4D6DA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the blood group a-trisaccharide (x02 mutant)
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
586
structure length
586
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTESYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 219
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6dA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6dA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6dA02
1CENA 3W82A 2CBIA 3N18A 2WMFA 2DSKA 2WHJA 4AIEA 1JZ3A 1E5NA 1E56A 1WZKA 4HMCA 1CZ1A 3BSGA 2NW0A 1Q6DA 1XV8A 3MV11 3WF1A 2QMKA 2D1ZA 4CVWA 1E0XA 4JCLA 3KL3A 3RILA 4CCDA 3CMJA 3NSMA 3DYOA 1CBGA 3CZLA 2VQUA 2ESCA 3EDKA 2ZWZA 2EXOA 5I77A 4OKDA 2PWDA 1ZS2A 2FHBA 2XWEA 1QI0A 3KE0A 3VIMA 3POCA 1WE5A 3SCVA 1XD1A 4OBSA 4IPNB 3MUIA 2J4GA 3WNPA 4PEEA 3ZSSA 4TX8A 5HPCA 1HN0A 1UWRA 3PTQA 1XD0A 1NP0A 1HVQA 2X2YA 4PTMA 1UD3A 2A3HA 1AMYA 2ZUNA 4AISA 1E6ZA 3MU7A 2D3NA 2WZIA 3WD0A 1E9LA 1QI4A 3LPGA 4MB4A 5JBFA 2WHLA 2WMHA 1EXPA 3PZ9A 1HJSA 5HNNA 2VTFA 2WCGA 1WAWA 3LPFA 2A3CA 1GZJA 1UQZA 3M7SA 1XYZA 5FIPA 4TTUA 1RP9A 1BQCA 4CD8A 4MNKA 2WHKA 3AMDA 3T0AA 2B31A 3TA9A 2G3MA 3K46A 2DIEA 3MMWA 3VX0A 3WNOA 4P7NA 4XZBA 1W1TA 4RE4A 4LYPA 2RGMA 3TP4A 3SUVA 3GNRA 3F4VA 1EA9C 3WL1A 4JCMA 2W5FA 4KH2A 4C7DA 5I0DA 5CJ5A 3VTRA 5ABFB 3WQWA 1E5JA 3AICA 2X1IA 3BLPX 1W9VA 3WY1A 2VQTA 1ISWA 4WK9A 3MANA 5M3WA 3K4DA 1R85A 2WMKA 1DWAM 1D2KA 4H2CA 3WFLA 2QPUA 1QNOA 4ZXOA 3VDHA 3L4UA 5EMYA 1GJWA 5C71A 2BXZA 3IJ9A 3G6MA 2BRPA 1CGUA 1FP8A 2J7EA 1V6UA 1EOKA 1PIGA 2VZVA 1KGXA 2W4XA 3PZMA 4U2YA 1JZ7A 1D7FA 1Q4NX 1VFUA 3WSUA 3FNDA 1OGSA 4DWSD 3IAPA 1XH0A 4UFHA 2NT0A 3PZVA 4JKMA 3EBVA 3SCTA 3VOCA 1EGZA 1LG2A 5AYBA 3VD9A 1VFOA 3N15A 1GVYA 3WDPP 4HZ6A 3CUJA 1J0IA 3O6AA 1HP5A 2D0GA 1AQHA 2XSAA 3N12A 1MXDA 1JNEA 1V6VA 4YHGA 3EDJA 4PMRA 4NI3A 2EPNA 1E6NA 4CGTA 2VR4A 3EDFA 1E0WA 1B31A 3IJ8A 3WDHA 1LXKA 3BC9A 2JF6A 2PWHA 1LL6A 3CUIA 5GNZA 2JFEX 3UCQA 1VENA 3PZTA 4E8DA 1HKIA 3CLWA 4W87A 1HJWA 4U31A 1ZBKA 4MDPA 1OGGA 3ZT7A 3AMLA 1XCXA 1HKJA 4XB3A 1XSIA 1OIFA 2E24A 3ARTA 3NDYA 1W1VA 3ARWA 5E0FA 1EO7A 1JYXA 2OSYA 3SURA 4D6GA 2VT0A 3CUHA 4UOJA 3TTYA 2WKLA 3RMEA 4ZFMA 3VINA 4EANA 5KZ6A 2J77A 4R27A 4LYQA 5LA1A 4MPKA 1GNXA 1X6LA 3PZNA 5HPOA 1JF6A 4J3WA 1K6AA 4PRWA 3THDA 2QLYA 4YPJA 3PHAA 2VOTA 1TA3B 2ZUUA 5CPTA 4B16A 3NUKA 1H11A 3MS8A 6TAAA 4J3TA 3W0KA 2D20A 2BXYA 1BYCA 1BG9A 4GZEA 3WD2A 1VJSA 2ZUTA 3ARRA 3T0DA 1PBGA 1UR0A 3FHAA 5CGMA 4TVCA 4FLSA 3AFBA 3WF2A 1V6XA 1SMAA 2YOCA 3DYPA 5A6MA 1OGBA 3UETA 1FP9A 5JBEA 2WVSA 1YQ2A 2WC4A 1FA2A 1VFMA 4IM4A 1WDQA 3QR3A 4NF7A 4GQRA 3AHVA 1KXQA 4BA0A 4QCEA 4PUEA 1F9GA 3AS0A 3A3HA 2VMFA 4OIFA 5LA0A 1DP0A 1AQ0A 5BRQA 1H0IA 2ZX6A 3ZM8A 4HPGA 3VIKA 1HVXA 1VJZA 2XTKA 2J7DA 4CD7A 2XVNA 1C3FA 1UD6A 4MDOA 3KWXA 4W7WA 1CEOA 2G3JA 1ZJAA 2W91A 4P8UA 3TTQA 3QOMA 3WNLA 1EDGA 5D9NA 1E1EA 1J12A 4Z2JA 3ARVA 1HF6A 1JZ6A 1UHVA 4PMVA 4UQDA 5A6BA 3UEQA 1TE1A 1H09A 1VF8A 3PTMA 4AZBA 4U3AA 2QV4A 5BXSA 1E3XA 1RH9A 1QNRA 1EOMA 1ZB5A 1ITCA 1Y7VA 3SCOA 1W1YA 3BAJA 3M07A 2UY2A 4DWSA 1EDQA 3E1F1 1H0GA 5D4YA 4CU6A 1QHPA 3B8SA 4ATDA 4BQ5A 5CLTA 2DT2A 3AZTA 1WDSA 1E6SM 1G9HA 1TMQA 1VRXA 2DQXA 3ZJKA 1PEZA 1E40A 4H8UA 3AZSA 2ZUWA 1JZ2A 2WLZA 3OLDA 3ZJ6A 3T2QA 1EQPA 1TVPA 1HJQA 4YHEA 2OYMA 4CU8A 1DWHM 1W9UA 2WNWA 3VGFA 3VPLA 3OBAA 4B9YA 3RJYA 4JFSA 4AW7A 3L4VA 2Q1FA 3CZKA 2DSUA 2WBKA 3WF4A 5A3HA 1KBKA 1JYVA 2ZXQA 4QAWA 4TVUA 3AHXA 3I3DA 2GVYA 3BGAA 4UFIA 1BGGA 1JFHA 4H8VA 3W25A 3B9EA 2GJXA 4L4PA 3FXYA 4HMEA 4PTXA 1HMWA 3AHTA 1LWJA 2ZUMA 4ACYA 2VX6A 1J10A 3AIBA 1HNYA 5A8PA 1JG9A 3SCQA 4HA1A 1XSJA 1CIUA 9CGTA 1GOIA 1E6QM 1QBAA 1D3CA 5BXTA 2DIJA 4UTFA 4K68A 1GOWA 3QGVA 1BVNP 4JFWA 1W3HA 1ISZA 1E6XM 4QLKA 1BYBA 1CXHA 1B90A 1NARA 3WF0A 4ACZA 1R86A 3ZIZA 3B9DA 2AOSA 2BV9A 2IXVA 1OD0A 1WZAA 4EK7A 4PCSA 2E22A 4QFUA 3AS2A 1E6RA 1OJMA 1NOUA 1HKKA 1JFXA 1KB3A 4CVUA 3SUTA 2X05A 4KRTA 3GXIA 3A4WA 1CGVA 4BCEA 2G4FA 2Y2WA 1ISXA 3ZOAA 1B3VA 5GNYA 1NP2A 2XJ7A 4AIOA 4F9JA 4HP5A 4FF5A 3CZGA 1SYTA 2VVNA 4JZ5A 3DECA 3WD3A 1KGWA 3BMVA 1SR0A 4UFJA 3M46A 5JUVA 4JL2A 3GM8A 4W8LA 1BHGA 3NJ3A 1VIWA 2W62A 3IANA 2BVTA 4UNIA 3RJXA 4CD5A 3UG5A 4HOXA 2VRKA 2XG9A 4PTVA 3AROA 4UQEA 3L4XA 5A6KA 1WNOA 3WD1A 3ZJ8A 4QLJA 2D22A 2XFFA 4GO8A 4BQ2A 1JZ8A 1JD9A 3GH4A 1B3XA 1CDGA 2GSJA 1PX8A 3A4XA 4GO9A 2XGBA 5C8BB 1W32A 3AIQA 3HJEA 3DC0A 3U5YA 5JBDA 1W9BM 4X9YA 1OM0A 2ZWYA 1HJVA 2JE8A 3VIGA 3ARSA 4LYRA 1US3A 3WDJA 3S6TA 1IV8A 7CGTA 4IPLA 2CYGA 2QPSA 2CEQA 1X1HA 2O9OA 4AZ5A 3SUWA 4AYSA 2E9MA 2WMJA 3UR7A 2YDQA 4XUYA 4XV0A 1FHLA 3VGEA 1E43A 2X0HA 1VFFA 4X0NA 3AXXA 1K9DA 2TAAA 3G6LA 4D72A 2WLYA 3WQVA 4HTYA 5DF0A 2VX5A 1QHZA 1W2PA 3LPOA 3L4TA 1V6YA 4P8WA 1CNVA 4GPNA 4H41A 2DPEA 4AZCA 3ARQA 1E73M 1M01A 2ZXAA 1U30A 1GW1A 1UZ1A 4OZOA 3AJ7A 1XH2A 1OJPA 1EGUA 1VBUA 2FHFA 3EDEA 3WQ8A 4PMUA 4H7VA 1PPIA 1KWKA 1X1JA 1SMDA 1JI1A 2O9TA 4JKLA 2BS9A 2ZX9A 4U3CA 4W8AA 2J47A 1C7SA 2YA2A 3ZO9A 2BVYA 4KGLA 3CGTA 1QI3A 2GFTA 4B9ZA 1TG7A 1KGUA 3PZUA 4CD6A 3WEZA 5DMYA 1UKSA 4LGXA 1G01A 1UYQA 2YA1A 4E8CA 2D3LA 1ESWA 2CXGA 3ZR6A 3L4WA 4Q22A 3LMYA 3NDZA 2WK2A 5DEZA 2OSXA 3POHA 4LQ1A 3BMWA 1X6NA 4D6DA 2DT1A 3CZEA 4WJXA 3THCA 1LL4A 2XYLA 3WUEA 3VIIA 4PUDA 1YHTA 1A47A 1MWOA 4JHZA 2XHYA 3RM8A 1B2YA 2XVLA 1QI2A 5DT5A 4A3HA 1RWFA 1NOFA 5LYRA 1KXHA 2WBGA 2WZEA 2EQDA 3OLIA 3WDIA 1WP6A 5HXMA 1GHRA 3NYDA 4U5IA 2YL8A 1B9ZA 2EPLX 1V0MA 3U5UA 2ZXDA 1DWGM 4WKHA 5EB8A 3N04A 4H04A 2ZICA 3DYMA 3VUPA 1B3YA 3FAXA 4JHOA 3AMKA 3N17A 2HISA 3BCDA 2WB5A 4J3VA 1K9TA 3L4ZA 2V3FA 1V3JA 5A8MA 2XPKA 3IK2A 2YDRA 3WIJA 5CGTA 4DUVA 3T09A 1M04A 4U5KA 5ABGA 3WDRA 1HJUA 4QDMA 1XC6A 1FFRA 5A8NA 5AC4A 1C7TA 3AYSA 1J01A 2YLAA 5IFPA 1QOXA 2J7HA 4UOZA 4MJ2A 4S3JA 4UCFA 3VIHA 4AD4A 2OWXA 5E09A 7TAAA 3MUAA 2FGZA 4P7LA 1UR8A 4CD4A 3SCRA 2DSZA 3KL5A 1TVNA 1LL7A 3WH6A 5E0CA 1ISVA 1V3LA 3VGGA 1OIMA 1H4PA 1HT6A 2CERA 2CKRA 3SCUA 4Z2KA 3WH5A 1HXJA 3O2LA 2VRJA 3APGA 3TTSA 4EAMA 2DH3A 3MUZ1 1TR1A 3KL0A 2WDAA 1PIFA 4CCCA 1LJYA 2WHMA 3WMBA 2ZX5A 2J7FA 2DSWA 5ABFA 3DHUA 2WMGA 4HZ7A 1OWQA 5BWFA 1FH7A 3VD7A 3SCNA 3ARXA 3HN3A 1UKOA 4TTGA 1BPLB 4U33A 1GONA 1Q6CA 2GK1B 1TUXA 2YIHA 2WCAA 1UKPA 1UKTA 3CHFA 1CGTA 4UQAA 3ZMRA 8CGTA 3VO0A 4HPHA 1C8QA 1Q6EA 3T2PA 3AZRA 4DM2A 4KWUA 4MNJA 1WCGA 3WL0A 1H1NA 3VKKA 1ISYA 1FH9A 1H49A 1C91A 2QMJA 2JEPA 3WH9A 1JF5A 2VURA 3WQ6A 1XSKA 1LOHA 5AY7A 2W61A 1IZKA 3A4AA 2PF0A 1F4AA 4HZ8A 1UH4A 4MAVA 5JIWA 1LWHA 1B30A 3K1DA 5A1AA 1O7AA 3BAKA 1W91A 4M56A 4KGJA 3K8KA 2A3AA 1QHOA 4M24A 2A3EA 3MMUA 3AQUA 4AEFA 3UR8A 5CLWA 4WSJA 4DM1A 2BHYA 5I78A 3PBGA 1W2VA 3W37A 1UR2A 1KWGA 1W9PA 2ZXBA 4AZHA 3T0BA 2YL6A 1QNQA 2XVKA 4WSKA 1GQJA 4UFLA 1BYAA 1NH6A 5D9OA 3VM7A 1NM9A 3K4AA 1U2YA 2BY3A 5LA2A 1G94A 1CLXA 4A4AA 3FAWA 1BVZA 3VDAA 2RGLA 1Z32X 2FH6A 5BXRA 1I1WA 1NQ6A 3W26A 3WH8A 1V3IA 4F66A 3N13A 1HN1A 5CZKA 2AAAA 1UD4A 4P7QA 3WF3A 2WMIB 1CPUA 4IUGA 3GXFA 3I3BA 1RWHA 2VZSA 3WMCA 1ECEA 4URIA 1E1FA 1AQMA 2WVVB 4W7VA 4PMOA 4J28A 1TA3A 3BAXA 2W63A 3ZT5A 4HA4A 2VO5A 5M03A 3VIFA 1WZLA 4V28A 4N0RA 4WIWA 4AD5A 1QNPA 1RD6A 4WLCA 5IXEA 3VDBA 3DHPA 1ZJBA 2HVMA 3OB8A 4F8XA 3RCNA 4PMQA 2Z1SA 4TX6A 3PN8A 4ATWA 1UA7A 2ZE0A 5JIPA 1MFVA 1OSEA 1G5AA 3KEHA 4F9DA 5IHRA 3F5LA 5A95A 3ALGA 1B0IA 2XIIA 4GI6A 1JDAA 5GPRA 2XVGA 2G3NA 4HU8A 4HU0A 1CWYA 1MW3A 2CETA 1BG4A 2E8ZA 2W92A 2Z1KA 1B3ZA 3WELA 1I1XA 5E70A 2J8FA 2MANA 4YN5A 3CZ8A 3O9NA 5I79A 1LF1A 3GXDA 1NWRA 3L2LA 2JEQA 2DH2A 3CZJA 1MXGA 4M80A 3PZGA 4LPCA 3NSNA 3SCSA 5DO8A 4J3SA 3WDQA 4AZGA 3RIKA 5HBFA 3AIRA 4FMVA 4BQ3A 2UY3A 2VZTA 2PC8A 4M81A 3RO8A 1RWGA 4GINA 2XUCA 4PMDA 3QHOA 5I2UA 1E6PA 1QBBA 1E0VA 2WVTA 1RWAA 1GORA 3AIUA 1UG6A 2VX4A 1V02E 2WZHA 1JNDA 5D8ZA 1W3JA 4W8BA 4WKFA 3BH4A 1CYGA 1ZBCA 1VEMA 1GOOA 2XM1A 5AYIA 2YBUA 4H8HA 1WPCA 3TOPA 3VGHA 3WFZA 3AIEA 2VRQA 4IISA 3W81A 1LLOA 2V3EA 3F5KA 4U2ZA 1QNSA 1V08A 2F8QA 3HMCA 1KR1A 2CBJA 4BQ4A 4CN1A 4M8UA 4NRSA 3M6DA 4ZE5A 3TONA 2Y24A 1CGYA 3WN6A 4D6EA 3U7VA 1QW9A 2E3ZA 1CLVA 1W3LA 1VAHA 1V3MA 3D3AA 4Z2LA 1W1PA 2IXUA 4J3UA 3VIJA 1N7NA 1UWTA 1OBAA 3GH7A 2OWWA 3L4YA 1CGWA 3MSGA 4MADA 3W27A 2CBUA 1JAEA 1UH2A 1NWSA 2PWEA 1AVAA 3OIHA 1QW8A 3CPUA 4UQBA 5M17A 5BYWA 4W93A 3BSHA 1OCQA 3AIVA 3BAYA 1DEDA 4N42A 1E4NA 5CXPA 2WC3A 1OD8A 2XGIA 3CHEA 4J27A 4DUWA 1HIZA 5A94A 1CECA 4PCTA 2G3IA 1LXMA 1N82A 2DDXA 1K9EA 3CO4A 1UR4A 1MW0A 4TUFA 4HOWA 2BRWA 1OB0A 5FL1A 2ZOXA 3W28A 2DT0A 4UR9A 1JXJA 1C93A 2YL9A 1V0LA 6CGTA 1E15A 3ARZA 3AXIA 1H3GA 1M53A 1O6IA 3CUFA 4AZIA 3RM4A 4GI8A 4P8XA 3T2OA 4W89A 3OGSA 1V3KA 4EE9A 1U33A 2CIPA 4PN2A 1DHKA 1V02A 3OZPA 3CH9A 3GBEA 4E4PA 4B3LA 1IZJA 1JZ4A 4OBRA 3N9KA 1UUQA 2WM0A 2V3GA 2NT1A 3N11A 4LX4A 1JIBA 2ZIDA 2BHZA 4CKQA 2VZUA 1KR0A 3U57A 3UESA 3WUFA 1Q6GA 1BYDA 3TTOA 3PZQA 1J0MA 1EQCA 2D2OA 4MNLA 1RWCA 2WPGA 2E40A 2V5DA 1W9XA 1JDCA 1L0PA 2O9RA 1HX0A 2QHAA 1GOQA 3N1AA 2WSPA 3MMDA 3VMOA 1GVIA 2JALA 2BVDA 4J7RA 3SUUA 3VGBA 2BRVX 2CCRA 1S46A 3A6OA 5DT7A 1E70M 2Y5EA 2OSWA 1J0ZA 4L4OA 2DEPA 3UERA 3BAWA 1JD7A 1C8YA 2JIWA 5FL0A 5CQ1A 1TFVA 3U7BA 3GXMA 4AD2A 2YBTA 1JL8A 1J0NA 1N7OA 2CESA 2VNCA 1FFQA 1FOBA 4AD3A 3OZOA 5CPQA 2D0HA 4UQ9A 1JGIA 4JFVA 2X8RA 2VZOA 2J8GA 4PYSA 3W6MA 4M82A 3BXWA 1EHAA 1RP8A 3UG3A 2NSXA 3MUY1 3VD5A 4AZ6A 1M7XA 1HM2A 2UWFA 5CSYA 3WEOA 4UQCA 4GZIA 5GNXA 2WWCA 4LXFA 3AOFA 5BRPA 1OT1A 2QF8A 1UWQA 3QHNA 2OWCA 2WCOA 5D9MA 1BSIA 2JF7A 2YL5A 5E6YA 2BY0A 3RDKA 1VB9A 3MSDA 3WNKA 4PMNA 2X0YA 4C7GA 4OOZA 2J7BA 3W38A 1KQZA 3MKKA 4V27A 4PBGA 2XM2A 1CXFA 4PMXA 2X09A 4Y7EA 4UFMA 2UY5A 1K9FA 4NZCA 1B1YA 5I24A 3WD4A 1J0JA 4D6CA 1GPFA 1R7OA 2VCBA 3FY1A 2GJRA 2Q8XA 1CGXA 3VD4A 1OINA 4MAZA 2ZX7A 4AY1A 1LG1A 3HU7A 2XSBA 2VCAA 1ZBWA 1MW2A 1UWSA 3JUGA 2X03A 1KBBA 3VIOA 4UZSA 1P6WA 2WSKA 3WH7A 1RW9A 3WBAA 1XH1A 1MQQA 1EIBA 2D0FA 2EJ1A 2Y8VA 4PMZA 2F2HA 5A69A 3CBWA 1PJ9A 1PX3A 2YJQA 3RPMA 1PZ2A 1PX4A 3OGVA 1EH9A 3OA5A 4W7UA 1MW1A 2FH8A 3BCFA 4C7FA 3II1A 2GDUA 4EKJA 1XCWA 4GI9A 1CXEA 1DTUA 1VEOA 2WKGA 2J25A 1GQIA 4PSPA 1N7PA 5A6BD 2EPOA 4PTWA 1E3ZA 4TOQA 5A8QA 1R8LA 3CUGA 3PTKA 3PZIA 2EO7A 2EPMX 2PWFA 2VI0A 8A3HA 2XIBA 4P7OA 3SCWA 1QPKA 2OLHA 3ZT6A 3GNOA 1GJUA 3ZSTA 4J3XA 2E9LA 1C92A 3W29A 4OJYA 1WB0A 5ECUA 3FW6A 1I75A 1KQYA 4F79A 3PZOA 5E9AA 3AHZA 4E2OA 3WNNA 5A6AA 2C8NA 2J74A 4WF7A 5IHSA 3AI0A 4KMQA 2V5CA 4BF7A 1UA3A 2Y8KA 3VMPA 3WQ4A 4MJ4A 4XX6A 3CHDA 1C82A 3S2CA 3AYRA 3WENA 4CU7A 1E72M 2PBOA 5AC5A 1R87A 3I3EA 1GQLA 3EMQA 2DSVA 2WC7A 2E8YA 3GZAA 5FKYA 1GUVA 2WANA 1W3KA 1UQYA 4A3YA 1UWIA 2BY2A 4QCFA 1N7RA 1UR9A 2CKSA 2CBVA 3AISA 4W5ZA 3ECQA 3VGDA 3W4RA 4AD0A 1VBRA 2BY1A 2WCSA 2VX7A 4M29A 4ZE4A 4UOQA 1MQRA 4ZEPA 3GH5A 3GYCA 2BFGA 4GKLA 1JYWA 4AC1X 4CUCA 4W85A 1F1SA 4X0VA 1WO2A 4BZYA 4AIUA 2EEXA 3AIWA 1TCMA 1X1IA 2GK1A 4W86A 3NIYA 5ABEA 3FN9A 2C7FA 4P8VA 3VX1A 5CPSA 5HOSA 3ZR5A 2FGLA 2PWGA 2GJPA 4MNMA 1UKQA 2D23A 3W6LA 1MFUA 2WAGA 2O92A 4ATLA 3WBEA 5D8WA 4ZXLA 4NSBA 3W24A 2XVPA 4D1JA 4DWSC 5A6JA 3D5HA 4D6FA 2XWDA 3ZQ9A 4DWSB 1CXIA 1UOKA 2CHOA 3CTTA 1M03A 3SCPA 2AMGA 2E9BA 4GXPA 1CXLA 3OLEA 4GIAA 1E71M 4WKAA 4QP0A 1WZMA 1Q6FA 1PZ3A 2GDVA 2Y4SA 2DT3A 5A8OA 1MVYA 4QLLA 3ARYA 4RE2A 2IUZA 4B15A 5F7UA 4PSRA 2E0PA 2J75A 1JI2A 1MYRA 4AZ7A 4OOUA 4Z2IA 3L2MA 3VNYA 1XYFA 3ALFA 4JFTA 3ARPA 5ABHA 3WMSA 1H5VA 4AMCA 5EFFA 1HM3A 1V0NA 2F61A 1IT0A 4R5EA 3WNMA 7A3HA 1GQKA 2FDMA 4KRUA 3BAIA 4D71A 3VMNA 3VDCA 1DWJM 4XZWA 2G41A 1G1YA 4JKKA 3EMZA 4GQQA 3AMCA 3QOKA 5CSUA 2WXDM 1WDPA 1ZL1A 1J11A 2GJXB 5BROA 1BTCA 1C90A 4TVDA 4JIEA 4FLOA 1NWTA 3GBDA 4W84A 3SEPA 3WUGA 1NWUA 4MTVA 4D1IA 4ML4A 5GQBA 2EPKX 1CXKA 2VL4A 1C8XA 1X1NA 3OGRA 1DWIM 2WMIA 1VEPA 2XFRA 1ODUA 1V3HA 1ZBVA 4MB1A 1KXVA 4FLRA 2WW5A 4D6HA 3QHMA 5I6SA 1JXKA 2WVVA 1RPKA 1E4LA 1KCLA 3K8MA 1F4HA 2ZUVA 5FCZA 5A6SA 3AS1A 4OUEA 3FHQA 1HMUA 5A2CA 2BHUA 3EYPA 1J9YA 1V0KA 1BLIA 1N7QA 3ZJ7A 2CPUA 5FOOA 1HP4A 1XHGA 1GHSA 3VIPA 3SUSA 5IDIA 3OG2A 1J18A 4RE3A 1DWFM 4ACZB 2DGAA 4MB3A 1FHDA 4W5UA 4CCEA 2J62A 3MO4A 2G8ZA 1A3HA 4JFUA 2VC9A 1SFSA 2UY4A 1JZ5A 5E6ZA 1WDRA 1UZ4A 2ZUSA 4AXNA 3OLGA 4RL3A 5BCAA 5DFAA 6A3HA 2CITA 3WQ5A 2YDSA 3LPPA 5BXPA 3VU2A 1EDTA 1FH8A 1UR1A 3AHYA 1QI5A 1XRVA 2XFYA 4JAWA 4W88A 2CHNA 4PMYA 1MQPA 1W3YA 4JL1A 3CHCA 2BNJA 1E4MM 2WYSA 2YA0A 2FHCA 1KCKA 3ARUA 1HJXA 5A2BA 2D24A 5I5RA 5CG0A 1KXTA 3IAQA 1ZU8A 4MB5A 1B3WA 1OJNA 1QVBA 5KEZA 1HL9A 1E4IA 4HA3A 4BS0A 3EMCA 3VILA 2OYLA 3UG4A 1W9DM 2PI6A 2GUYA 4CN4A 3BLKA 3J7HA 3WUBA 3KZSA 4UFKA 1BGAA 1UD5A 4FLQA 1JDDA 3VM5A 5I3DA 5D9PA 3GTNA 4ZENA 1UH3A 3MV01 1H2JA 2WVUA 2J78A 1HKMA 3NSXA 2CNCA 5EBAA 2VUYA 4TXEA 4HMDA 1J0YA 4P7RA 2VVSA 3NCOA 3A47A 1BFNA 2J7GA 3WEMA 1G0CA 1BAGA 3RM9A 4NRRA 3WKZA 2PB1A 3T08A 4M1RA 3B9AA 3CIVA 1CB8A 1ODZA 4UZUA 3AMGA 1US2A 2E4TA 4AD1A 2VJXA 4HOZA 4B3KA 4FK9A 1PAMA 3K8LA 2VR5A 1NOWA 4S3KA 2PBGA 3EDDA 4Z2HA 1I8QA 2C0HA 5M5DA 1OJOA 5FD0A 2YKKA 3VNZA 5A6LA 4AZCB 2W66A 2EBNA 4Q7NA 3GDBA 2OYKA 1ITXA 2J7CA 4AWEA 2O9PA 4Z2GA 1JAKA 1KFWA 1L8NA 1BF2A 2V38A 1GCYA 4GZJA 2W67A 3VD3A 1HL8A 4AEEA 1E55A 2ZX8A 4V2XA 3CMGA 1R7AA 1CTNA 3VVGA 1UWUA 5HDRA 1V03A 2J79A 2YLLA 4CN6A 3GNPA 1EHNA 3F5JA 2WWDA 1XGZA 5A2AA 4D6IA 5EFDA 1UD8A 1H41A 3SIMA 2JIEA 1OT2A 3AS3A 2VCCA 3AXHA 4D6JA 3W53A 5TD4A 3IJ7A 1V6WA 1GOKA 1UD2A 1GOMA 1LQ0A 4DUXA 1J0HA 2V3DA 1TZ7A 1WKYA 1J0KA 5IFTA 1EO5A 2A3BA 1JYNA 5I23A 5C70A
chains in the Genus database with same CATH superfamily
3P61A 2CBIA 1KA9F 2WMFA 2OZTA 3MSRA 3U3HA 4PL1A 1DJXA 3BZJA 3R79A 1OG6A 1XIJA 1CZ1A 2NW0A 2BB0A 3FDGA 2V0TA 1XV8A 3WF1A 3QH2A 1LTDA 1EP3A 3SFKA 4AMAA 3G18A 2FPVA 1RZMA 3NSMA 1QATA 2PCEA 3W9ZA 2ZWZA 1ZS2A 3U2OA 4HNUA 4K1WA 2XWEA 3AUOA 5FI8A 1V77A 3POCA 1OYBA 2WV8A 1VPQA 4HB7A 2J4GA 4PEEA 2A3LA 4IMEA 1EB3A 5HWJA 3P62A 3A64A 1XD0A 4F0LA 1S2VA 1NP0A 3SJ3A 4O52A 1HVQA 2X2YA 4PTMA 2A3HA 3QKZA 4XAYA 2GUUA 3QGKC 4INFA 2TMDA 4R9XA 1NJJA 2D3NA 1W5OA 3TLLA 4FNSA 2PDUA 5F2LA 1PO9A 4KWSA 1EXPA 3PZ9A 1HJSA 2SFPA 2FYMA 1XS2A 1EUAA 5IDZA 3ABRA 1VFLA 2A3CA 4JR5A 1UQZA 1XYZA 4TTUA 4I90A 2RKXA 3E5PA 4W9TA 3OYXA 4UTTA 3S47A 3LHWA 4FNPA 2B31A 3BE7A 3K46A 1FWCC 3FGCB 1P6BA 3UD1A 2RGMA 3KDOA 3DI1A 3KS5A 1W1A1 1QPQA 1AZ1A 1G4TA 3AO0A 4JCMA 2W5FA 3K2GA 2Q01A 5CJ5A 4KEZA 1LRTA 3NQDA 3WQWA 3EKZA 3BLPX 1W9VA 1SU5A 3GAYA 3PFRA 4WXZA 5M3WA 1IEVA 4LNYA 3UJFA 1P0KA 1DWAM 1D2KA 2CFFA 3PBWA 4C60A 3CASA 4ES4A 3H21A 1HZYA 3LOTA 1KRMA 3LQLA 3WQEA 3C3UA 1I60A 1CGUA 1FP8A 3LA4A 5F2GA 1PIGA 1KGXA 4HBKA 2DIKA 3EX4A 4DWSD 4UFHA 3ANUA 3THAA 5SWUA 3CHVA 3KBVA 1O1ZA 1LG2A 4RDVA 3CAQA 3VD9A 4UIOA 1GVYA 3VOGA 4WY0B 1J0IA 3PFMA 3O6AA 4K8EA 4HSNA 2ZE3A 1V5XA 3DBPA 4C6IA 1NF7A 5I3KA 4PMRA 5CAHA 3ITTA 1MDRA 3N2CA 2XIMA 1B31A 3OVQA 3IJ8A 3S4TA 2JF6A 2PWHA 3Q37A 2JFEX 2XINA 4PFHA 2ZA1A 1W5PA 4FXFA 4W87A 1HJWA 4PL2A 4U31A 5FEWA 4MOZA 4MDPA 3MT1A 3ZT7A 1Z48A 3AMLA 2FFIA 1KW1A 2XZ7A 4WSHA 3VKAA 1XW8A 2UBPC 4QBXA 3ARTA 1K1DA 1W1VA 4DI8A 3EZ4A 1QTWA 5I00A 5EYWA 5KZ6A 1B9BA 2J77A 3GW3A 2JBMA 4CNSA 3H55A 3PZNA 2J24A 4J3WA 3IUIA 3TC7A 3M16A 5F2MA 5CPTA 4M6QA 3OJGA 3NL5A 1F2JA 2Z25A 1UMLA 1BG9A 1MEIA 4GZEA 2AQVA 4HPNA 1XLEA 3ARRA 1PBGA 1UR0A 5CGMA 4KRZA 3RX3A 1M41A 2KXRA 4NT0A 3IIOA 3S5OA 2YOCA 4FF7A 1VKFA 1YQ2A 2D2GA 1EJSC 3R7MA 3AHVA 4BA0A 4RJEA 3AS0A 4IIBA 2OJPA 3EWWA 1MMFA 4MVAA 1PKMA 3TYEA 2VMFA 4Q8WA 4OIFA 1DP0A 3QW4B 4ZQPA 4I8YA 3R25A 2XVNA 1C3FA 1S3TC 4MJMA 3KWXA 1EIXA 2W91A 3P3BA 4Q4RA 1E1EA 3QZAA 4DBDA 2WZTA 3VOIA 3N14A 1VF8A 4Q6JA 3EKLA 4U3AA 1T40A 1EOMA 4JTJA 5CG7A 3NFUA 2EHHA 3P93A 3B8TA 4DXVA 1LUCA 3ZXWA 4CU6A 1QHPA 3NGFA 3OU8A 1G9HA 3P0WA 3KUMA 5KZMA 5HMDA 5LIUX 3LV6A 1VRXA 3UD6A 3ZJKA 1PEZA 4O8AA 1E40A 1VP5A 2ZUWA 4G56A 3LI0A 4LOCA 4YHEA 4CU8A 1DWHM 2IPGA 1WDWA 3OODA 3AUJA 4GMEA 4E3TA 4XO7A 5A3HA 1KBKA 3AHXA 1Q3NA 3OOQA 4A8NA 4GXWA 2GJLA 3W25A 5K7JA 3K1GA 3B9EA 4LRTA 1HMWA 3K30A 4YXGA 1LWJA 4YTRA 4ACYA 4F2BA 4GZ7A 3B4YA 3HQPA 4WR3A 1QBAA 1D3CA 1KD0A 2HSAA 2YFNA 1GG1A 4RPPA 4I5RA 3MWCA 1E6XM 3M0LA 1BYBA 3P80A 3B9DA 2AOSA 4AF0A 3SADA 2IXVA 5IRPA 1OD0A 1NU5A 3EX1A 4EK7A 4B92A 1Z69A 2C6QA 3UCCA 1E6RA 1OJMA 1NOUA 3P7YA 4I9TA 3QY8A 4IX2A 4GJ1A 4FS9A 3BSMA 1XLGA 2X05A 4KRTA 3IACA 3LDVA 4I9MA 1JUEA 1NP2A 4C91A 4AIOA 5FAJA 1N2VA 1MEWA 4PUWA 4JZ5A 2P8CA 3M6YA 1XJBA 4UFJA 4W8LA 2INEA 1BHGA 4AG0A 1QASA 3VNMA 5H8MA 1TJ1A 1JGMA 4AIBA 3N6JA 1O1HA 4CD5A 3WK3A 2XG9A 1KTCA 4QS5A 4PE8A 1JRCA 4UQEA 3ZJ8A 1REQB 3UW6A 2D22A 4BQ2A 4NP7A 3NQVA 1LP6A 4LTSA 3GTIA 1B3XA 2E5BA 3TIMA 1SZNA 2ZZ6A 2QJNA 1CDGA 2GSJA 1I6NA 1PX8A 4O19A 1K02A 2ONEA 1BTMA 5C8BB 1OK6A 3F4CA 3UYIA 3DX5A 3HJEA 3DFYA 5JBDA 3LTPA 4OQVA 1KM4A 2YCJA 2H8ZA 3LBMA 3M41A 3IK4A 3P84A 1US3A 3IS4A 2DZUA 1NDVA 4F2UA 2CYGA 5HA7A 2CEQA 3R43A 3DG6A 3SUWA 4AYSA 3V36A 3T44A 3UR7A 4XUYA 4RCXA 3FA3A 1FHLA 3VGEA 2X0HA 4XAGA 3HURA 2NVCA 1AG1O 4D72A 2QCHA 1I4NA 3W7GA 3HQNA 1K70A 3L21A 4QEHA 1N8IA 3ES8A 1DTNA 4C6EA 2PDKA 4H41A 1U30A 3IJDA 1UZ1A 1UP2A 2C13A 1TQXA 1OJPA 3STFA 2DUXA 1EGUA 2B81A 1M7JA 2IKGA 1HKWA 4GJJA 4JN6A 3KBNA 1X1JA 1OC7A 1SMDA 3NXFA 3PPGA 5AECA 4HNTA 2BS9A 4HGXA 2ZVIA 3BDKA 1JPHA 1SFTA 3R89A 1DJZA 5K3VA 2YA2A 3ZO9A 1FCUA 4KGLA 1QI3A 2GFTA 4E3VA 2E6AA 4B9ZA 1HUVA 2GUBA 1MXSA 1PSCA 2ZBTA 4C1NB 4Q4KA 3BJSA 1V6TA 1XCFA 2D3LA 3ZR6A 1W31A 3PPCA 3E12A 3NQBA 2I57A 3PTDA 5J5RA 5DEZA 4IMDA 3UZJA 1TZ9A 2OSXA 3CZEA 5MF5A 5CZSA 3GR7A 1YHTA 1L6FA 4ZFCA 4JHZA 2XHYA 1B2YA 3LI1A 4DJFD 1TPEA 2DU2A 5CKSA 4FSAA 3W1NA 4ZO8A 3SQMA 1IR2A 4C6CA 1XI3A 1RUSA 1GYNA 1GHRA 3L12A 1SSDA 4U5IA 3SY5A 5AN7A 4LB4A 1B9ZA 2I5IA 2ZXDA 4ZO7A 4H04A 2ZICA 3VUPA 3GKFA 4GIYA 4JHOA 4A8IA 5HNUA 2WB5A 3CQHA 1CB2A 2GDQA 1K9TA 4IQLA 3UG8A 1XYBA 4LVFA 3CIXA 3BW3A 1F6YA 1R2RA 5B80A 1AMKA 2FZMA 1JCMP 5CGTA 4DUVA 4H19A 2CLHA 3EB4A 2OB3A 1ZPTA 3EWXA 3RR1A 3WDRA 5D03A 4QDMA 1FFRA 5A8NA 1R9ZA 5DBUA 1J01A 5HMFA 2YX0A 3CT7A 3GDKA 3TYUA 1VJIA 1BEUA 3AAMA 1XPYA 3WK0A 1JCTA 4UOZA 3NNTA 2PWUA 2J6VA 1XIGA 3FEQA 3MUAA 3XIMA 4CD4A 3KL5A 1P48A 1IEIA 1Z6KA 1OIMA 1R47A 1H4PA 2CKRA 3SCUA 3W1TA 4NYUA 3NR0A 3WH5A 3JZEA 1RALA 2VRJA 3APGA 3TTSA 3VNIA 4EAMA 1IGWA 3S2MA 1AH3A 3A22A 3VKCA 3P14A 3KL0A 2WDAA 4DF2A 4DLQA 4XZIA 1LJYA 2PRMA 2WHMA 3WMBA 1GYLA 2F6XA 1N8WA 3S5SA 2DSWA 3Q2DA 1MNSA 4D8ZA 4PB3A 4HZ7A 3EWYA 3W7DA 2RAGA 1YTKA 1TUXA 4KPLA 4OU1A 4Y90A 2E68A 3CHFA 1CGTA 2F7FA 3VO0A 1C8QA 1W1B1 3DOPA 4KWUA 1ISYA 3TR2A 4NZFA 2QMJA 2CZ5A 2VUNA 2Y8UA 2JGQA 3A4AA 4EXBA 1Y0EA 1F4AA 4MAVA 3LCFA 3K1DA 1Q85A 3HM7A 3BAKA 4GC3A 1W91A 3VXGA 1I2NA 4GY0A 4KGJA 1A3XA 1TIMA 4H7ZA 1PKNA 2X7WA 2DZXA 2A3EA 2C79A 4AEFA 1LRQA 3UR8A 3R13A 3TAOA 1BRLA 3LHYA 2BHYA 2PE4A 1W2VA 4QAIA 2Q8ZA 1PZ1A 3O15A 3GVGA 3IIXA 3KP0A 2XVKA 1GQJA 5D9OA 1NM9A 3K4AA 2OGYA 3I6TA 2F6UA 4NKCA 4YYFA 3L0KA 4IF2A 3E2VA 3NM1A 2DUAA 4JXCA 3VDAA 1NQ6A 3H70A 3B03A 4ZZ9A 3LZ5A 3QPZA 4JTDA 1NIUA 4K39A 4P7QA 3WF3A 2WMIB 1CPUA 1TWWA 2Y1HA 4EXQA 1RWHA 4URIA 4MWAE 4W7VA 3IJLA 4PA8A 1TA3A 2HMCA 4X3ZA 5M03A 3VIFA 1WZLA 3P8JA 4BEQA 2QDEA 3V5OA 4A3RA 1RJPA 3DHPA 4ERAA 1EFZA 5DXYA 4J35A 2ZE0A 3WLOA 1G5AA 3UGRA 1Q65A 4GI6A 2BX7A 4REQB 1B4EA 1IE7C 4DLMA 3DESA 2XVGA 4HU8A 1TPVA 3W1PA 4LC6A 4O28A 3TYDA 4LF1A 3EKGA 1DXEA 3CM4A 1B3ZA 1E1CB 4RV8A 4CLMA 5E70A 4LCRA 3MJMA 4YN5A 3CZ8A 2A0NA 4DI9A 5I79A 1RVKA 1NWRA 4LUIA 4PB4A 1EXBA 5DO8A 4J3SA 3RIKA 3AIRA 4FMVA 3D0CA 1YIXA 4X22A 3RO8A 2Z2BA 1HGWA 5CJNA 3DFOA 4PMDA 3M0ZA 5I2UA 3LBCA 2WVTA 1IHIA 3GWQA 1GORA 3M47A 4U28A 2Z7KA 3TN5A 2WZHA 4H6EA 3ZS4A 4LUTA 4CQDA 3S8HA 1W3JA 4ADUA 1VEMA 1VLIA 5AYIA 4YTQA 4FA3A 3WFZA 2PC4A 4EPEC 4MM1A 1NTHA 4U2ZA 4AY7A 1QNSA 4J2PA 5G4WA 2CBJA 1THFD 4CN1A 4ZB5A 4TR9A 3M6DA 2PDGA 1X6UA 4D6EA 3TC6A 2AL2B 2TPSA 2NLYA 2BZNA 1DQWA 5EBUA 3U9IA 1VAHA 2PUZA 1PB0A 3D3AA 1I45A 2ANUA 3TCSA 3GH7A 3B0YA 3NQ8A 1HO4A 3RFAA 4KWVA 5LHEA 3BOXA 2OPJA 1FWGC 4IPJA 1VC4A 1E4NA 5CXPA 4ZO6A 2FKPA 2WC3A 3LCGA 2GVGA 4J27A 5EY5A 3FYPA 3G1XA 2P0OA 2G3IA 1LXMA 3BCJA 1N82A 3CNYA 3FJLA 2DDXA 1K9EA 3CQJA 1UR4A 1OB0A 4DJED 1XKYA 3W28A 2DT0A 5CSSA 4BI5A 3E0VA 4NIRA 3UZWA 3B40A 1WXJA 1V0LA 3FX4A 1EX1A 6CGTA 1OYCA 2QAPA 3ARZA 3QZEA 2DZTA 1H7OA 2J9ZA 3O6DA 5FF7A 3W1MA 1E9YB 4NZJA 3CUFA 4F0KA 3V16A 3WX7A 1LQ2A 1BWVA 3T2OA 4W89A 3OGSA 3FSUA 1V3KA 5B7YA 4GBUA 1TV2A 1XBZA 3NWRA 1UW9A 4NJHA 5C9UA 3KOFA 3R10A 3GG0A 1DHKA 3H7VA 3GYEA 4E4PA 2PP1A 3G24A 1IZJA 2NWRA 3GY1A 4OBRA 1G4SA 1UUQA 2PGFA 2WM0A 3FDKA 1XBXA 5K9CA 3SB0A 3AU2A 3MCMA 1VHNA 2CZDA 3TYZA 2KX9A 3KRUA 1JIBA 3BGJA 3W1RA 3UESA 3R5EA 1UP3A 1VLWA 5D04C 1WOAA 4DO5A 1EQCA 2QUVA 3NZQA 3WQFA 1SO6A 1RWCA 2WPGA 5CC6A 3WO8A 1L0PA 3GW0A 3GRIA 2VWTA 3P82A 2Q71A 2QHAA 3C5QA 2WJEA 2WSPA 1O60A 4HHMA 3VMOA 3RYSA 1GVIA 2JALA 2NQ9A 2J66A 3T81A 2DZPA 1X1OA 1KRCC 3DDMA 2QCCA 4FALA 3HFYA 4H9TA 2OSWA 3ZWSA 4XAZA 1QW7A 4Q7BA 2DEPA 4O1FA 4KERA 1JD7A 3LX9A 1XDJA 2JIWA 3S3GA 5I3GA 3CQ0A 1TFVA 1E9IA 1SFJA 3UZXA 2QDHA 2DW6A 2CESA 1YE6A 2VNCA 4IIHA 3UQNA 1JGIA 4DZAA 2VZOA 3VCCA 4X9SA 4NNAA 4PYSA 3WQDA 4M82A 3KVMA 1PHQA 3MUY1 2D2HA 4LVGA 2G97A 5K4ZA 3UY8A 1M7XA 4EIVA 4RUBA 3WEOA 3HOJA 3GHRA 3LHVA 4IJBA 4LXFA 2A2IA 3AOFA 3QHNA 1PKYA 2KXSA 3H2EA 5D9MA 4M3PA 1BSIA 3URAA 4X60A 4MKNA 2GYIA 3MSDA 2VFEA 4DBSA 1TO3A 3C2FA 2I1OA 1WBJA 3W38A 3HV9A 5GJMA 5AYZA 1UIOA 1IIHA 2F9RA 3TMQA 3GC5A 3GR4A 3VOFA 4AAJA 1CXFA 4Y7EA 4UFMA 1GKRA 5I24A 3WD4A 3F4NA 3HPAA 1J0JA 5LNSA 4JEQA 1CGXA 3TFXA 2ZX7A 4XAPA 3DIPA 3HU7A 1YDNA 4WGHA 3DHDA 2XH0A 1ZBWA 1U1UA 2PSNA 1OFPA 4JQ4A 1P6WA 3TFCA 3P5YA 3DFSA 3W2NA 4UMCA 3WBAA 1XH1A 2QR6A 3RLGA 2ZZ7A 1AD1A 2F2HA 1D8CA 2GVJA 1F3EA 1PZ2A 1PX4A 1EJRC 4GWEA 4N9CA 1EF3A 4W7UA 1M1BA 2FH8A 3W6YA 1DJIA 3BCFA 5I7GA 4UXDA 5D2VA 2GDUA 3L66A 4C7FA 4EKJA 5B7ZA 3N4EA 3B0PA 1SZRA 1KLZA 1RBOB 4B3ZA 3MPGA 1CXEA 3KBTC 4LAUA 2WKGA 1GQIA 1A5LC 3W73A 4PSPA 1N7PA 3TNOA 1E3ZA 4OT7A 3A9BA 3PTKA 3PZIA 2HRWA 1IZCA 2VI0A 3TX9A 3LSBA 4MIMA 3BICA 1WX0A 4L6OA 5AVNA 4YYCA 3PK7A 1QPKA 4JIIX 1TPUA 1GJUA 4I5XA 4LFYA 1C92A 4OJYA 1I75A 1G69A 1C8VA 1QWGA 4Z1CA 3QC0A 4L4LA 1XXXA 3W7LA 5IHSA 9XIAA 2E1DA 3TROA 2EGZA 3P67A 1KC7A 1M3UA 3L67A 4TIMA 5CC7A 4HTBA 4EP8C 3LSCA 3NURA 3O6YX 4XX6A 3CUXA 1C82A 4O11A 2UV8G 3I3EA 3H8AA 3VDGA 5AHMA 4RNFA 3UWQA 4IPPA 3CEPA 3GZAA 3M43A 1DYSA 1TPWA 1UWIA 1PIIA 4QCFA 2CBVA 4EPBC 3ECQA 1Q2RA 1VBRA 2FZ9A 2G0WA 3NQFA 2VX7A 5EMKA 3HG5A 2AAMA 1MQRA 1FQ0A 3GH5A 3MW7A 2BFGA 4GVFA 3UZ5A 3NZRA 1QWKA 4CUCA 1B5TA 2Z6IA 1TWSA 4OUIA 1WO2A 3TZNA 3GAKA 4UCGA 1TCMA 1J8VA 1Z89A 3U4AA 5FEXA 1X1IA 1F8IA 1Q4WA 5ABEA 3IRSA 2ICSA 2C7FA 4P8VA 5CPMA 3MTWA 5CPSA 3ZR5A 3CT2A 3W7OA 1SW7A 5CZ0A 4BF9A 1H5YA 3CQKA 4MNMA 2PDXA 3W6LA 2ZVRA 2WJZA 2NX1A 4PH6A 4NJGA 1G7VA 5D02A 2YXXA 3MUXA 4NSBA 4GHRA 2XVPA 3FVMA 5DY3A 1GW9A 1PYMA 3MP3A 1TTQA 2XWDA 1Z9AA 1P1MA 2NLIA 1M03A 4QNWA 3LNMA 4GIAA 3COTA 3UVIA 2GDVA 5H91A 2G50A 5A8OA 2IUZA 4NAEB 4PSRA 3HO8A 4YMZA 2QEZA 1AQFA 1ZZMA 2REQB 3C86A 4JFTA 5ABHA 3YPIA 1W54A 3WMSA 1Q8JA 4IP7A 1LLZA 4JTLA 2F61A 1P0NA 1GK8A 1OFAA 1K4HA 1H7NA 3VCRA 2FDMA 4KRUA 3BAIA 3IUHA 4D71A 3Q58A 3VMNA 3QQ1A 4N6EA 1DWJM 1T96A 4XZWA 1G1YA 1SFLA 3AALA 4XAFA 4GQQA 4I6VA 2WXDM 1A5UA 2GJXB 1BTCA 3KRSA 4JN8A 3GBDA 4D1IA 3BV4A 4ML4A 3ABXA 1CXKA 3BLIA 5C0QA 1W5NA 1X1NA 3JW7A 5I6SA 3W84A 2QT3A 1RPKA 1YPXA 4J5NA 1TV3A 1ZRQA 2QXWA 4MZYA 4RR4A 3GB6A 2IMRA 3SN0A 1XPGA 3EYPA 1V0KA 3IGSA 5D30A 1BLIA 5FF4A 4ZQOA 3QYQA 3LTSA 2CPUA 3VOJA 2XGZA 4DBWA 1J2BA 2Q6ZA 2X1UA 4XKYB 5IDIA 3OG2A 3WQCA 8RUCA 1FHDA 4FR1A 2J62A 2G8ZA 2HXTA 1A3HA 2NZLA 1YPFA 4JTRA 4JFUA 4AVNA 4C5YA 4MUZA 5E6ZA 1POKA 1P43A 1V7YA 2ZRVA 1WDRA 1UZ4A 4AXNA 4EOUA 5C9ZA 2GGHA 5KZDA 5DFAA 6A3HA 3PULA 1ONWA 1WAUA 5BXPA 4OE7A 4JYEA 4J9JA 3QTGA 1EDTA 1EP1A 3B8WA 1LROA 3E6EA 4JAWA 4MZ8A 4W88A 4L61A 1MQPA 2V5BA 1W3YA 4UTLA 2YA0A 3ANYA 1NY1A 3G1SA 4A8LA 3CTLA 3VCNA 3PBMA 3IAQA 4K36A 1ZU8A 3T78A 1TKKA 4Y6GA 5KEZA 2C1HA 1HL9A 1R38A 4IGMA 4EXAA 2EAWA 4BS0A 3EMCA 3IJ6A 4IFKB 3VILA 4CQAA 2OYLA 7REQB 1SZEA 4CN4A 2DJLA 4RX0A 4UFKA 5DX7A 4Y8FA 2V6AA 1BGAA 1LDCA 1UD5A 2HWGA 3O16A 2R1PA 2Q02A 3ITLA 5I3DA 5AHNA 3GTNA 3IWPA 1UH3A 4OWGA 1H2JA 4LF2A 4FX6M 2J78A 5CAKA 5I07A 1I0BA 2CNCA 1A0CA 2VGFA 4HMDA 3APYA 2YEPF 1J0YA 5FESA 3A47A 1YXDA 4GUHA 3WLPA 2TRSA 4NRRA 4GCXA 4S2BA 3RM9A 4FIRA 3WKZA 3T08A 3B9AA 1ODZA 1US2A 3WZ0E 3B0UX 4JTSA 3EXRA 2VJXA 3UXDA 4B3KA 4S3KA 3FV9A 2PBGA 3EDDA 1L2QA 3NA8A 1I8QA 4IJCA 5FF3A 2PZ0A 2Y5SA 5FD0A 1XG3A 4IIGA 3IVTA 1KFEA 6ENLA 4BF5A 4FNUA 2EBNA 2O9PA 4Z2GA 4LB3A 4AQLA 1KFWA 1BWLA 2FJUB 2CHRA 1PL9A 3T42A 3TV8A 2W67A 1KM1A 4U4MA 4QG6A 4V2XA 3FS2A 3WJSA 4O15A 4B5WA 1R7AA 3ZYZA 3ITCA 1UC4A 2ZC1A 3USBA 1O94A 1S1RA 3SIMA 2VDHA 2C16A 1OT2A 5D2TA 3IV8A 4D6JA 4JTCA 2WNNA 4S23A 1V6WA 5EMJA 1GOMA 1L2UA 3T1GA 1J0KA 2OX1A 1MZRA 4IX0A 1S5TA 4YWSA 4N02A 1CENA 3QBUA 2YCLB 4AIEA 1JZ3A 2GWNA 3UPBA 4JTUA 1S1PA 3DC8A 4EWND 4TV5A 1TWDA 4HYWA 4HMCA 3BSGA 5LXEA 1Q6DA 3A3WA 5CZJA 4OTKA 1H1ZA 5REQB 4FX8A 4CVWA 1E0XA 4JCLA 5FACA 4LWWA 2VD8A 3KL3A 3CWOX 4CCDA 2HCVA 4EWJA 3CMJA 4CCZA 1CBGA 3GNXA 1H7PA 2EXOA 3ZLFA 5I77A 2PWDA 3FKKA 2FHBA 1QI0A 3SCVA 3TLQA 1QNVA 3QVQA 1E9ZB 3MUIA 5KTLA 3NQMA 3WNPA 4ICNA 3ZSSA 3TK7A 5EL1A 1UWRA 3UJRA 2VC6A 2PRLA 3L5MA 2ZUNA 4AISA 5H2ZA 3MU7A 3GDMA 3TZFA 2WZIA 3MBDA 1QI4A 4MB4A 3INPA 2WMHA 4UTWA 4N9DA 4AXKA 3WLTA 4HNCA 4GXMA 3LUTA 2VTFA 3C8FA 3CL6A 4MFEA 2ACQA 3N2MA 1IWBA 2QCMA 2J9XA 1IIGA 3UWZA 4QXIA 4S3CA 4UTIA 4N4QA 1GG0A 3TJ4A 4CNNA 4Q8VA 3O0FA 3TA9A 2HK0A 3KFTA 1QRQA 5H1WA 2G3MA 4P7NA 1N55A 1X96A 4Y96A 1JVNA 2OFJA 1EZ2A 4LYPA 2ATMA 3OVRA 3MI3A 4MZ1A 2Z1WA 1PWMA 3F4VA 4K1GA 3PUDA 4KH2A 2OMAA 4LAZA 4QGCA 3C0JA 2BODX 4C7DA 5I0DA 4XTIA 4H6RA 3NL3A 3VTRA 3AICA 3HPSA 4Z0JA 3WY1A 2VWSA 2VQTA 3K4DA 4S1FA 4NX0A 3UJSA 4HSHA 1R85A 1O5RA 3VDHA 1EUNA 3GR8A 3DG3A 1GJWA 1ICPA 3IJ9A 3KCLA 4CQ9A 3USZA 3PZMA 1RHCA 4PCFA 1OVDA 3FNDA 1OGSA 1TIWA 4BWLC 4QE1A 1UASA 1AL7A 1XH0A 1J4EA 1T6MA 3EPOA 4K37A 4GKTA 3M5XA 3EBVA 1NFBA 4N6FA 2UZ9A 1VGAA 3KBJA 4RDYA 5JH2A 2WNZA 2VENA 4AHOA 4Q33A 4A3UA 2D0GA 1AQHA 4WOZA 3N12A 2A7RA 3EDJA 2EPNA 3STCA 5DLCA 4HNVA 2ZZ3A 2OXNA 3QR0A 2XSXA 3GXPA 5HWNA 3WDHA 1QDSA 1AUSL 3CUIA 3UCQA 1JPMA 2NX9A 3PZTA 3M4HA 1YKWA 4E8DA 1HKIA 2C71A 1AK5A 3S46A 5CC3A 1RQEA 1G67A 1X8CA 1IXOA 1UJQA 5C7HA 2INZA 5IBXC 1XSIA 1OIFA 2E24A 3ARWA 2POZA 5E0FA 1EO7A 3GZ3A 1P0BA 2QJGA 3SURA 4D6GA 2VT0A 3RMEA 4ECLA 4R27A 4FOUA 1KV8A 3UT0A 1X6LA 1GQNA 5HPOA 1JF6A 3THDA 5D37A 4GG9A 1IYXA 3GLCA 2HE8A 2ZUUA 3GX9A 1BYCA 4MWAD 3PG9A 2P3EA 3NQCA 1VJSA 3W71A 3NO1A 4NXSA 2PDCA 2ZRXA 3R2GA 3WF2A 1SMAA 3DYPA 5JBEA 1XUUA 1OGBA 1IEQA 1FP9A 2ZRZA 2WVSA 2WC4A 3DFQA 4JQ3A 4DELA 2HNEA 2VXNA 3O05A 4O53A 3TWBA 2BG5A 1D8WA 3DAQA 4E8GA 4ZQCA 3N4AA 3U2ZA 2QPXA 1ZENA 3FIGA 4JNMA 3GHUA 3NPWA 4JHMA 3W02A 1EBHA 1U5HA 3I7RA 5BRQA 2ZX6A 3RN6A 4HPGA 1HVXA 3O7UA 2O0TA 4PUMA 3QQWA 4JTEA 1UD6A 2G3JA 3TTQA 1A5MC 3KX6A 3WNLA 1EWDA 5JXQA 1J12A 4UWMA 3ARVA 3F4WA 1U1HA 1S3HA 3UEQA 1ZALA 1GPWA 1RH9A 2VEKA 4QJ1A 2HV5A 1Y7VA 4HT3A 3SCOA 1W1YA 3BAJA 2UY2A 1OK4A 4LS2A 3H2FA 2ZZ5A 2ZFAA 3EB2A 3SGZA 4BQ5A 5CLTA 4C6MA 5I3IA 2BMBA 4DXXA 3GUGA 4H8UA 3AZSA 3G22A 1F9CA 3OLDA 3RUBL 1K7XA 4GC4A 4AY8A 3SM0A 1HKVA 3C0LA 2RDTA 1CCWB 2WNWA 3VPLA 1ADDA 4AW7A 3HGJA 3L4VA 2Q1FA 3CZKA 2WBKA 4I9JA 3RXZA 1JYVA 2ZXQA 2R14A 4QAWA 4Z1BA 4GY7A 3I3DA 3BGAA 3GIPA 1JFHA 3IGUA 3W88A 4XVDA 1Y5XA 4RK8A 3TYCA 4BJHA 2KAUC 3AHTA 3JVAA 1V93A 3AIBA 1DIKA 1HNYA 5A8PA 1JG9A 1A5NC 3V18A 3EWZA 4XD4A 1XFCA 1GOIA 4E0CA 2F2KA 3WLSA 4XZNX 1BVNP 4PUUA 3W01A 3E0LA 4JFWA 1ISZA 1U83A 4QLKA 3R0DA 4IG2A 3AXKA 3TYAA 2ZA2A 1NARA 2B7QA 3N2TA 2E09A 1DE5A 4US5D 4R7JA 2BV9A 1DXFA 1SSGA 2GQ8A 3TYBA 2Y0FA 3ZVHB 3DU0A 1QPNA 4WGXA 4QFUA 2V5JA 3THQA 4M5PA 1JFXA 1KB3A 2DUZA 3G0UA 5D2YA 4JQ2A 3SUTA 3A4WA 2G4FA 2AQWA 1B3VA 1RLCL 3A4JA 5C9XA 2XJ7A 1LM1A 4NAFB 4F9JA 3UWUA 3CB3A 2VVNA 1VH7A 1YLVA 3M46A 4JL2A 4IMAA 1GKPA 4H7CA 5BOEA 3NJ3A 4HD5A 5FEZA 1VIWA 3W1AA 2RDUA 3LK6A 4NHVA 3NDOA 3RJXA 4XZ9A 3UG5A 5LZLA 4IFRA 2VRKA 3TXZA 4OECA 4PTVA 2WOQA 3LRKA 1JD9A 2YGYA 3QPYA 3KDNA 3LCHA 2HK1A 4L9XA 3A4XA 4A35A 3H7RA 4IP5A 4GO9A 2FFCA 3TH6A 3DC0A 1JCJA 1W9BM 4X9YA 9RUBA 2IW0A 1OM0A 1H7XA 3SQLA 5KITA 2JE8A 4GYPA 4HVXA 3L7RA 1XLMA 2BGSA 2E28A 1BD0A 5XIAA 5HINA 4WZHA 2QPSA 5AC8A 1XP3A 1E43A 4HU4A 2QQ6A 1VFFA 4IQDA 3ICJA 4IFOA 4KETA 4HTYA 4ALDA 1X98A 1W2PA 3L4TA 1V6YA 4P8WA 3QMSA 3EWDA 2DPEA 4KESA 4CEXC 2EKCA 4EAYA 1M01A 1E73M 2FB3A 5FF2A 1GW1A 2YZ5A 1B3OA 1E0UA 4OZOA 3WLJA 3AJ7A 1OFOA 4N2YA 2RDXA 2RJHA 4UB9A 3EOEA 4D2JA 1VBUA 3EDEA 3N4FA 4F4RA 2XIJA 4NXKA 3HG3A 1JI1A 2O9TA 2QCDB 4G9PA 2VOMA 2C18A 2ZX9A 4K2SA 2J47A 4X63A 1T41A 3RR4A 4IICA 1UR3M 3CAWA 3CGTA 2YCIX 1TG7A 2OKTA 1KGUA 2I56A 4O14A 4CD6A 3WEZA 5DMYA 4LGXA 4NNBA 3L9CA 1LBMA 1UYQA 2Y61A 4UTTC 1IEXA 2CXGA 2A79A 3NDZA 4PODA 2QDGA 2ABBA 2OTDA 1X6NA 3BMWA 3LEPA 2XYLA 3WUEA 4QM1A 3LU2A 1T8QA 5ENLA 2FVMA 3RM8A 2XVLA 5AYXA 1QI2A 1XRFA 3WLRA 2VEGA 3M0VA 2WZEA 4C65A 3M7WA 4UTKA 3WDIA 3W72A 1OX5A 1ZCOA 1OX4A 5TNVA 4I9AA 2FTPA 1DXIA 3NEHA 3THUA 4ZVJA 2EPLX 4DYKA 3U5UA 1I0DA 4BY3A 4WVXA 5EB8A 3BGGA 3JRKA 3N04A 3CQIA 1B3YA 3OA3A 3FAXA 3KHDA 4K7YA 1XLDA 3AMKA 4S38A 1VPYA 3G1RA 2HISA 3BCDA 1YNPA 4J3VA 4HKPA 1V3JA 2YB4A 5HUPA 4C6DA 3WIJA 4C1LA 3ITVA 1QUMA 1R3WA 4G7EA 4P5UA 1HJUA 5AC4A 1C7TA 4DX3A 4HN4A 1J5TA 2OEJA 1CT5A 3GU1A 3IJQA 1QOXA 3MJYA 4HNLA 3UPMA 4S3JA 4AD4A 1Q2SA 4RW5A 1X8FA 2FGZA 4M7TA 1UR8A 5EKYA 3ITOA 1TVNA 2A7PA 3C2VA 4HIBA 4DNHA 4Q8OA 1ISVA 3VGGA 2QYGA 2ACUA 4MFDA 1HT6A 2CERA 2EPHA 3MHGA 1HXJA 3O2LA 4B4HA 4L5ZA 3A24A 2HVNA 2H90A 2CLMA 2B7OA 1JJKA 2MNRA 1UUOA 1EYWA 3R6IA 1TB3A 2J7FA 5ABFA 4LS1A 5AHIA 5K9XA 3DHUA 2IPWA 4RZBA 4ASTA 3D46A 5BWFA 3VD7A 3SCNA 3ARXA 1IXNA 4JYFA 5HMEA 1BPLB 4U33A 1GWJA 1GONA 3CK5A 3VUSA 2AGTA 4JY9A 3F4DA 1AD4A 1UKPA 4IP4A 1UKTA 5HQMA 1DL3A 4HPHA 3GK0A 1E51A 4MNJA 1WCGA 4JTFA 4QISA 5DBTA 3HFTA 1I9CB 3R1ZA 3I10A 5AY7A 5DMNA 1IZKA 3IEBA 1FBAA 4HZ8A 5JIWA 1PTAA 4QHRA 1TV7A 5H8PA 1NAL1 2A3AA 3DKJA 4M24A 1SUXA 1KRAC 2BOGX 3HG2A 3S1WA 3PBGA 3HZ3A 3W37A 1A49A 1UR2A 4DBEA 1LOSA 2ADAA 4WSKA 4EVZA 3TA6A 2B4GA 1O95A 1LOQA 4PUKA 4WY0F 2BY3A 4NYYA 5LA2A 3FAWA 3WBXA 3RX4A 1Z32X 4YU1A 1I1WA 4EX4A 2Z7GA 1V3IA 4S2CA 1HN1A 1FXPA 3I3BA 3ITXA 1E1FA 1AQMA 2WVVB 4AWSA 4AHQA 3H4XA 4XTDA 4AVFA 2VO5A 3SN1A 1JCXA 4V28A 3PG8A 1QNPA 1RD6A 4WLCA 4XQ6A 1OCJA 5G4HC 3VDBA 1J2WA 1ZJBA 2HVMA 1JDEA 4W4QA 3OB8A 4US6A 4PMQA 3RCNA 1KFBA 4ERIA 5JIPA 1OSEA 3S5NA 1BXBA 4F9DA 4LVAA 4A3QA 3MKVA 3QW3A 5U4NA 4WX2A 2E5CA 2FJKA 3FKRA 2DVUA 4HHLA 1VCFA 2P53A 1RK5A 1CWYA 1MW3A 3B9NA 4O4VA 1ADSA 2Z1KA 3LN3A 3WELA 1I1XA 5G1YA 3QY7A 2J8FA 1YXYA 1XKJA 1AJZA 1DKWA 3KBWA 2JEQA 4BI7A 2DH2A 3CZJA 3G0SA 3GS6A 5BZAA 3CEUA 4C6KA 3WDQA 2PDJA 3SCSA 3W86A 4LCQA 5HBFA 2XFWA 5G2IA 4JN7A 1F6PA 2PC8A 2ZRUA 2OZ0A 1W5QA 3V4BA 3QHOA 1LLWA 4S39A 1S38A 1JPKA 3UZZA 2I9EA 1DIDA 1VFHA 2VX4A 1V02E 1V8EA 1R30A 3ABZA 4R9OA 3NOYA 2Y7GA 3VI2A 3BH4A 1CYGA 4H00A 3T7VA 1LT7A 4QJ3B 2XM1A 4BK9A 4Q4OA 3GU2A 3VGHA 3AIEA 4L6HA 2CLIA 6PTDA 4G2DA 2F8QA 1KR1A 3KTXA 4BQ4A 4GVHA 1M7PA 3W7PA 3TTEA 4B90A 4GK8A 2VEFA 4KCTA 4XKYA 1CLKA 1CGYA 4MWAA 3WN6A 2PCQA 3U7VA 2VZKB 1QW9A 4H9XA 3Q67A 4E4FA 4N4PA 1CLVA 5CEWA 3AC0A 2PP3A 3CJPA 4J3UA 3VIJA 5K9DA 2OWWA 1BQGA 2WSRA 4KCWA 3P0XA 3MSGA 2CBUA 1JAEA 4GUIA 1AVAA 3LCIA 2QJIA 4DO6A 3BSHA 3O06A 4GE8A 1OCQA 3RLUA 3BAYA 1SR9A 2FQIA 4JTTA 2XGIA 3CHEA 5C6MA 2OR2A 3WG6A 2PTYA 4YTSA 4CNTA 4K8GA 3CO4A 3TR9A 2PU1A 2BRWA 1TR9A 3UXAA 4QX4A 3TN3A 2ZOXA 1JUKA 3G1FA 2E67A 3W2UA 1NVMA 3WLKX 1E15A 1KKOA 3AXIA 3F1QA 5T9CE 1TUFA 4M7SA 1XUZA 2F6KA 1TRIA 4I7VA 2PAJA 3FXGA 3EOSA 1S2CA 3PPFA 1WUEA 3S2JA 2CIPA 2OZ8A 4AHPA 4PN2A 5EMLA 3OZPA 2CXEA 3T4CA 4R33A 2OO6A 3N9KA 1TELA 4O1BA 3KBSA 3M0JA 3W2LA 2NT1A 3N11A 3LV5A 4F0HA 4O10A 2NQ5A 2H6RA 4CKQA 2CW6A 1VS1A 1KR0A 3U57A 2P5NA 3S2LA 3WUFA 3B06A 1P6CA 2WQDA 2X7VA 5T26A 4LUSA 3TC3A 4MNLA 4H3DA 3I6RA 3W87A 4Y2WA 1W9XA 2QV5A 3H2AA 2O9RA 3MQTA 2GLKA 4BHYA 1UWAA 3VNJA 3MMDA 3UGVA 2IQTA 2X16A 3RAOA 3P5ZA 4LV9A 2CCRA 5DRIA 1S46A 3QFEA 3PWAA 1E70M 3UERA 3LD5A 3BAWA 3HPXA 2PDFA 5D32A 2P50A 4C6JA 4NX5A 3S5YA 3V0SA 2YBTA 1H63A 1SVDA 1FFQA 3KOWA 4AD3A 3OZOA 2HJPA 4US5A 3T8QA 3MHUA 1PDZA 3RF9A 2C0AA 1VD6A 1MRAA 4JFVA 2I16A 3H7UA 1EHAA 3UG3A 1TV5A 3QPEA 1SW0A 2NSXA 1WA3A 4PEKA 1JQVA 2QULA 4UQCA 3SSJA 2W9MA 1OT1A 1ZAIA 2QF8A 3QC3A 4XVEA 1YXCA 2YL5A 4LBSA 3CL8A 3WJWA 3XISA 2X0YA 4C7GA 5H6HA 4FOJA 2VD9A 2OVLA 4V27A 4LBUA 1XLLA 5FJPA 4LS0A 1K9FA 2ALRA 3GFYA 2VCBA 1GGOA 3DERA 2GJRA 3UWVA 2Q8XA 3MDUA 4MAZA 1L6WA 3VZXA 4AY1A 2FZ8A 3SR7A 5FJTA 1GVSA 2VYOA 4AEOA 2NVDA 4C1KA 1TPC1 4TV6A 2VCAA 5FJJA 4QJ5B 1JULA 1UWSA 4DO4A 1C9DA 3JUGA 2X03A 1KBBA 3FCPA 3T0CA 1ME7A 1WXYA 4UZSA 2VFIA 4MYAA 4D8LA 1RW9A 2D0FA 1EIBA 3RRAA 3TEVA 1TPFA 5A69A 2GGJA 1PX3A 3LY0A 3B8VA 1MW1A 4DXKA 1EZWA 4E4UA 4GI9A 3EEZA 4JX6A 1BVWA 3D6NA 3N29A 5I09A 1O66A 3CUGA 2EO7A 3MYPA 4P7OA 3SCWA 2EJAA 3PBVA 3ISIX 3HTWA 3ZSTA 1PHWA 3Q94A 3W29A 5M2FX 1WB0A 1YMYA 4F79A 3AHZA 3C8NA 3M0IA 4E2OA 3WNNA 2PDYA 1K7FA 4HHHA 4KFNA 2R91A 3LGGA 2V5CA 2OODA 4LCSA 4ZTXA 4BF7A 4IIFA 4AC7C 3S1XA 4Z42C 1D9EA 3S2CA 5C2XA 2AKZA 1S39A 1OY0A 3WENA 3EWCA 4CU7A 1RR2A 4IHCA 2Z2UA 2WC7A 2Z28A 4FAMA 1GUVA 4H1ZA 1I8JA 4LT9A 3V35A 2CKSA 4W5ZA 3OZYA 1X97A 3E0IA 3VGDA 3MVIA 3W4RA 1W1IE 4XO6A 4ZE4A 5BWAA 1CI1A 3BPWA 4ZEPA 3URBA 3FJ4A 4H4IA 1JYWA 4AC1X 1F1SA 1XQLA 4X0VA 1P5BA 2PDIA 2QUTA 3EWBX 1TRDA 2HTMA 2GK1A 3NIYA 1TJPA 1FHUA 4JTAA 4TQTA 3ORWA 3V1PA 1DJYA 4WXYA 3G3DA 2OT0A 1MFUA 2WAGA 3WBEA 4KEMA 4JX4A 4DWSC 3W76A 3MZ2A 4GVGA 3D5HA 2DW7A 1OG0A 3BVJA 1LUCB 4DJDA 3GO2A 2E9BA 4ZO9A 1E71M 1WZMA 2Y7EA 1PZ3A 5IM51 1XYAA 1LZOA 4QLLA 3ARYA 2XZ9A 1W3TA 4DYEA 3KWSA 1MYRA 4S3FA 4ICCX 4IGNA 2VZKD 3UNDA 4G6CA 3L2MA 1H5VA 1IT0A 2B0MA 3VDCA 4MMWA 2G41A 2GZXA 4JKKA 3AMCA 3N19B 3UBPC 5F4SA 1P1XA 1P7TA 4TVDA 4LUYA 4MTVA 4NJKA 5GQBA 3GG1A 2EPKX 1X7IA 3MYOA 1C8XA 2EG7A 1DWIM 1VEPA 2XFRA 3DN5A 1Y8BA 2WW5A 1JXKA 3UXIA 1ML1A 3K8MA 2QJHA 2ZUVA 5FCZA 2OX4A 3AS1A 3G1AA 5A2CA 4ERGA 5MKGB 5G1MA 5BMXA 1Z3NA 1ENUA 4Q32A 3CLMA 1N7QA 3ZJ7A 3LLDA 2QIWA 4MSSA 4XZLX 4IGSA 3K13A 3ABSA 4JX5A 4RE3A 1DWFM 4MB3A 4AF0B 4CCEA 4O12A 3N2BA 1OZQA 2P1FA 1SZFA 1O12A 5CPLA 4E6MA 2NXHA 3BOFA 2CWXA 3OLGA 5BCAA 1RCQA 2CITA 3RU6A 1RD5A 3LPPA 3SRDA 5CH9A 2ON3A 3DENA 3T9PA 2CLLA 1FH8A 2X0SA 1UR1A 2CHNA 4PMYA 5JH1A 2Y5JA 1E4MM 2WYSA 4LYKA 4OHQA 4O50A 2X1TA 2FHCA 4UTMA 3LGEA 3ARUA 2D24A 5CG0A 2E7FA 1K8CA 3S0CA 1OJNA 1O5KA 2OLSA 3PPHA 1PKLA 5BMWA 1E4IA 4RZ5A 3GIQA 3OEXA 1W9DM 1TMLA 2GUYA 3BLKA 1ZSXA 3KZSA 4XZHA 3VM5A 4GVIA 5E5CA 3BANA 3MV01 4MY8A 4JPGA 3CXOA 3NSXA 1Q63A 2VC5A 5EBAA 4I8DA 3V0UA 2VUYA 4L65A 3NCOA 6REQA 1S5VA 1G0CA 1BAGA 4HK6A 3BO9A 1TZZA 1CB8A 4FIQA 3E5BA 4UZUA 1UB3A 5J8LA 4ENLA 2QUNA 4HOZA 4IWWA 2BDQA 2FPTA 4FK9A 1PAMA 3G1YA 3C4UA 4C6FA 5M1TA 4LAKA 1P0EA 1EPXA 5A6LA 4K7VA 4Q7NA 3GDBA 2JKAA 4AWEA 3RK8A 2GJNA 4HYRA 3LNPA 4PULA 1OC5A 4MGGA 2YB1A 4D8AA 1YDVA 4HNNA 4AEEA 3CMGA 3ZWTA 3KTSA 1UWUA 2J79A 4NNCA 1O4UA 1PE1A 4A22A 2WWDA 5A2AA 5EFDA 1UD8A 1H41A 3VK5A 4GNKB 2JIEA 1D3HA 2HROA 3AXHA 3W53A 2P3ZA 3IJ7A 3R94A 1YW1A 1GOKA 3BK0A 4UMAA 2HZGA 4NVTA 5F1VA 3TQPA 2V3DA 1WKYA 3G2GA 3VE9A 2AL1A 1EO5A 4UNLA 2BWGA 1JYNA 5I23A 2GVEA 2VHLA 3W82A 2ZKMX 4L64A 2DSKA 3UJ2A 3UFYA 1E5NA 1E56A 3U2EA 3OQ8A 1WZKA 5F1UA 2Z1XA 3G8RA 4DPQA 4XBSA 3RILA 1Q8AA 7PTDA 3KXQA 4KEVA 5GJPA 3CZLA 3GHSA 3EDKA 1UP0A 4C5ZA 3QV6A 3W85A 3DCPA 3I65A 2Z1VA 3EOLA 3PAOA 1RSCA 1WE5A 2ABAA 1Q6LA 4EF9A 2QDDA 2QGHA 1VBHA 3N6HA 4YLWA 5F4WA 5HPCA 3W1QA 1HN0A 3PTQA 5AZ1A 3W3OA 1US0A 5D2XA 5LIYX 1UD3A 1AMYA 4M1BA 1OCBA 3WJZA 4QSHA 2DZWA 3ABOA 4PR4A 3LPGA 2Q09A 5I03A 3W00A 3RCMA 1WBHA 1F73A 1XLCA 4UUIA 2A21A 5HNNA 2IS7A 3FOKA 1VCVA 1Q7ZA 1GZJA 1U5VA 3M7SA 3FK4A 1ITUA 2PA6A 2PDWA 1UPMB 1VBGA 4CD8A 1SM9A 2VEIA 2WHKA 3TN4A 1BXNA 3GNNA 4GX8A 3I4KA 3WNOA 4XZBA 4PBEA 4RE4A 3AWNA 3TP4A 4LVDA 4B5NA 3SUVA 1S2WA 3EA2A 3GNRA 3UWEA 4DPPA 3LM7A 4FHAA 1AL8A 1EA9C 4PCPA 1F7BA 3WL1A 5HNTA 1EA0A 5KSWA 2RJGA 3GVWA 3KAOA 2XH4A 3PANA 2PGEA 1ICQA 1GEQA 2NUYA 1E5JA 4MKVA 5GJNA 1ISWA 3KVKA 3TQVA 3MANA 1KFLA 1OF6A 4H2CA 2QPUA 3E9AA 4ZXOA 2O4MA 1ZAHA 5C71A 2BXZA 3GVQA 3G6MA 3W7KA 3KBMA 4R7WA 1AH0A 1V6UA 4LSBA 4QRNA 4U2YA 3UF9A 2GQ3A 1D7FA 5DMLA 1VFUA 2NQHA 3NVTA 4HYVA 3U8GA 3T0TA 3W1XA 4F0MA 3EOUA 1OFBA 5I06A 1VIZA 2NT0A 4CQ8A 2WM1A 3PZVA 4JKMA 4B5XA 2IKHA 1EGZA 2OKOA 5BOFA 5AYBA 3KOXA 3N15A 1FDZA 4I7UA 4HZ6A 1FWDC 3KVLA 2WKJA 5ABTA 1HTIA 1F3WA 3URNA 4DJFC 2XSAA 3DFHA 1V6VA 3H4WA 5C5YA 1OFRA 4YHGA 4KEUA 3G3MA 3N2OA 2BSLA 1BRLB 4NI3A 4AUBA 1XWYA 4AX6A 3F2CA 4CGTA 2V81A 4C6OA 2VR4A 3EDFA 2PDPA 1E0WA 2V82A 3AWOA 3BC9A 1QOPA 1LL6A 3C52A 3MCOA 3PSWA 4FP1A 4XD6A 1DJNA 1TJRA 1VCGA 4ML9A 3FJ6A 1ZBKA 1EEPA 2GOKA 1UJPA 1HKJA 3NG3A 4YTUA 1JYXA 2OSYA 2FTYA 1R5YA 2JQXA 3M0MA 3B8DA 3RO6A 3TTYA 2WKLA 3VINA 1GTHA 4ZFMA 4EANA 1GNXA 4IPIA 4PRWA 5DANA 2XN2A 2QLYA 3N9RA 1HGYA 3PHAA 1TA3B 2ISSA 1XF0A 3IUDA 1H11A 6TAAA 3W0KA 2D20A 3O6CA 4RXFA 2VKZG 2WQPA 4NASA 1XIIA 4FLSA 3H12A 5HJLA 1KV5A 3BZGA 1VYSX 3BG5A 4DEFA 1YX1A 3GTXA 4Q8UA 1FA2A 1GVOA 1VFMA 4IM4A 1A5CA 1M5WA 3TMLA 3G1VA 4NF7A 4GQRA 1A3WA 3RITA 1KXQA 4QCEA 1F9GA 2D2JA 5LGZA 4UBPC 2IKIA 1WDDA 4IH3A 3A3HA 3GQYA 4U10A 3NQ6A 4WJEA 1AQ0A 1G4PA 1H0IA 3ZM8A 2YBVA 1VJZA 1IQ8A 1EYEA 2J7DA 1GVQA 4CD7A 4M51A 2PPGA 4MDOA 4W7WA 4P8UA 3QOMA 3M5VA 5JMUA 3EPNA 3CO8A 2FVKA 3M64A 3O63A 2X42A 1H09A 3GXTA 5K4XA 2NXGA 2QV4A 3DUGA 1XYCA 3M1ZA 1QNRA 4LUTB 1ZB5A 4NJIA 3H53A 4DWSA 1KO0A 1XIEA 1EDQA 3A23A 1H0GA 3E1F1 5D4YA 3WLHA 4ATDA 2PDMA 2R1LA 4Z1DA 3TW6A 2E6YA 4PZVA 2QF7A 2FPYA 3KRBA 1JZ2A 4XZMX 4DF1A 3ZJ6A 3T2QA 1TVPA 1HJQA 1FWNA 2OYMA 3SAZA 3VGFA 4JFSA 1RY8A 3MHFA 3WF4A 5C9RA 4IMGA 2GVYA 5G2HA 3V3WA 3HGOA 3KRZA 1EPVA 1ONEA 1S2TA 4H8VA 2AKMA 4L4PA 3FXYA 5CJMA 4FXRA 2QS8A 4IXXA 3IV3A 1N8FA 4AYGA 3SCQA 2A5HA 1XGDA 4HA1A 1CIUA 3IVSA 9CGTA 4POCA 2GGIA 1LWIA 1F74A 2DIJA 1FWWA 4K68A 5J04A 3QGVA 1DORA 2YYTA 1B90A 2PLJA 3OG3A 4ACZA 2Z24A 1S5MA 3ZIZA 2HEJA 1YNQA 4PCSA 3D47A 4GQGA 4HMNA 4QE5A 1K7EA 1HKKA 1Q66A 3SSZA 1LT8A 1X39A 4CVUA 4UTUA 2VGGA 4MY1A 1TWIA 4BCEA 3ZOAA 4X61A 4ZOCA 3QQ0A 3BLLA 1VBJA 4Q4MA 4HP5A 3CZGA 1UMYA 1SYTA 3GC4A 1VYRA 2PTDA 3DECA 1TMHA 4JICA 1KGWA 1SR0A 5JUVA 3STPA 3GM8A 1F05A 5AB3A 2Z1BA 1YRRA 3P81A 4GX9A 3GD6A 3PBUA 2X30A 3MO7A 1TPDA 4LAOA 4HOXA 4NZ4A 4LVBA 4F0SA 2E1WA 3S6DA 3AROA 3L4XA 1WNOA 3WD1A 4QLJA 3C61A 3VZZA 3B9OA 3UA4A 3V5CA 2OT1A 3KCJA 5KETA 3C2EA 3G1DA 4Y9OA 3REQB 2XGBA 4QR6A 5HUOA 2CLPA 1VZWA 2H9AA 1PS9A 2MUCA 2ZWYA 5C7VA 4LYRA 4HPXA 4Q4PA 3S6TA 1K03A 4K38A 4IPLA 1X1HA 2O9OA 4TMBA 1H60A 3AYTA 2WMJA 3VKJA 3QLLA 5DY2A 4ZTYA 4X0NA 2TAAA 3G6LA 3E2RA 4M6UA 2WLYA 4O57A 4DLFA 4CEUC 4R88A 1Z7AA 2VX5A 1QHZA 5AVHA 4LAMA 4XSMA 1CNVA 3DXIA 3VOHA 2XN1A 2ISDA 4AZCA 5EPDA 4DB7A 1MI3A 5KZEA 1TWZA 1PZ0A 5D38A 3WQ8A 7ODCA 1EC9A 2D73A 1TPH1 5AHFA 3TCEA 3BLEA 3S2NA 4UTWC 5I3JA 3QKEA 1C7SA 1YBQB 3BV7A 4L7ZA 2BVYA 1TTIA 4DJEC 1UOZA 4Q4SA 5AC6A 3OVGA 4KW2A 3DI0A 1TPB1 1VRAB 1ZY9A 1H7WA 1G01A 4E8CA 3LMYA 1H62A 2CZFA 2WK2A 2DZAA 4LEQA 1HFBA 3NQAA 3POHA 4LQ1A 3WFAA 4D6DA 2DT1A 4WJXA 3VIIA 4PUDA 3NQ7A 1A4MA 1A47A 4FEZA 3L68A 4HJWA 5DT5A 2PD5A 1RWFA 1Y5WA 3LCWA 3GUWA 3HQ1A 1KXHA 3W7MA 3PUGA 3MCNA 3TN6A 4DY1A 4ZBCA 4O0KA 3VNLA 3SRHA 1HG3A 4DHGA 1ADOA 2YL8A 3OTRA 4O1EA 2DZSA 1TE6A 4K3ZA 2W79A 4LNCA 1AJ2A 3N17A 1A80A 4I3GA 4B4FA 2V3FA 4UR8A 1JCLA 3P60A 3IK2A 2YDRA 3MSYA 3T09A 4FR6A 3M0YA 5ABGA 1Q45A 3VKBA 4YNGA 1XC6A 3AYSA 3SY8A 3L5AA 5HANA 3CS2A 2O56A 3B8IA 2YLAA 4O18A 4L56A 3SGGA 2J7HA 4MJ2A 4JEJA 3QLDA 3VIHA 3LMZA 2OWXA 7TAAA 3LRMA 2PDLA 4KT2A 3SCRA 3VC5A 4ZA0A 5EMMA 2QCFA 2DSZA 2FZNA 1LL7A 3NO5A 1V3LA 1Q7QA 1EP2A 4L6DA 1AFSA 1VRDA 3PSVA 1XIMA 2GPTA 4XBKA 3FGCA 3BL3A 3MUZ1 1R3QA 1LLQA 4KIRA 1PIFA 4CCCA 4UMBA 3PM6A 4L4MA 3WLLA 3E0FA 3PS7A 1OFQA 2YXGA 4WOQA 2E77A 3IVUA 1KCXA 4LY4A 3SRFA 3HN3A 1RCXB 5FJIA 4QQUA 1LYXA 2E6DA 2G5WA 2WCAA 4GUGA 2HNHA 5DELA 2J9YA 1TV4A 4UQAA 4H2HA 3ZMRA 8CGTA 1JQXA 5C55A 3T2PA 1Q6EA 1VQTA 1FRBA 3R58A 1H1NA 3QY6A 4CNPA 1FH9A 1H49A 2VC7A 2YW3A 1C91A 3WH9A 2NVAA 3UCDA 5LNVA 2VURA 4UR7A 1XSKA 2QIIA 1LOHA 2WO5A 1LBFA 4ORMA 2W61A 4YTTA 3L2IA 4V1XA 1Z41A 1UH4A 4WRHA 1B30A 2VELA 3QM3A 4QDPA 4M56A 5HATA 4WY0A 3B8UA 2NQZA 3K8KA 3HJZA 1QHOA 2CLOA 4DO7A 3MMUA 1EGVA 1A4LA 4DJFA 1FX6A 1G7UA 4WSJA 4ZQNA 4DM1A 5D09A 4J3ZA 1KTBA 4H8NA 3BWWA 3OW1A 4AZHA 3NL2A 2YL6A 1YTDA 3ATZA 1QNQA 5DCDA 4AFYA 4GY1A 4KWWA 4F0RA 3VKDA 1FUYA 1U2YA 4O4WA 4I6KA 2FTWA 4A4AA 1RQHA 2QJJA 5GVJA 1BVZA 2RGLA 3CPRA 4H83A 1RBLA 1XINA 2G4JA 5CZKA 1L6SA 2QW5A 2VZSA 4R7OA 4J28A 4ONVA 3BAXA 2HXUA 3P2VA 2W63A 3GDRA 1XL9A 3OYZA 1MUCA 3R0KA 1MO0A 4HA4A 4EPKA 2GGEA 4WIWA 4AD5A 2H3BA 4Q8TA 2A4AA 5AHEA 4LRSA 1LBLA 2HQAA 1I2PA 4F8XA 2J88A 2Z1SA 4TX6A 4ATWA 2PEVA 5HULA 2O7SA 3W2KA 1ZCCA 4JIHA 2NV9A 1MRQA 2G3NA 3OPSA 5LNUA 3L65A 1XISA 3PB0A 1NF0A 3HPZA