1X3QA 1RCVD 4KN7C 3TMEA 4DU9A 3N6RA 5I4DA 4LK1C 1ZXTA 2L4NA 3TZUA 4DAYA 4QGUA 1K8OA 5H1SE 2WMKA 3SXHA 4FF2A 2WMHA 1CM9A 3K5OA 5C3EB 3CKIB 2DNEA 1RIPA 2BE5D 2I5MX 3R2IA 4K5WA 3KBUC 1F2ZA 1A62A 1QVFA 4JI3Q 3BVZA 4JI6Q 3SE0A 1RODA 2RQXA 3A74A 2FMMA 5C4XH 1N8RC 4KD3A 1BR9A 2ZJRA 1FJGL 4C3JH 2LSSA 3PUWA 5JJLA 2WCOA 3QR8A 3D4RA 3UDFA 5D65A 4LF8Q 3RNUA 4DV7Q 2K5HA 2R92B 1IBLL 3M4OH 4HEDA 3SGIA 4D8OA 1PRTF 1HNZQ 1GHKA 1FNUA 4GZYC 3BDLA 3CC2A 3NTKA 5K36H 4JC0A 4DK3C 1K28A 3HOUB 3QJYA 1X54A 3HOXB 2IPKD 4Q0FA 4A3GH 4X62L 1CZGA 3L2PA 3KDFB 5CBAE 4DPGA 2UXCL 3NK9A 2AHOB 4XQNA 3PO2B 2DJGC 1TT2A 2L15A 4BY1H 1E3PA 4PMBA 1TXYA 2X69A 3C46A 1S5FD 1I4RA 1A15A 4CKBA 3VR3A 4C1NI 5KGUA 3A8IE 5L37A 5AFWA 1ASYA 4LF7L 1Y1WH 3GTQB 2DNCA 2ICEC 2F0OA 1HR0Q 1XMOQ 3KYHC 3EQLC 3T4AC 4OX9Q 1Q7YC 2IHFA 4IN3A 1RD9D 1XNRQ 4NXNL 2M9VA 5C0XH 4DR1L 5C4JB 4KY6A 3K7AH 4C3JG 1UWVA 3DEOA 5FLMG 5IT9L 4R4CA 2AMCB 4LF9L 2CCZA 1EIGA 2EJMA 2CH4W 1OJMA 1X32A 4RHSA 3SEBA 2OWOA 2F0MA 2F3VA 5D3DA 5FO9B 1PFMA 3EVQA 1VQ4A 2E76C 1HPCA 2AUJD 3CP0A 5FJ8G 4RA8A 5M9OA 4NXMQ 3K5LA 1AFPA 2OQ0A 5GAGC 2JA6H 4DGZA 2BE5C 4P72A 5FLXE 1HRJA 3S24A 5EKKA 1X9NA 5JVG3 1Q82C 1CT1D 4QUFA 5ELBA 2AWOA 1JB7A 1PFBA 2KOLA 4YCWA 4OELB 3K6OA 1QE6A 4HN7A 2K7VA 3DWQA 1QNKA 4RG1A 4GOPB 1Y1WG 5ELNA 3HOYG 1EZ6A 4IJHA 3OMGA 4LF4Q 1CB8A 3F2DA 1S5DD 3BG3A 1AP0A 4QB4A 4AIMA 4D71A 2WMIB 5LHY1 5M5YH 2O5JC 1OJOA 4GN3B 2F0KA 1H9JA 4R1JA 4J6HA 1X3FA 4KI0A 3VR5A 2BOSA 4CJ0B 2ES2A 3HP3A 2KENA 1GVPA 2CFMA 3S16H 1NNXA 1D1KA 2BA1A 5M3MB 1Q90A 4XDXA 1T9HA 4K0KL 1YHBA 4OONA 2ICIA 1N7PA 3H0GG 5EQ0A 1QWYA 3HOWH 1R4PB 2K4KA 1I4GA 1L2FA 3W3AA 3TSSA 3GTJB 1SR3A 1NTGA 4Y52H 3CMAA 1R9TB 3NENA 4HIMA 4GNXA 3S2DB 1H9RA 1PTOD 2ALYB 4M8AA 1LYLA 1JORA 1CUKA 2F0IA 3H94A 5IGBA 4C3HH 3DUZA 1N32Q 4WRDA 3NTHA 4HIOA 2EYMA 1PH4A 4G7ZC 1GUSA 5A2QL 1PH7A 1WD1A 3IFDA 4R8NA 3ND9A 3R93A 2RCFA 1DOMA 4A3KG 2NZOA 4R4IA 4A3JH 4XYOA 2HD3A 1JOQA 1G2SA 1HHVA 2E2HH 2GA4B 1LM0A 1Z6HA 5KEEA 3FKIB 1G6ZA 4OO1H 5IGFA 4DK6C 3PIOA 4A76A 4D6CA 1KAAA 1TIID 5GAHC 5KRUA 4B9WA 5LMUL 1M1KC 1CKMA 1EY5A 5IT9c 3QOLA 2VZAA 4PQXA 1NR2A 4FNFA 1F1SA 3TEHB 1ZYRD 2EYOA 1HA6A 1RWFA 3HRZC 1IKLA 1IHZA 1Y1VB 2EY1A 4ZLTF 5IWAQ 3MHBA 1G2TA 4TSSA 2EE1A 1TWHB 1OXXK 1UE5A 1EIHA 2RDHA 1YIJA 4A3DH 1MI2A 2XSCA 1ICFB 1NMFA 1Q8IA 4H02A 4PG3A 3G7LA 4JI7L 4D6EA 1HXYD 1UUPA 4RH6A 1O7YA 3D8GA 4DXFA 2NTSA 1XTDA 3NWTA 1LOHA 1DZ1A 1S40A 1GUOA 3G6JB 4QL5A 3CCEA 3S14H 1N9WA 1B7YB 2DY7A 4TKOB 3CXCA 2RKSA 3CPWA 1G91A 1STEA 1BF4A 2NVTH 1D7QA 4F8MA 3GTPB 3DM1A 4BBRG 4CDFC 2F0JA 4KTAA 1CFMA 1HR0W 2XNAC 4JW0A 2V1CC 2LFNA 3S1MB 1VQKA 5FKAC 2EQSA 3GQBA 2CW0D 2RSNA 2E2IB 3PF5A 2A5HA 4BBSH 2QF7A 1TWAH 3HOZB 3ERQA 5FLXc 4LFAQ 1VDZA 2EXZA 3TBIB 3IL8A 3NQTA 5CV9A 3TP6A 1N36L 4B3MQ 3M85A 3GTLB 1ENFA 2EYPA 2AKWB 1PTOC 1KNEA 1CA5A 1ASZA 1AH9A 2E8GA 1W6JA 4U68A 4YWMA 1DXMA 1IBMQ 1X1IA 2ATWA 2J4XA 4N8X1 3K80C 3SK6A 3G48A 1K83B 2UUAL 2BCOA 1TU2B 1XNQL 5JAVA 1QUQA 4BA2I 2OTLA 2JA9A 5LMNL 3OTOL 1WTVA 1RWHA 5BR8L 5AJ3Q 2KBNA 5JPMC 1DYQA 1J0MA 1EU4A 5CV8A 2NVQH 1B9NA 3I4MG 1HTLD 2RBMA 3A56A 1PH5A 5CBEE 2CWAA 3HG9A 2MO1A 4AYBG 1XTCD 1XWEA 3CC4A 1V1PA 1ZYRC 2HIVA 4V190 2O5IC 2KXSA 3BZDB 2Q2IA 4BBSG 2KCMA 3I90A 4DV2L 4XT3B 1HM3A 4QJFA 2N88A 5TSSA 4N9PA 1U0LA 2HQEA 4ZAIA 4GNXC 3MEFA 1L0XB 2XIWA 5GROA 2VB2X 1S5BD 1CI3M 2B39A 4LUVA 3DMUA 1ET9A 1WCMH 2K5QA 4JI1L 2JK8A 1BDOA 2SNMA 4IFDJ 4BY7H 1PTOF 4CDDC 3TQYA 1SNCA 4LF5L 4OGQC 2OXPA 4OHJA 2QA4A 3T13A 1GO3E 2YYZA 5IP7H 2NUCA 1N33L 2B63H 5JJKA 2A73B 1Y1WB 3HOYB 2MPMA 1A6XA 4B3TL 3JAMi 2K5NA 1S4ZA 2F0DA 1F2YA 1V1QA 3FMCA 3QB3A 4D6GA 2RCNA 3S9WA 1LABA 2CW0C 4WJ3M 2NZHA 5JOBA 1IW7D 2RF4A 4UP9A 4GKJL 4D6IA 3PIP3 4ZRZA 3PO3B 2UXDQ 2F0FA 2VQFQ 1SYFA 4LAAA 4DUYL 2UU9L 1CQVA 4DR5L 3L9AX 3T1HL 5F2DA 2B8FA 2CVRA 3P7JA 1RWAA 1K8GA 2VUMB 3H0GB 2EYLA 4JI5Q 4I7ZC 1UEAB 3J80L 4FF4A 1PRTD 4KLKA 1SNMA 4UDUC 1IYVA 3M3YH 1CHQD 1VQ5A 1E0BA 3D6WA 1E22A 2K5VA 4CJ1B 1PYWD 1TQOA 2B2WA 4B3SL 3FP9A 1KIXA 3A8KE 1GOZA 4L5RC 4OIJA 4A3MH 5C44H 2C9OA 5KYIA 1B3AA 3H6MA 4KHPL 5C3XA 3BS1A 3F8TA 3FRPB 4DAPA 4X3KA 1XJVA 3ZYYX 1FNWA 1BCPB 2I5LX 4A3KB 4CGYB 1VQJA 1HNWQ 2CH4A 4IO9A 4DK1A 1Q46A 4LF6Q 4JBWA 4DKAC 5EKIA 3UE1A 3NP8A 2MNAA 1SYBA 1L0YB 4WJ4A 3F2CA 1JMCA 4X66Q 1HH2P 4KY5A 2QILA 3T1YL 3GTOB 3TN2A 3LWEA 4ME5A 5IYDG 4A3EG 1EY4A 3OYYA 1DM0B 4QMGA 2EYHA 1GUTA 4LW1A 5IY0A 4DV0L 2HDMA 1FR3A 4PNYA 2R7ZH 2ZM6Q 1K73C 5EGTA 5FO7B 1XPOA 3PUYA 1D5MC 2PQAB 1LTGD 1X3EA 3C1FA 4TRDA 4ZYSA 4BXXH 1PH8A 2WKCA 4X3UA 3U9SA 4M1UB 2JXMB 3HKZE 2ZXPA 3RZOB 1J5EL 1H9MA 4FXGC 1LACA 4A3FG 4RMFA 3J81i 2WFWA 4A3BH 3ZJYC 1HNXL 1SNDA 4DV3Q 5C44G 4YCUA 2IHEA 3AFPA 1IBLQ 3L7ZC 1UE6A 3GTMH 2NN6H 2IX0A 2VB3X 1YVCA 3HS0C 5T1GA 3Q24A 1F2LA 1BBXC 3MVVA 4DR3Q 2CWPA 4LWCA 1IW7C 2KCCA 1CKNA 3PMFA 3BJUA 4G4KA 4JI0Q 4FYDA 5EJWA 2K32A 4G57A 1EY0A 1EEID 2EYFA 4MTNA 4KK7A 4IFDI 1PXUA 3KLRA 5DEHA 3H3VI 5IP9G 1VQMA 3NBIA 4X62Q 3WWVA 3G71A 1PZID 1OXSC 4KKSA 4BBRB 5M5WH 3JAME 1PTOH 4CKEA 1B44D 2DGYA 4JV5Q 3HKZB 3Q6SA 2K75A 5G3LD 1A3UA 2F0UA 3BYTB 2E2JH 1Y8OB 3CD6A 1JQYD 1PRTC 2RHSB 1NBWA 5IIFA 2YU9B 3K59A 1VQAA 2UXBL 1X6OA 1WTOA 4C3IG 1UE1A 4AYBE 4GN4B 4U673 3I72A 4ALPA 1CSPA 3SVMA 3J80c 1U4LA 2UUCL 4DAMA 2ZT9C 2K33A 2EPBA 2JP1A 3JAML 1A2UA 1VQ9A 1OXVA 3A7LA 1EGUA 3UDXA 2AQ3B 5M3FH 5EBCA 3D4DA 1JOOA 3CMEA 2R93G 1FD7D 2A69D 4NB3A 1WTWA 1I4XA 1B70B 3E0JA 4A93G 3EA6A 3U58A 3QO2A 5CC4A 1BKBA 4PV1C 3BYYB 3K5NA 3QOJA 3I4MB 1F2MA 3RR5A 1II3A 4JBKA 4LFBQ 2QW7A 1B8AA 3DLLA 2XWBB 4AYBB 1X55A 1XMQL 2Z6KA 2F52A 2HHHL 2K03A 4NMZA 4FVMA 1I3QH 1E1TA 3ULJA 1E24A 1SROA 1PYSB 4GKKL 2CQAA 5C5LA 2MP1A 4XT1B 3HOVG 1A63A 2B2WC 5GAEC 5E3FA 3K8AA 1RKNA 1JJ2A 1G6PA 2BRVX 2FXQA 2KJXA 1BOSA 4X64Q 5IYBH 1P16A 4D6HA 3OWFA 4YHHQ 1AN8A 5IT9E 1SAPA 1D5ZC 2JEAI 1V1OA 3CQZH 3QG1A 2Y0SG 3J81E 2EJFC 1IL2A 5I2XA 1TWGH 4X65Q 1F9GA 3MXPA 2AQ1B 1B4OA 4IPHA 1IBKQ 4FXKC 1VMPA 2K50A 4ID6A 4HIKA 4QIWE 2HCIA 1BBWA 2AUKA 3U4ZA 5C4XG 2KA7A 1CSQA 4OWXB 2ZJPA 2Q2HA 1YITA 1CKNB 2NVXH 1LLRD 4F88A 5DNFA 2TSSA 1BO0A 1H9KA 5JEAH 5ELCA 3QWNA 4RCNA 1K0RA 3J81L 2HUGA 3S15H 4B3RL 3I4NH 4DV5L 5A35A 1EUJA 2L9HA 4HMJA 4J15A 5K36G 4DUZQ 4DV6L 1ML0D 1LTRD 2A69C 5M5XB 5CYUA 1HFGA 2HT1A 4A3GG 4HSPA 1T5EA 4QIWB 1WOCA 2KUMA 3JAMc 3RZDH 2GVAA 2Z4HA 4L5TA 1OXTA 2IWHA 1GUNA 4BY1G 2F1MA 4B9XA 4O42A 2BDOA 2FFKB 4L8JA 3FEWX 1JWUD 2R7FA 1BVSA 1STNA 2F0VA 4RKLA 1EIFA 1QCBD 4R9WA 1ZEQX 1EFWA 5IGEA 1K3RA 3AQQA 3UD1A 1QJOA 2ID0A 1G291 2NWGA 1S5ED 2H1EA 4PMCA 4HJAA 5BN4A 1SYGA 3I7FA 1YHQA 4JI6L 4ULLA 1WVLA 2D62A 4ME3A 4JI2Q 4A3EB 1C7YA 3MZ5A 3PGZA 5C0XG 4A3IH 3NELA 4DAYB 1AZQA 5G3LF 5HURA 1HUMA 4IQZA 4IUUA 1TWCH 1MJCA 4CJ2C 1VQGA 4DV1Q 1H95A 1F9QA 3D3RA 3AFQA 4DF7A 2B3GA 2VXWA 2M00A 4LF8L 4DV7L 5JEAG 1HZCA 4NW2A 5A2QE 1N34Q 4BWGB 1N7OA 5COYA 3FPPA 2R61A 5FK9C 1HNZL 3OW2A 2QEJC 2NB0A 1MD2D 3GP7A 2RDFA 2JEBI 4POFA 2D5DA 3R8BA 2PW5A 2NVYB 5IYCH 2VQEQ 2BRPA 1C8CA 2EY5A 2KCTA 4A3FB 1KDBA 3MEHA 4LJZC 4Q5VA 3MC0B 1C4QA 4TQUS 3QIAA 1OTCA 2BDNA 3L0OA 3FDTA 2JA6G 2BA0A 1J6QA 1TY0A 4YY3Q 4L63B 4RGOS 4OEMB 2SOBA 4IJLA 2PZUA 3MXUA 1H9SA 1M4VA 1LTLA 1FYCA 2ZXRA 4JOIC 1F9SA 2ZTCA 5KNBA 3M4PA 1BXTA 2OT2A 1HQRD 3GTGB 1HR0L 3Q0AA 4HJ8A 3IRBA 2Z6KC 4OX9L 3X3NA 1G8ZD 2VL6A 3G4SA 1VQPA 5E4XA 4GLAC 3ITPA 4K8IA 4E6IA 3VR2A 3CCJA 1XNRL 1MSGA 3KF6A 1KRSA 1I6HB 4X6AH 2JA7H 2L5TA 1STHA 2QGQA 4GLVB 1PFSA 4C1NK 3S1QB 1ZKOA 5KNCA 2F0HA 4DK0A 2DY8A 4FDBA 4IOCA 2RVLA 4G7HC 3AU7A 3S1NB 2MO0A 2WACA 5LMNQ 3OTOQ 2XN9C 3CRLC 3I8ZA 4CDEC 3GV3A 4C3IB 4DR7L 4X3SA 5GADC 3EBEA 4D72A 3J81c 2I07B 5ELEA 2F0LA 2FHTA 1VQCA 1SYCA 3LX0A 1SYDA 1TS2A 1Z7TA 1XXGA 3C3LA 3HOWG 5IYCG 3TREA 4HJ7A 3HEJA 4KHVA 5CR3A 1PFNA 4GS3A 1N7NA 4NXML 5D14A 1SFOB 4JYAQ 4JI8Q 4PMWA 4QF4A 2R93B 3GTMB 3E0EA 4J1MA 4A93B 1SDFA 4EVOA 3GTKB 1SJED 1I8QA 3UD2A 2JA8H 2TMPA 3J80i 4JI4Q 2F4VQ 5IOCA 1MJEA 3E3XA 2A1AA 4C3HG 5J39A 2LKVA 3DWPA 3OPOA 1VQHA 4DNIA 5EPLA 4Y7NH 1IYUA 3J7YW 1Q3LA 1X1JA 3LGJA 1QOHA 4A3JG 1PTOB 1STYA 1M90C 4LF4L 5EAYA 1ET6A 5EBDA 3S1RH 1PVOA 3M4QA 2Y0SE 3HKSA 4L5QA 3S2HH 2IT1A 1PH3A 5ELDA 4ZUIA 2XWJB 3HGBA 1YNND 3UI2A 4QQBX 1M8AA 4OO1G 2KXRA 2FJ2A 3PUZA 3I3CA 3W1BA 4DV4L 4IZ8A 2SDFA 5J3BA 1HZBA 1BQQT 1K0SA 2LXJA 5C3EH 1V43A 1SE2A 1WTPA 3HOVB 2CHBD 4KV6A 4UHVA 1FL0A 1KDCA 1S72A 1LTAD 4KKTA 1S5CD 5LL6X 4RGNA 3TDQA 4RAUC 4ZUJA 3NUCA 3VYRA 4D6FA 4ABNA 4R4TA 1Q12A 1IZ6A 5E7NA 4A3DG 1EY8A 3KF8A 4UY8C 2QKIC 1NUCA 1A2TA 1WJJA 2Y0SB 2BRWA 2PI2A 2MFIA 4OXPA 3VDYA 2Z1CA 3A7AB 1KHIA 2R92H 3CCLA 1EQRA 1Q1EA 1VQ7A 3F59A 4BS9A 3BDOA 1N32L 2RHQB 5T1IA 4POGA 3CW2C 5J1ZA 1E2ZA 2M2LA 5ELFA 3IAYA 4MZ9A 2PZTA 4L5SA 2WAQG 4GNXB 1YHAA 3HOUH 3HOXH 4P73A 4B08A 3TRZA 1SE8A 5C4XB 1I94Q 1UAPA 3TP7A 1O7LA 3PO2H 4C3JB 5JVH3 3DEPA 3I70A 4FF3A 4AQYQ 1XYIA 1BUVT 2E75C 2EJGC 2IX3A 3M4OB 2UUBQ 3WOFA 1YNXA 3MWYW 4EX5A 4DR6L 1U4RA 3GTQH 1O7IA 1S3OA 1JE4A 5ISRA 1F9RA 4ZK9B 1WD0A 4A3GB 3SK5A 5IWAL 1VQ6A 3P75A 3U7VA 3OW7A 5C4JH 3VYUA 1SE4A 4BY1B 2DUDA 3G6EA 1NMGA 1PH1A 1EL0A 3W2DA 1RW9A 1VF5C 4L6TB 3NTIA 3T16A 1PMRA 2JJQA 2VS1A 4HCSA 5BN5A 4APVA 4IUTA 1ESRA 5LL6S 1LT3D 2OEOA 3J80E 1L1OA 1U4PA 1LXMA 1YNNC 1O80A 4MN3A 3HOUG 1K8AC 3VR6A 2IY5B 4IUNA 1Q81C 3CCUA 2N55A 4JVZA 1LUZA 1E7ZA 3K7AB 3PO2G 1KXLA 1NJIC 4RFBA 5I6YA 3K58A 4DR2Q 1U9RA 2B2YA 3I4OA 4S3SA 2F3IA 4I65A 5C3WA 3K57A 4IOAA 1EWCA 1SN8A 3SDZA 4P71A 4LFAL 1Q86C 1AEXA 2VW9A 4B3ML 4IALA 2OF1A 1Y69U 4A3LH 2RA4A 2KVMA 2YTVA 5I9PA 4XQQA 1IBML 5DLQE 1VQFA 2JA6B 1VQDA 4DAVA 1STAA 1Y14B 2E5LQ 1WCMG 2ZXOA 4MIUA 1SNQA 2KHSA 4Z9CB 4BY7G 1HFNA 2JSOA 3K7UC 3D0FA 5HGQA 3GO5A 4IPCA 4UP8A 1PA6A 2RDGA 5IP7G 2B63G 3SK8A 5M3MH 4H13C 5AJ3L 1XPRA 1D8LA 1KRTA 5DM63 1R4QB 2L12A 3MXGA 1IL8A 1QG7A 1J9OA 3GTJH 3U9OA 1LTTD 5M5YB 1LO5D 1SBBB 3EFXD 1X65A 1R9TH 2MUYA 2JA5H 1C9OA 3S2DH 2N49A 1B2TA 4F87A 1K8MA 3DM3A 1QUQB 1IKMA 4JBMA 1Y8PB 4IUQA 2XVSA 3K81C 1AE3A 1GKHA 3S16B 1GUGA 2IJ0A 2MQHA 2QEXA 4NP5A 4IFDH 3URYA 3H3VH 1V8QA 1WTHA 3HOWB 4NPSA 2K04A 1AE2A 1HZ9A 1PH6A 3NHHA 4D6JA 3A0JA 2WMGA 1KTKA 4FF1A 3K0XA 1D1IA 3FKIH 1FJGQ 4V0BA 1V1PB 1YBYA 2JQOA 3UDGA 2HCCA 2WV6D 3NBHA 3DHQA 2CKZB 3KDFA 2PPBC 1YNJD 2Q8RE 1LT6D 4A3MG 5IGGA 1PRTB 3BDCA 4C3HB 4A3CH 2L55A 5CV4A 3MTSA 1I4QA 1VQNA 1Q1BA 2EOTA 5CV7A 2F0WA 3PSIA 4OIKA 2D0OA 2EY2A 4A3JB 2F0GA 2PNRC 3M4YA 5JJZA 1Y1VH 2E2HB 3EJIA 4O2DA 2UXCQ 1TWHH 1KQSA 3PCOB 1SXTA 1HMWA 1CK1A 2XTIA 4QY7A 2JA5G 2K1BA 2G9HD 5E4WC 3BU2A 3HFZB 1UNSA 3U4VA 3X3MA 4FXDA 2UXDL 4H0LC 4D1IA 2VQFL 2L1BA 4DLOA 2IX1A 1EYAA 1X56A 2WAQE 3BVMA 5E1FA 4KN4C 3KLWA 2YTYA 1HTPA 5IE8A 4LF7Q 2R7ZG 3J7ZC 1EY9A 4JI5L 4DFAA 1A0IA 1PHJA 1LTSD 4BXXG 2VY3A 4NXNQ 5KYLA 1YI2A 1MIUA 4DR1Q 3A54A 2G9DA 2H5XA 3GTPH 1PYBA 1PDQA 4A3DB 3RN5A 4C56C 5EKLA 2V4DA 5EPKA 3SK4A 1FGBD 1G51A 1ENCA 4A3BG 2X03A 1SMYD 1NE3A 1CZWA 3KFUA 3S1MH 3ONAB 1C82A 3ULLA 2JN4A 2NBFA 1PLFA 2E2IH 1QZGA 4LF9Q 3J7AF 4A3CG 5C0XJ 2NN6G 1L1OC 3HOZH 2B2TA 3TS2A 3S14B 4KMUC 1C0AA 1GD7A 1WTQA 4N8FA 2WAQB 3D4WA 1MBYA 1HNWL 2Q2TA 2CQOA 4FP5D 3GTLH 4F7XA 5IGCA 1TWFH 4LF6L 5JEAJ 4GOPA 2NVTB 1B53A 3T51B 1RDPD 3PIO3 2Q2UA 4JOIA 4OWTB 4ODGA 4FO2A 2Q8IB 1F77A 3J81j 1NSNS 3OIQA 4X66L 2B2YC 1QZHA 1OXUA 2WMIA 1W6KA 3J7A5 1K83H 1STBA 1SEBD 3KK7A 1B9MA 4BBSB 4ZKCB 1I50H 3A55A 4D1JA 1LV9A 1TWAB 3RUZA 2WP8J 2ZM6L 2BH8A 4HR7B 4IPDA 4CDCC 4BA1I 2WMFA 3NSWA 1CA6A 1Z47A 4IURA 1RHPA 3WOEA 1KAWA 5KNDA 1KD1C 1YNJC 4K14A 1SLJA 3V2TA 2N3SA 2MGSA 4A75A 2PMZE 5FLMH 2N8NA 3SHLA 3FVQA 2NTTA 4R8IA 4DV3L 4PZ7A 1YJNA 5M3FG 3PIPA 1CKOA 1B50A 3HOZG 1LTID 4LFCL 4K0KQ 3CHBD 3LWUA 4DR3L 1ENAA 2J7ZA 5HGTA 2PCFB 3R2TA 4JI0L 3KJOA 5FJ8H 2NVQB 3WDNA 3NBHB 4HAEA 3I2ZA 2AQ2B 4DR4L 4JV5L 1J0NA 2FMCA 2A68D 3A8JE 2Z0SA 2PMZB 3E9HA 1HA5A 4GN5A 2H4OA 3HOYH 3A5UA 3EIVA 1YJ9A 4RGTA 4EQPA 2XRQD 1HM2A 1A3TA 3TZDA 4RGMA 1IXRA 4HIDA 2F3WA 2E24A 4KKUA 1AW7A 1Q8KA 1SMYC 1TR5A 5K5PA 2B2VA 4RHRA 1XX8A 1HUNA 1CHPD 1WCMB 2ENBA 3KBTC 1GJXA 2K52A 4HMIA 1K3BC 1JJGA 1FGUA 1HMUA 1KLUD 4BY7B 3PO3H 2D2CC 3RLNA 1DGSA 5IYBG 5LMUQ 3KBXA 4IPGA 1FNVA 4RKBA 1HZAA 5JJIA 2B63B 4K6DA 4HJ5A 4DR7Q 1SRUA 4XIGS 4GLXA 3C2PA 1YZ6A 4OL7A 3OHXC 1OJNA 2VUMH 3T53B 3H0GH 4JCVE 1CTMA 1VQIA 1AZPA 1ICWA 5DM73 1ILQA 4DN4M 1MGSA 3CF5A 3NPPA 4WORA 5C4ZA 2ZTDA 1QVGA 2WMJA 4JI3L 5C0XI 4LFBL 4YIJA 1HQMC 3BZCA 3VR4A 4JI7Q 1EQVA 1J8IA 3MAQA 4D6DA 5EPJA 2B2UA 5J22A 2LMCB 1RTOA 1QNUA 5CMDA 4K5VA 1NCVA 2HDLA 1SJHD 3CRKC 4LUZA 3FHWA 2F0TA 4IUPA 2OQKA 4A3KH 3H91A 2KECA 3I91A 4HTHA 1X3GA 1SMXA 3BVGA 2EVBA 1MKHA 3M3YB 3I4NG 4EQ5A 3H09A 4HJ9A 3OMCA 4ZCKA 1GM5A 2R6GA 1PH2A 1EIYB 1U4MA 3UE0A 3GTOH 3ER0A 4DV4Q 1WFQA 4A3MB 5C44B 3PO3G 2B2TC 4X64L 1KL9A 5FLXL 1N7QA 4LUOA 4C2MH 2MHVA 4YHHL 4G7OC 2WB1G 1XPUA 2KHJA 2HIXA 3RD4A 2KEEA 1D2BA 2KHIA 1N36Q 4KJOA 4GOPC 4X65L 2VUMG 1HN0A 1EU3A 1IBKL 3N52A 3K5MA 2K01A 3AMUA 4YWLA 2ZJQA 1E1OA 1XMOL 3PUVA 1DONA 2A68C 2KEDA 2JA5B 1B1ZA 1RWGA 3RZOH 3TP8A 1EQQA 3CCSA 3ERSX 4JK1C 5BN3A 3HZXA 2UUAQ 4A3IG 2Q1FA 1XNQQ 3VA5A 3BZKA 2OTJA 3R3OA 4CKCA 4RCOA 2R7ZB 5C4HA 1SSOA 3AEVA 3GV6A 4XQJA 3L3OC 5BR8Q 1F9PA 2K14A 2K5DA 5FO8B 1DCZA 4WFN3 1LT5D 4LMQD 5CGKA 1X3PA 3MXNA 3TS0A 2WDAA 3GD7A 2N78A 3V96A 4DUZL 4BBRH 2WKDA 1EYCA 1TS4A 4HCEA 4O0AA 3Q22A 4DLQA 2ASBA 4A3BB 2LS01 4EQOA 2EIFA 1EFID 2F0PA 3S17H 1U5KA 4R4OA 3PQIA 2WINB 1CQFA 3NEMA 1UE7A 1KDAA 3OIPA 2LXKA 4DV2Q 1JE5A 1WTXA 4DR6Q 2YU9H 2I46A 5IODA 2DJFC 1QVCA 3AYHB 3KLSA 2BH2A 2A8VA 3H3VC 2F0QA 3A5ZB 1A8VA 2O4XA 3U50C 3B6YA 2B8GA 5M5WB 4J8QA 4KY7A 2F0NA 1EWHA 2PNHA 4O1NA 4NDXA 4JI1Q 1PV4A 4JI2L 2D0PA 4LF5Q 2JA7G 1JWSD 1VQ8A 2L11A 3J7AV 3CCVA 4OO1I 2E2JB 3AB9A 2E74C 3TP5A 4DV1L 1VQEA 1N33Q 3M7GA 2PYKA 4CHTB 2PW7A 3D31A 2A6HD 1TKWB 4B3TQ 4QUCA 4DA2A 2YTXA 1N34L 3Q23A 2X6LA 4H44C 2B2VC 2HQLA 3STBD 1T5XD 4MNOA 3I4MH 1RTNA 1ESFA 1PZJD
chains in the Genus database with same CATH topology
3PQIA 3QR8A 4MTKA 2KXRA 3UD1A 4DLQA 3KBTC 4D8OA 3KBUC 4DLOA 4UHVA 2P5ZX 3F59A 3UD2A 2KXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PQI A;  3QR8 A;  4MTK A;  4UHV A;  2P5Z X; 
#chains in the Genus database with same CATH topology
 2VQE L;  1EWI A;  4GKJ Q;  1FVI A;  4TVA B;  2NYZ D;  1OJP A;  3F2U A;  1KLG D;  1KNA A;  3RLO A;  1SYE A;  3LNN A;  4DUY Q;  3F2B A;  1HCZ A;  5M3F B;  2UU9 Q;  2B29 A;  3HKZ G;  3VYS A;  4DR5 Q;  1TS3 A;  2JYO A;  4KD4 A;  4UAI A;  4YY3 L;  1MSH A;  3CCR A;  3T1H Q;  4RWS C;  3W5O A;  4JPB W;  2JA8 G;  3OOC A;  3NQI A;  4NKL A;  4P75 A;  4ZKB B;  1TS5 A;  3M7N A;  2F03 A;  1TWF B;  1PH9 A;  3CC7 A;  2OCE A;  3SR1 A;  3DXJ C;  1EY7 A;  1IYJ B;  1K9M C;  4B3S Q;  3OSO A;  1E2W A;  2GVB A;  2QDB A;  1SNP A;  2I0Q A;  2B2U C;  2IL8 A;  2PZW A;  1VCI A;  3W1G A;  1W3S A;  1YJW A;  1JIC A;  2Q8T A;  1JR0 D;  3K0Y A;  1I50 B;  1H9S B;  4KHP Q;  1I3Q B;  2K05 A;  4CBV A;  2A74 C;  3KJP A;  1EQT A;  1WI5 A;  2D9U A;  1EEF D;  1STG A;  2QCP X;  2C35 B;  1W3Y A;  5C3E G;  5NUC A;  4LNQ A;  1DOL A;  3KBG A;  1VS0 A;  4R4Q A;  4IUV A;  3KF6 B;  2PQA A;  5I9O A;  2R7D A;  3T1Y Q;  3KLS X;  5HY6 A;  4KJN A;  4JYA L;  4JI8 L;  3V05 A;  4PZ8 A;  2XRS D;  4DV0 Q;  3CQZ B;  1QIL A;  2P5Z X;  4K6L A;  4JI4 L;  3NE5 B;  3CU7 A;  5COR A;  2F4V L;  1TWG B;  2R92 G;  3MXN B;  3NXW A;  1LTB D;  1O7Z A;  2LY7 A;  1V9P A;  4I7A A;  3KUP A;  1N7R A;  5FOB B;  3NWS A;  1VMC A;  2L0C A;  1DD2 A;  2RSO A;  3O13 A;  2K5W A;  1GHJ A;  3ULP A;  2WB1 E;  1J5E Q;  3HOX G;  1BCP D;  2FIN B;  4YWK A;  5M5X H;  1VQB A;  4UP7 A;  1X1H A;  2A6H C;  1JB3 A;  1HNX Q;  2Z4I A;  1WYD A;  1I4P A;  1QB5 D;  3STB C;  2NVX B;  4KHZ A;  4P74 A;  3KOJ A;  3PV0 A;  2PO4 A;  4JG2 A;  2SNS A;  3S15 B;  3I4N B;  1MHW C;  5I2Y A;  1VQO A;  2J0T D;  2F0E A;  1HJP A;  2PI2 E;  3I4L A;  5LMN W;  1BBU A;  1SE3 A;  1VF7 A;  1EZ8 A;  3E5S A;  4A4I A;  2K28 A;  1TVX A;  3P1H A;  2C5C A;  4A3E H;  5IYD H;  3RZD B;  4QCL A;  1EYD A;  1P8L A;  2WB1 B;  2F4I A;  3FPU B;  2O2L D;  3MFY A;  1WTR A;  1Z9F A;  1JJC B;  3UDI A;  4MTK A;  3PF4 A;  1RWC A;  2G5D A;  2UXB Q;  2A6E D;  1RJT A;  2SEB D;  2WII B;  3ND8 A;  2UUC Q;  4K5X A;  5I6W A;  3ICE A;  2NVY H;  3DWA A;  5GQO A;  2Z6B A;  3PUX A;  4A3F H;  3KF8 B;  4JBJ A;  2GN5 A;  1I94 L;  2EY6 A;  4A3I B;  3T56 B;  1DJR D;  1SNO A;  1ILP A;  4H7B A;  1JWM D;  2X6G A;  4UPA A;  1BNZ A;  1TWC B;  3OWE B;  4EGV A;  2A19 A;  3RLF A;  2AWN A;  4AQY L;  1W2B A;  1O78 A;  1GUW A;  3ERO A;  2KQ3 A;  3IKJ A;  4DXG A;  2R3Z A;  2KCN A;  1DOK A;  4YCV A;  4PZ6 A;  2UUB L;  3E6Z X;  3Q8D A;  1YEZ A;  1EOT A;  2QDL A;  5IP9 H;  3GTG H;  4X3T A;  1VQL A;  4EQN A;  3I55 A;  1C48 A;  4A3L G;  1XMQ Q;  1JC7 A;  1TY2 A;  2I5H A;  2HHH Q;  1I6H H;  1B3Q A;  1LXK A;  3I56 A;  3VA7 A;  4OWW B;  5CV5 A;  3S1Q H;  4C2M B;  1PZK D;  3F1Z A;  5JPN C;  3S1N H;  1UEB A;  4GKK Q;  2PQE A;  3JC6 6;  1L0W A;  4XYQ A;  1NAP A;  1BCP C;  4C3I H;  2E2D C;  2MJ8 A;  5M3M G;  1EOV A;  1A3V A;  2EXD A;  1E2V A;  3CPF A;  1RF2 D;  4XXE A;  2NZ1 D;  2JA7 B;  1RL2 A;  5CV6 A;  3RN2 A;  1SFO H;  3RMH A;  1GXD C;  3D6C A;  3MFG A;  3E9I A;  1JT8 A;  2VNU D;  2R93 H;  4HSV A;  1NY4 A;  1JOK A;  4DR2 L;  4A93 H;  3EN2 A;  3GTK H;  4LFC Q;  4WJW A;  3MA2 B;  3M9B A;  5C6A A;  1L1O B;  5C5M A;  2Z9H A;  4ILW A;  1D5X C;  4K8J A;  4AH6 A;  5D3I B;  1EYG A;  1I4H A;  2K6A A;  2JE6 I;  2IW3 A;  3CCQ A;  1LT4 D;  4IFD G;  2DN8 A;  4DNR B;  2EDG A;  1Y8N B;  1KAB A;  3CCM A;  2ZTE A;  3GDE A;  4K2K A;  1D6E C;  1OO9 B;  3S17 B;  4DR4 Q;  4XTC S;  4K2L A;  3FKI G;  2E5L L;  1KC8 C;  3P20 A;  3IFT A;  2A6E C;  4MHE A;  3VYT A;  4P2C B;  3CAM A;  2JA8 B;  4DNT B;  5ELO A;  5KIX A;  2NN6 I;  5DAU A;  4B3R Q;  3HOV H;  2EZV A;  4Y7N B;  4DV5 Q;  2YV5 A;  1ONL A;  3C1E A;  1EY6 A;  4DV6 Q;  5IGD A;  2EYJ A;  2F0S A;  4ZQ3 A;  1BCP F;  3S1R B;  1I5F A;  1NR4 A;  1Y1V G;  2XGT A;  1JCK B;  2E22 A;  3S2H B;  3I73 A;  4N9T A;  3H15 A;  1I6V C;  2Z8L A;  1X3Q A;  1RCV D;  4KN7 C;  3TME A;  4DU9 A;  3N6R A;  5I4D A;  4LK1 C;  1ZXT A;  2L4N A;  3TZU A;  4DAY A;  4QGU A;  1K8O A;  5H1S E;  2WMK A;  3SXH A;  4FF2 A;  2WMH A;  1CM9 A;  3K5O A;  5C3E B;  3CKI B;  2DNE A;  1RIP A;  2BE5 D;  2I5M X;  3R2I A;  4K5W A;  3KBU C;  1F2Z A;  1A62 A;  1QVF A;  4JI3 Q;  3BVZ A;  4JI6 Q;  3SE0 A;  1ROD A;  2RQX A;  3A74 A;  2FMM A;  5C4X H;  1N8R C;  4KD3 A;  1BR9 A;  2ZJR A;  1FJG L;  4C3J H;  2LSS A;  3PUW A;  5JJL A;  2WCO A;  3QR8 A;  3D4R A;  3UDF A;  5D65 A;  4LF8 Q;  3RNU A;  4DV7 Q;  2K5H A;  2R92 B;  1IBL L;  3M4O H;  4HED A;  3SGI A;  4D8O A;  1PRT F;  1HNZ Q;  1GHK A;  1FNU A;  4GZY C;  3BDL A;  3CC2 A;  3NTK A;  5K36 H;  4JC0 A;  4DK3 C;  1K28 A;  3HOU B;  3QJY A;  1X54 A;  3HOX B;  2IPK D;  4Q0F A;  4A3G H;  4X62 L;  1CZG A;  3L2P A;  3KDF B;  5CBA E;  4DPG A;  2UXC L;  3NK9 A;  2AHO B;  4XQN A;  3PO2 B;  2DJG C;  1TT2 A;  2L15 A;  4BY1 H;  1E3P A;  4PMB A;  1TXY A;  2X69 A;  3C46 A;  1S5F D;  1I4R A;  1A15 A;  4CKB A;  3VR3 A;  4C1N I;  5KGU A;  3A8I E;  5L37 A;  5AFW A;  1ASY A;  4LF7 L;  1Y1W H;  3GTQ B;  2DNC A;  2ICE C;  2F0O A;  1HR0 Q;  1XMO Q;  3KYH C;  3EQL C;  3T4A C;  4OX9 Q;  1Q7Y C;  2IHF A;  4IN3 A;  1RD9 D;  1XNR Q;  4NXN L;  2M9V A;  5C0X H;  4DR1 L;  5C4J B;  4KY6 A;  3K7A H;  4C3J G;  1UWV A;  3DEO A;  5FLM G;  5IT9 L;  4R4C A;  2AMC B;  4LF9 L;  2CCZ A;  1EIG A;  2EJM A;  2CH4 W;  1OJM A;  1X32 A;  4RHS A;  3SEB A;  2OWO A;  2F0M A;  2F3V A;  5D3D A;  5FO9 B;  1PFM A;  3EVQ A;  1VQ4 A;  2E76 C;  1HPC A;  2AUJ D;  3CP0 A;  5FJ8 G;  4RA8 A;  5M9O A;  4NXM Q;  3K5L A;  1AFP A;  2OQ0 A;  5GAG C;  2JA6 H;  4DGZ A;  2BE5 C;  4P72 A;  5FLX E;  1HRJ A;  3S24 A;  5EKK A;  1X9N A;  5JVG 3;  1Q82 C;  1CT1 D;  4QUF A;  5ELB A;  2AWO A;  1JB7 A;  1PFB A;  2KOL A;  4YCW A;  4OEL B;  3K6O A;  1QE6 A;  4HN7 A;  2K7V A;  3DWQ A;  1QNK A;  4RG1 A;  4GOP B;  1Y1W G;  5ELN A;  3HOY G;  1EZ6 A;  4IJH A;  3OMG A;  4LF4 Q;  1CB8 A;  3F2D A;  1S5D D;  3BG3 A;  1AP0 A;  4QB4 A;  4AIM A;  4D71 A;  2WMI B;  5LHY 1;  5M5Y H;  2O5J C;  1OJO A;  4GN3 B;  2F0K A;  1H9J A;  4R1J A;  4J6H A;  1X3F A;  4KI0 A;  3VR5 A;  2BOS A;  4CJ0 B;  2ES2 A;  3HP3 A;  2KEN A;  1GVP A;  2CFM A;  3S16 H;  1NNX A;  1D1K A;  2BA1 A;  5M3M B;  1Q90 A;  4XDX A;  1T9H A;  4K0K L;  1YHB A;  4OON A;  2ICI A;  1N7P A;  3H0G G;  5EQ0 A;  1QWY A;  3HOW H;  1R4P B;  2K4K A;  1I4G A;  1L2F A;  3W3A A;  3TSS A;  3GTJ B;  1SR3 A;  1NTG A;  4Y52 H;  3CMA A;  1R9T B;  3NEN A;  4HIM A;  4GNX A;  3S2D B;  1H9R A;  1PTO D;  2ALY B;  4M8A A;  1LYL A;  1JOR A;  1CUK A;  2F0I A;  3H94 A;  5IGB A;  4C3H H;  3DUZ A;  1N32 Q;  4WRD A;  3NTH A;  4HIO A;  2EYM A;  1PH4 A;  4G7Z C;  1GUS A;  5A2Q L;  1PH7 A;  1WD1 A;  3IFD A;  4R8N A;  3ND9 A;  3R93 A;  2RCF A;  1DOM A;  4A3K G;  2NZO A;  4R4I A;  4A3J H;  4XYO A;  2HD3 A;  1JOQ A;  1G2S A;  1HHV A;  2E2H H;  2GA4 B;  1LM0 A;  1Z6H A;  5KEE A;  3FKI B;  1G6Z A;  4OO1 H;  5IGF A;  4DK6 C;  3PIO A;  4A76 A;  4D6C A;  1KAA A;  1TII D;  5GAH C;  5KRU A;  4B9W A;  5LMU L;  1M1K C;  1CKM A;  1EY5 A;  5IT9 c;  3QOL A;  2VZA A;  4PQX A;  1NR2 A;  4FNF A;  1F1S A;  3TEH B;  1ZYR D;  2EYO A;  1HA6 A;  1RWF A;  3HRZ C;  1IKL A;  1IHZ A;  1Y1V B;  2EY1 A;  4ZLT F;  5IWA Q;  3MHB A;  1G2T A;  4TSS A;  2EE1 A;  1TWH B;  1OXX K;  1UE5 A;  1EIH A;  2RDH A;  1YIJ A;  4A3D H;  1MI2 A;  2XSC A;  1ICF B;  1NMF A;  1Q8I A;  4H02 A;  4PG3 A;  3G7L A;  4JI7 L;  4D6E A;  1HXY D;  1UUP A;  4RH6 A;  1O7Y A;  3D8G A;  4DXF A;  2NTS A;  1XTD A;  3NWT A;  1LOH A;  1DZ1 A;  1S40 A;  1GUO A;  3G6J B;  4QL5 A;  3CCE A;  3S14 H;  1N9W A;  1B7Y B;  2DY7 A;  4TKO B;  3CXC A;  2RKS A;  3CPW A;  1G91 A;  1STE A;  1BF4 A;  2NVT H;  1D7Q A;  4F8M A;  3GTP B;  3DM1 A;  4BBR G;  4CDF C;  2F0J A;  4KTA A;  1CFM A;  1HR0 W;  2XNA C;  4JW0 A;  2V1C C;  2LFN A;  3S1M B;  1VQK A;  5FKA C;  2EQS A;  3GQB A;  2CW0 D;  2RSN A;  2E2I B;  3PF5 A;  2A5H A;  4BBS H;  2QF7 A;  1TWA H;  3HOZ B;  3ERQ A;  5FLX c;  4LFA Q;  1VDZ A;  2EXZ A;  3TBI B;  3IL8 A;  3NQT A;  5CV9 A;  3TP6 A;  1N36 L;  4B3M Q;  3M85 A;  3GTL B;  1ENF A;  2EYP A;  2AKW B;  1PTO C;  1KNE A;  1CA5 A;  1ASZ A;  1AH9 A;  2E8G A;  1W6J A;  4U68 A;  4YWM A;  1DXM A;  1IBM Q;  1X1I A;  2ATW A;  2J4X A;  4N8X 1;  3K80 C;  3SK6 A;  3G48 A;  1K83 B;  2UUA L;  2BCO A;  1TU2 B;  1XNQ L;  5JAV A;  1QUQ A;  4BA2 I;  2OTL A;  2JA9 A;  5LMN L;  3OTO L;  1WTV A;  1RWH A;  5BR8 L;  5AJ3 Q;  2KBN A;  5JPM C;  1DYQ A;  1J0M A;  1EU4 A;  5CV8 A;  2NVQ H;  1B9N A;  3I4M G;  1HTL D;  2RBM A;  3A56 A;  1PH5 A;  5CBE E;  2CWA A;  3HG9 A;  2MO1 A;  4AYB G;  1XTC D;  1XWE A;  3CC4 A;  1V1P A;  1ZYR C;  2HIV A;  4V19 0;  2O5I C;  2KXS A;  3BZD B;  2Q2I A;  4BBS G;  2KCM A;  3I90 A;  4DV2 L;  4XT3 B;  1HM3 A;  4QJF A;  2N88 A;  5TSS A;  4N9P A;  1U0L A;  2HQE A;  4ZAI A;  4GNX C;  3MEF A;  1L0X B;  2XIW A;  5GRO A;  2VB2 X;  1S5B D;  1CI3 M;  2B39 A;  4LUV A;  3DMU A;  1ET9 A;  1WCM H;  2K5Q A;  4JI1 L;  2JK8 A;  1BDO A;  2SNM A;  4IFD J;  4BY7 H;  1PTO F;  4CDD C;  3TQY A;  1SNC A;  4LF5 L;  4OGQ C;  2OXP A;  4OHJ A;  2QA4 A;  3T13 A;  1GO3 E;  2YYZ A;  5IP7 H;  2NUC A;  1N33 L;  2B63 H;  5JJK A;  2A73 B;  1Y1W B;  3HOY B;  2MPM A;  1A6X A;  4B3T L;  3JAM i;  2K5N A;  1S4Z A;  2F0D A;  1F2Y A;  1V1Q A;  3FMC A;  3QB3 A;  4D6G A;  2RCN A;  3S9W A;  1LAB A;  2CW0 C;  4WJ3 M;  2NZH A;  5JOB A;  1IW7 D;  2RF4 A;  4UP9 A;  4GKJ L;  4D6I A;  3PIP 3;  4ZRZ A;  3PO3 B;  2UXD Q;  2F0F A;  2VQF Q;  1SYF A;  4LAA A;  4DUY L;  2UU9 L;  1CQV A;  4DR5 L;  3L9A X;  3T1H L;  5F2D A;  2B8F A;  2CVR A;  3P7J A;  1RWA A;  1K8G A;  2VUM B;  3H0G B;  2EYL A;  4JI5 Q;  4I7Z C;  1UEA B;  3J80 L;  4FF4 A;  1PRT D;  4KLK A;  1SNM A;  4UDU C;  1IYV A;  3M3Y H;  1CHQ D;  1VQ5 A;  1E0B A;  3D6W A;  1E22 A;  2K5V A;  4CJ1 B;  1PYW D;  1TQO A;  2B2W A;  4B3S L;  3FP9 A;  1KIX A;  3A8K E;  1GOZ A;  4L5R C;  4OIJ A;  4A3M H;  5C44 H;  2C9O A;  5KYI A;  1B3A A;  3H6M A;  4KHP L;  5C3X A;  3BS1 A;  3F8T A;  3FRP B;  4DAP A;  4X3K A;  1XJV A;  3ZYY X;  1FNW A;  1BCP B;  2I5L X;  4A3K B;  4CGY B;  1VQJ A;  1HNW Q;  2CH4 A;  4IO9 A;  4DK1 A;  1Q46 A;  4LF6 Q;  4JBW A;  4DKA C;  5EKI A;  3UE1 A;  3NP8 A;  2MNA A;  1SYB A;  1L0Y B;  4WJ4 A;  3F2C A;  1JMC A;  4X66 Q;  1HH2 P;  4KY5 A;  2QIL A;  3T1Y L;  3GTO B;  3TN2 A;  3LWE A;  4ME5 A;  5IYD G;  4A3E G;  1EY4 A;  3OYY A;  1DM0 B;  4QMG A;  2EYH A;  1GUT A;  4LW1 A;  5IY0 A;  4DV0 L;  2HDM A;  1FR3 A;  4PNY A;  2R7Z H;  2ZM6 Q;  1K73 C;  5EGT A;  5FO7 B;  1XPO A;  3PUY A;  1D5M C;  2PQA B;  1LTG D;  1X3E A;  3C1F A;  4TRD A;  4ZYS A;  4BXX H;  1PH8 A;  2WKC A;  4X3U A;  3U9S A;  4M1U B;  2JXM B;  3HKZ E;  2ZXP A;  3RZO B;  1J5E L;  1H9M A;  4FXG C;  1LAC A;  4A3F G;  4RMF A;  3J81 i;  2WFW A;  4A3B H;  3ZJY C;  1HNX L;  1SND A;  4DV3 Q;  5C44 G;  4YCU A;  2IHE A;  3AFP A;  1IBL Q;  3L7Z C;  1UE6 A;  3GTM H;  2NN6 H;  2IX0 A;  2VB3 X;  1YVC A;  3HS0 C;  5T1G A;  3Q24 A;  1F2L A;  1BBX C;  3MVV A;  4DR3 Q;  2CWP A;  4LWC A;  1IW7 C;  2KCC A;  1CKN A;  3PMF A;  3BJU A;  4G4K A;  4JI0 Q;  4FYD A;  5EJW A;  2K32 A;  4G57 A;  1EY0 A;  1EEI D;  2EYF A;  4MTN A;  4KK7 A;  4IFD I;  1PXU A;  3KLR A;  5DEH A;  3H3V I;  5IP9 G;  1VQM A;  3NBI A;  4X62 Q;  3WWV A;  3G71 A;  1PZI D;  1OXS C;  4KKS A;  4BBR B;  5M5W H;  3JAM E;  1PTO H;  4CKE A;  1B44 D;  2DGY A;  4JV5 Q;  3HKZ B;  3Q6S A;  2K75 A;  5G3L D;  1A3U A;  2F0U A;  3BYT B;  2E2J H;  1Y8O B;  3CD6 A;  1JQY D;  1PRT C;  2RHS B;  1NBW A;  5IIF A;  2YU9 B;  3K59 A;  1VQA A;  2UXB L;  1X6O A;  1WTO A;  4C3I G;  1UE1 A;  4AYB E;  4GN4 B;  4U67 3;  3I72 A;  4ALP A;  1CSP A;  3SVM A;  3J80 c;  1U4L A;  2UUC L;  4DAM A;  2ZT9 C;  2K33 A;  2EPB A;  2JP1 A;  3JAM L;  1A2U A;  1VQ9 A;  1OXV A;  3A7L A;  1EGU A;  3UDX A;  2AQ3 B;  5M3F H;  5EBC A;  3D4D A;  1JOO A;  3CME A;  2R93 G;  1FD7 D;  2A69 D;  4NB3 A;  1WTW A;  1I4X A;  1B70 B;  3E0J A;  4A93 G;  3EA6 A;  3U58 A;  3QO2 A;  5CC4 A;  1BKB A;  4PV1 C;  3BYY B;  3K5N A;  3QOJ A;  3I4M B;  1F2M A;  3RR5 A;  1II3 A;  4JBK A;  4LFB Q;  2QW7 A;  1B8A A;  3DLL A;  2XWB B;  4AYB B;  1X55 A;  1XMQ L;  2Z6K A;  2F52 A;  2HHH L;  2K03 A;  4NMZ A;  4FVM A;  1I3Q H;  1E1T A;  3ULJ A;  1E24 A;  1SRO A;  1PYS B;  4GKK L;  2CQA A;  5C5L A;  2MP1 A;  4XT1 B;  3HOV G;  1A63 A;  2B2W C;  5GAE C;  5E3F A;  3K8A A;  1RKN A;  1JJ2 A;  1G6P A;  2BRV X;  2FXQ A;  2KJX A;  1BOS A;  4X64 Q;  5IYB H;  1P16 A;  4D6H A;  3OWF A;  4YHH Q;  1AN8 A;  5IT9 E;  1SAP A;  1D5Z C;  2JEA I;  1V1O A;  3CQZ H;  3QG1 A;  2Y0S G;  3J81 E;  2EJF C;  1IL2 A;  5I2X A;  1TWG H;  4X65 Q;  1F9G A;  3MXP A;  2AQ1 B;  1B4O A;  4IPH A;  1IBK Q;  4FXK C;  1VMP A;  2K50 A;  4ID6 A;  4HIK A;  4QIW E;  2HCI A;  1BBW A;  2AUK A;  3U4Z A;  5C4X G;  2KA7 A;  1CSQ A;  4OWX B;  2ZJP A;  2Q2H A;  1YIT A;  1CKN B;  2NVX H;  1LLR D;  4F88 A;  5DNF A;  2TSS A;  1BO0 A;  1H9K A;  5JEA H;  5ELC A;  3QWN A;  4RCN A;  1K0R A;  3J81 L;  2HUG A;  3S15 H;  4B3R L;  3I4N H;  4DV5 L;  5A35 A;  1EUJ A;  2L9H A;  4HMJ A;  4J15 A;  5K36 G;  4DUZ Q;  4DV6 L;  1ML0 D;  1LTR D;  2A69 C;  5M5X B;  5CYU A;  1HFG A;  2HT1 A;  4A3G G;  4HSP A;  1T5E A;  4QIW B;  1WOC A;  2KUM A;  3JAM c;  3RZD H;  2GVA A;  2Z4H A;  4L5T A;  1OXT A;  2IWH A;  1GUN A;  4BY1 G;  2F1M A;  4B9X A;  4O42 A;  2BDO A;  2FFK B;  4L8J A;  3FEW X;  1JWU D;  2R7F A;  1BVS A;  1STN A;  2F0V A;  4RKL A;  1EIF A;  1QCB D;  4R9W A;  1ZEQ X;  1EFW A;  5IGE A;  1K3R A;  3AQQ A;  3UD1 A;  1QJO A;  2ID0 A;  1G29 1;  2NWG A;  1S5E D;  2H1E A;  4PMC A;  4HJA A;  5BN4 A;  1SYG A;  3I7F A;  1YHQ A;  4JI6 L;  4ULL A;  1WVL A;  2D62 A;  4ME3 A;  4JI2 Q;  4A3E B;  1C7Y A;  3MZ5 A;  3PGZ A;  5C0X G;  4A3I H;  3NEL A;  4DAY B;  1AZQ A;  5G3L F;  5HUR A;  1HUM A;  4IQZ A;  4IUU A;  1TWC H;  1MJC A;  4CJ2 C;  1VQG A;  4DV1 Q;  1H95 A;  1F9Q A;  3D3R A;  3AFQ A;  4DF7 A;  2B3G A;  2VXW A;  2M00 A;  4LF8 L;  4DV7 L;  5JEA G;  1HZC A;  4NW2 A;  5A2Q E;  1N34 Q;  4BWG B;  1N7O A;  5COY A;  3FPP A;  2R61 A;  5FK9 C;  1HNZ L;  3OW2 A;  2QEJ C;  2NB0 A;  1MD2 D;  3GP7 A;  2RDF A;  2JEB I;  4POF A;  2D5D A;  3R8B A;  2PW5 A;  2NVY B;  5IYC H;  2VQE Q;  2BRP A;  1C8C A;  2EY5 A;  2KCT A;  4A3F B;  1KDB A;  3MEH A;  4LJZ C;  4Q5V A;  3MC0 B;  1C4Q A;  4TQU S;  3QIA A;  1OTC A;  2BDN A;  3L0O A;  3FDT A;  2JA6 G;  2BA0 A;  1J6Q A;  1TY0 A;  4YY3 Q;  4L63 B;  4RGO S;  4OEM B;  2SOB A;  4IJL A;  2PZU A;  3MXU A;  1H9S A;  1M4V A;  1LTL A;  1FYC A;  2ZXR A;  4JOI C;  1F9S A;  2ZTC A;  5KNB A;  3M4P A;  1BXT A;  2OT2 A;  1HQR D;  3GTG B;  1HR0 L;  3Q0A A;  4HJ8 A;  3IRB A;  2Z6K C;  4OX9 L;  3X3N A;  1G8Z D;  2VL6 A;  3G4S A;  1VQP A;  5E4X A;  4GLA C;  3ITP A;  4K8I A;  4E6I A;  3VR2 A;  3CCJ A;  1XNR L;  1MSG A;  3KF6 A;  1KRS A;  1I6H B;  4X6A H;  2JA7 H;  2L5T A;  1STH A;  2QGQ A;  4GLV B;  1PFS A;  4C1N K;  3S1Q B;  1ZKO A;  5KNC A;  2F0H A;  4DK0 A;  2DY8 A;  4FDB A;  4IOC A;  2RVL A;  4G7H C;  3AU7 A;  3S1N B;  2MO0 A;  2WAC A;  5LMN Q;  3OTO Q;  2XN9 C;  3CRL C;  3I8Z A;  4CDE C;  3GV3 A;  4C3I B;  4DR7 L;  4X3S A;  5GAD C;  3EBE A;  4D72 A;  3J81 c;  2I07 B;  5ELE A;  2F0L A;  2FHT A;  1VQC A;  1SYC A;  3LX0 A;  1SYD A;  1TS2 A;  1Z7T A;  1XXG A;  3C3L A;  3HOW G;  5IYC G;  3TRE A;  4HJ7 A;  3HEJ A;  4KHV A;  5CR3 A;  1PFN A;  4GS3 A;  1N7N A;  4NXM L;  5D14 A;  1SFO B;  4JYA Q;  4JI8 Q;  4PMW A;  4QF4 A;  2R93 B;  3GTM B;  3E0E A;  4J1M A;  4A93 B;  1SDF A;  4EVO A;  3GTK B;  1SJE D;  1I8Q A;  3UD2 A;  2JA8 H;  2TMP A;  3J80 i;  4JI4 Q;  2F4V Q;  5IOC A;  1MJE A;  3E3X A;  2A1A A;  4C3H G;  5J39 A;  2LKV A;  3DWP A;  3OPO A;  1VQH A;  4DNI A;  5EPL A;  4Y7N H;  1IYU A;  3J7Y W;  1Q3L A;  1X1J A;  3LGJ A;  1QOH A;  4A3J G;  1PTO B;  1STY A;  1M90 C;  4LF4 L;  5EAY A;  1ET6 A;  5EBD A;  3S1R H;  1PVO A;  3M4Q A;  2Y0S E;  3HKS A;  4L5Q A;  3S2H H;  2IT1 A;  1PH3 A;  5ELD A;  4ZUI A;  2XWJ B;  3HGB A;  1YNN D;  3UI2 A;  4QQB X;  1M8A A;  4OO1 G;  2KXR A;  2FJ2 A;  3PUZ A;  3I3C A;  3W1B A;  4DV4 L;  4IZ8 A;  2SDF A;  5J3B A;  1HZB A;  1BQQ T;  1K0S A;  2LXJ A;  5C3E H;  1V43 A;  1SE2 A;  1WTP A;  3HOV B;  2CHB D;  4KV6 A;  4UHV A;  1FL0 A;  1KDC A;  1S72 A;  1LTA D;  4KKT A;  1S5C D;  5LL6 X;  4RGN A;  3TDQ A;  4RAU C;  4ZUJ A;  3NUC A;  3VYR A;  4D6F A;  4ABN A;  4R4T A;  1Q12 A;  1IZ6 A;  5E7N A;  4A3D G;  1EY8 A;  3KF8 A;  4UY8 C;  2QKI C;  1NUC A;  1A2T A;  1WJJ A;  2Y0S B;  2BRW A;  2PI2 A;  2MFI A;  4OXP A;  3VDY A;  2Z1C A;  3A7A B;  1KHI A;  2R92 H;  3CCL A;  1EQR A;  1Q1E A;  1VQ7 A;  3F59 A;  4BS9 A;  3BDO A;  1N32 L;  2RHQ B;  5T1I A;  4POG A;  3CW2 C;  5J1Z A;  1E2Z A;  2M2L A;  5ELF A;  3IAY A;  4MZ9 A;  2PZT A;  4L5S A;  2WAQ G;  4GNX B;  1YHA A;  3HOU H;  3HOX H;  4P73 A;  4B08 A;  3TRZ A;  1SE8 A;  5C4X B;  1I94 Q;  1UAP A;  3TP7 A;  1O7L A;  3PO2 H;  4C3J B;  5JVH 3;  3DEP A;  3I70 A;  4FF3 A;  4AQY Q;  1XYI A;  1BUV T;  2E75 C;  2EJG C;  2IX3 A;  3M4O B;  2UUB Q;  3WOF A;  1YNX A;  3MWY W;  4EX5 A;  4DR6 L;  1U4R A;  3GTQ H;  1O7I A;  1S3O A;  1JE4 A;  5ISR A;  1F9R A;  4ZK9 B;  1WD0 A;  4A3G B;  3SK5 A;  5IWA L;  1VQ6 A;  3P75 A;  3U7V A;  3OW7 A;  5C4J H;  3VYU A;  1SE4 A;  4BY1 B;  2DUD A;  3G6E A;  1NMG A;  1PH1 A;  1EL0 A;  3W2D A;  1RW9 A;  1VF5 C;  4L6T B;  3NTI A;  3T16 A;  1PMR A;  2JJQ A;  2VS1 A;  4HCS A;  5BN5 A;  4APV A;  4IUT A;  1ESR A;  5LL6 S;  1LT3 D;  2OEO A;  3J80 E;  1L1O A;  1U4P A;  1LXM A;  1YNN C;  1O80 A;  4MN3 A;  3HOU G;  1K8A C;  3VR6 A;  2IY5 B;  4IUN A;  1Q81 C;  3CCU A;  2N55 A;  4JVZ A;  1LUZ A;  1E7Z A;  3K7A B;  3PO2 G;  1KXL A;  1NJI C;  4RFB A;  5I6Y A;  3K58 A;  4DR2 Q;  1U9R A;  2B2Y A;  3I4O A;  4S3S A;  2F3I A;  4I65 A;  5C3W A;  3K57 A;  4IOA A;  1EWC A;  1SN8 A;  3SDZ A;  4P71 A;  4LFA L;  1Q86 C;  1AEX A;  2VW9 A;  4B3M L;  4IAL A;  2OF1 A;  1Y69 U;  4A3L H;  2RA4 A;  2KVM A;  2YTV A;  5I9P A;  4XQQ A;  1IBM L;  5DLQ E;  1VQF A;  2JA6 B;  1VQD A;  4DAV A;  1STA A;  1Y14 B;  2E5L Q;  1WCM G;  2ZXO A;  4MIU A;  1SNQ A;  2KHS A;  4Z9C B;  4BY7 G;  1HFN A;  2JSO A;  3K7U C;  3D0F A;  5HGQ A;  3GO5 A;  4IPC A;  4UP8 A;  1PA6 A;  2RDG A;  5IP7 G;  2B63 G;  3SK8 A;  5M3M H;  4H13 C;  5AJ3 L;  1XPR A;  1D8L A;  1KRT A;  5DM6 3;  1R4Q B;  2L12 A;  3MXG A;  1IL8 A;  1QG7 A;  1J9O A;  3GTJ H;  3U9O A;  1LTT D;  5M5Y B;  1LO5 D;  1SBB B;  3EFX D;  1X65 A;  1R9T H;  2MUY A;  2JA5 H;  1C9O A;  3S2D H;  2N49 A;  1B2T A;  4F87 A;  1K8M A;  3DM3 A;  1QUQ B;  1IKM A;  4JBM A;  1Y8P B;  4IUQ A;  2XVS A;  3K81 C;  1AE3 A;  1GKH A;  3S16 B;  1GUG A;  2IJ0 A;  2MQH A;  2QEX A;  4NP5 A;  4IFD H;  3URY A;  3H3V H;  1V8Q A;  1WTH A;  3HOW B;  4NPS A;  2K04 A;  1AE2 A;  1HZ9 A;  1PH6 A;  3NHH A;  4D6J A;  3A0J A;  2WMG A;  1KTK A;  4FF1 A;  3K0X A;  1D1I A;  3FKI H;  1FJG Q;  4V0B A;  1V1P B;  1YBY A;  2JQO A;  3UDG A;  2HCC A;  2WV6 D;  3NBH A;  3DHQ A;  2CKZ B;  3KDF A;  2PPB C;  1YNJ D;  2Q8R E;  1LT6 D;  4A3M G;  5IGG A;  1PRT B;  3BDC A;  4C3H B;  4A3C H;  2L55 A;  5CV4 A;  3MTS A;  1I4Q A;  1VQN A;  1Q1B A;  2EOT A;  5CV7 A;  2F0W A;  3PSI A;  4OIK A;  2D0O A;  2EY2 A;  4A3J B;  2F0G A;  2PNR C;  3M4Y A;  5JJZ A;  1Y1V H;  2E2H B;  3EJI A;  4O2D A;  2UXC Q;  1TWH H;  1KQS A;  3PCO B;  1SXT A;  1HMW A;  1CK1 A;  2XTI A;  4QY7 A;  2JA5 G;  2K1B A;  2G9H D;  5E4W C;  3BU2 A;  3HFZ B;  1UNS A;  3U4V A;  3X3M A;  4FXD A;  2UXD L;  4H0L C;  4D1I A;  2VQF L;  2L1B A;  4DLO A;  2IX1 A;  1EYA A;  1X56 A;  2WAQ E;  3BVM A;  5E1F A;  4KN4 C;  3KLW A;  2YTY A;  1HTP A;  5IE8 A;  4LF7 Q;  2R7Z G;  3J7Z C;  1EY9 A;  4JI5 L;  4DFA A;  1A0I A;  1PHJ A;  1LTS D;  4BXX G;  2VY3 A;  4NXN Q;  5KYL A;  1YI2 A;  1MIU A;  4DR1 Q;  3A54 A;  2G9D A;  2H5X A;  3GTP H;  1PYB A;  1PDQ A;  4A3D B;  3RN5 A;  4C56 C;  5EKL A;  2V4D A;  5EPK A;  3SK4 A;  1FGB D;  1G51 A;  1ENC A;  4A3B G;  2X03 A;  1SMY D;  1NE3 A;  1CZW A;  3KFU A;  3S1M H;  3ONA B;  1C82 A;  3ULL A;  2JN4 A;  2NBF A;  1PLF A;  2E2I H;  1QZG A;  4LF9 Q;  3J7A F;  4A3C G;  5C0X J;  2NN6 G;  1L1O C;  3HOZ H;  2B2T A;  3TS2 A;  3S14 B;  4KMU C;  1C0A A;  1GD7 A;  1WTQ A;  4N8F A;  2WAQ B;  3D4W A;  1MBY A;  1HNW L;  2Q2T A;  2CQO A;  4FP5 D;  3GTL H;  4F7X A;  5IGC A;  1TWF H;  4LF6 L;  5JEA J;  4GOP A;  2NVT B;  1B53 A;  3T51 B;  1RDP D;  3PIO 3;  2Q2U A;  4JOI A;  4OWT B;  4ODG A;  4FO2 A;  2Q8I B;  1F77 A;  3J81 j;  1NSN S;  3OIQ A;  4X66 L;  2B2Y C;  1QZH A;  1OXU A;  2WMI A;  1W6K A;  3J7A 5;  1K83 H;  1STB A;  1SEB D;  3KK7 A;  1B9M A;  4BBS B;  4ZKC B;  1I50 H;  3A55 A;  4D1J A;  1LV9 A;  1TWA B;  3RUZ A;  2WP8 J;  2ZM6 L;  2BH8 A;  4HR7 B;  4IPD A;  4CDC C;  4BA1 I;  2WMF A;  3NSW A;  1CA6 A;  1Z47 A;  4IUR A;  1RHP A;  3WOE A;  1KAW A;  5KND A;  1KD1 C;  1YNJ C;  4K14 A;  1SLJ A;  3V2T A;  2N3S A;  2MGS A;  4A75 A;  2PMZ E;  5FLM H;  2N8N A;  3SHL A;  3FVQ A;  2NTT A;  4R8I A;  4DV3 L;  4PZ7 A;  1YJN A;  5M3F G;  3PIP A;  1CKO A;  1B50 A;  3HOZ G;  1LTI D;  4LFC L;  4K0K Q;  3CHB D;  3LWU A;  4DR3 L;  1ENA A;  2J7Z A;  5HGT A;  2PCF B;  3R2T A;  4JI0 L;  3KJO A;  5FJ8 H;  2NVQ B;  3WDN A;  3NBH B;  4HAE A;  3I2Z A;  2AQ2 B;  4DR4 L;  4JV5 L;  1J0N A;  2FMC A;  2A68 D;  3A8J E;  2Z0S A;  2PMZ B;  3E9H A;  1HA5 A;  4GN5 A;  2H4O A;  3HOY H;  3A5U A;  3EIV A;  1YJ9 A;  4RGT A;  4EQP A;  2XRQ D;  1HM2 A;  1A3T A;  3TZD A;  4RGM A;  1IXR A;  4HID A;  2F3W A;  2E24 A;  4KKU A;  1AW7 A;  1Q8K A;  1SMY C;  1TR5 A;  5K5P A;  2B2V A;  4RHR A;  1XX8 A;  1HUN A;  1CHP D;  1WCM B;  2ENB A;  3KBT C;  1GJX A;  2K52 A;  4HMI A;  1K3B C;  1JJG A;  1FGU A;  1HMU A;  1KLU D;  4BY7 B;  3PO3 H;  2D2C C;  3RLN A;  1DGS A;  5IYB G;  5LMU Q;  3KBX A;  4IPG A;  1FNV A;  4RKB A;  1HZA A;  5JJI A;  2B63 B;  4K6D A;  4HJ5 A;  4DR7 Q;  1SRU A;  4XIG S;  4GLX A;  3C2P A;  1YZ6 A;  4OL7 A;  3OHX C;  1OJN A;  2VUM H;  3T53 B;  3H0G H;  4JCV E;  1CTM A;  1VQI A;  1AZP A;  1ICW A;  5DM7 3;  1ILQ A;  4DN4 M;  1MGS A;  3CF5 A;  3NPP A;  4WOR A;  5C4Z A;  2ZTD A;  1QVG A;  2WMJ A;  4JI3 L;  5C0X I;  4LFB L;  4YIJ A;  1HQM C;  3BZC A;  3VR4 A;  4JI7 Q;  1EQV A;  1J8I A;  3MAQ A;  4D6D A;  5EPJ A;  2B2U A;  5J22 A;  2LMC B;  1RTO A;  1QNU A;  5CMD A;  4K5V A;  1NCV A;  2HDL A;  1SJH D;  3CRK C;  4LUZ A;  3FHW A;  2F0T A;  4IUP A;  2OQK A;  4A3K H;  3H91 A;  2KEC A;  3I91 A;  4HTH A;  1X3G A;  1SMX A;  3BVG A;  2EVB A;  1MKH A;  3M3Y B;  3I4N G;  4EQ5 A;  3H09 A;  4HJ9 A;  3OMC A;  4ZCK A;  1GM5 A;  2R6G A;  1PH2 A;  1EIY B;  1U4M A;  3UE0 A;  3GTO H;  3ER0 A;  4DV4 Q;  1WFQ A;  4A3M B;  5C44 B;  3PO3 G;  2B2T C;  4X64 L;  1KL9 A;  5FLX L;  1N7Q A;  4LUO A;  4C2M H;  2MHV A;  4YHH L;  4G7O C;  2WB1 G;  1XPU A;  2KHJ A;  2HIX A;  3RD4 A;  2KEE A;  1D2B A;  2KHI A;  1N36 Q;  4KJO A;  4GOP C;  4X65 L;  2VUM G;  1HN0 A;  1EU3 A;  1IBK L;  3N52 A;  3K5M A;  2K01 A;  3AMU A;  4YWL A;  2ZJQ A;  1E1O A;  1XMO L;  3PUV A;  1DON A;  2A68 C;  2KED A;  2JA5 B;  1B1Z A;  1RWG A;  3RZO H;  3TP8 A;  1EQQ A;  3CCS A;  3ERS X;  4JK1 C;  5BN3 A;  3HZX A;  2UUA Q;  4A3I G;  2Q1F A;  1XNQ Q;  3VA5 A;  3BZK A;  2OTJ A;  3R3O A;  4CKC A;  4RCO A;  2R7Z B;  5C4H A;  1SSO A;  3AEV A;  3GV6 A;  4XQJ A;  3L3O C;  5BR8 Q;  1F9P A;  2K14 A;  2K5D A;  5FO8 B;  1DCZ A;  4WFN 3;  1LT5 D;  4LMQ D;  5CGK A;  1X3P A;  3MXN A;  3TS0 A;  2WDA A;  3GD7 A;  2N78 A;  3V96 A;  4DUZ L;  4BBR H;  2WKD A;  1EYC A;  1TS4 A;  4HCE A;  4O0A A;  3Q22 A;  4DLQ A;  2ASB A;  4A3B B;  2LS0 1;  4EQO A;  2EIF A;  1EFI D;  2F0P A;  3S17 H;  1U5K A;  4R4O A;  3PQI A;  2WIN B;  1CQF A;  3NEM A;  1UE7 A;  1KDA A;  3OIP A;  2LXK A;  4DV2 Q;  1JE5 A;  1WTX A;  4DR6 Q;  2YU9 H;  2I46 A;  5IOD A;  2DJF C;  1QVC A;  3AYH B;  3KLS A;  2BH2 A;  2A8V A;  3H3V C;  2F0Q A;  3A5Z B;  1A8V A;  2O4X A;  3U50 C;  3B6Y A;  2B8G A;  5M5W B;  4J8Q A;  4KY7 A;  2F0N A;  1EWH A;  2PNH A;  4O1N A;  4NDX A;  4JI1 Q;  1PV4 A;  4JI2 L;  2D0P A;  4LF5 Q;  2JA7 G;  1JWS D;  1VQ8 A;  2L11 A;  3J7A V;  3CCV A;  4OO1 I;  2E2J B;  3AB9 A;  2E74 C;  3TP5 A;  4DV1 L;  1VQE A;  1N33 Q;  3M7G A;  2PYK A;  4CHT B;  2PW7 A;  3D31 A;  2A6H D;  1TKW B;  4B3T Q;  4QUC A;  4DA2 A;  2YTX A;  1N34 L;  3Q23 A;  2X6L A;  4H44 C;  2B2V C;  2HQL A;  3STB D;  1T5X D;  4MNO A;  3I4M H;  1RTN A;  1ESF A;  1PZJ D; 
#chains in the Genus database with same CATH homology
 3PQI A;  3QR8 A;  4MTK A;  2KXR A;  3UD1 A;  4DLQ A;  3KBT C;  4D8O A;  3KBU C;  4DLO A;  4UHV A;  2P5Z X;  3F59 A;  3UD2 A;  2KXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...