4D6DA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the blood group a-trisaccharide (x02 mutant)
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
586
structure length
586
Chain Sequence
b'EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTESYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 219
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6dA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6dA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6dA02
4GI6A 5A8OA 3S2CA 4OZOA 5BRQA 1WDPA 1E3ZA 4TVCA 5GNXA 1G9HA 1HF6A 1OGBA 3AIWA 3EMCA 1CXIA 1AQHA 5I2UA 4JAWA 4HP5A 2EO7A 4MPKA 1B9ZA 1QW9A 1ODZA 3QHOA 2QMJA 4FF5A 1E70M 1E15A 1UR0A 1XHGA 4JFSA 3MV11 3WF1A 2FH8A 4B9ZA 2B31A 4D6HA 1ZBKA 4KGLA 1ITXA 4CN4A 1QNQA 3G6LA 2EBNA 5BXSA 1K9DA 1E6PA 4ATDA 1DWAM 4CUCA 3AMKA 3DC0A 2CIPA 4HA1A 3WF2A 3WF4A 1XH1A 1EH9A 4UNIA 1H5VA 3WY1A 2BHZA 3A4AA 3I3DA 4WSJA 5D9OA 3AXIA 3W28A 4BQ3A 4P7NA 3ARXA 1OB0A 4UQCA 4W86A 3GYCA 2WHLA 3GH4A 1JYWA 4KRUA 3OB8A 1I75A 3PZUA 2ZXDA 3LPPA 3W0KA 3VGEA 2ZX6A 3VDBA 2WSPA 1UD8A 4JIEA 2FHCA 3ZJKA 1E43A 3WDJA 1EGZA 3SCQA 4OJYA 3AI0A 2ZX8A 1EGUA 4EE9A 4GZJA 5KZ6A 3AXHA 1HJSA 3MSGA 2V3FA 2VX5A 4D6DA 2E40A 4F8XA 5JBFA 2WCAA 2WKLA 1AVAA 1V3JA 4HU8A 5ABHA 1QBBA 3CUJA 1HNYA 1GQKA 1KCLA 3QHNA 5A69A 2WLYA 3EDFA 4U5KA 3UCQA 1WCGA 1YHTA 2WBGA 3CIVA 3IAQA 4D1JA 1LQ0A 1IV8A 2WYSA 1IZKA 3VVGA 1VJSA 1HVQA 3MMDA 3PZQA 3RCNA 2XHYA 3B9EA 1X6NA 2J62A 2NT0A 1TFVA 1B3YA 1CLVA 1J0YA 1W3LA 4DWSD 1Q6EA 2YA2A 2XGIA 4R5EA 1IZJA 1TVPA 3WD1A 3VM5A 2WHKA 1D2KA 3WEOA 1QBAA 5BXPA 4NF7A 2WSKA 3WDIA 1I1XA 2JIWA 3W27A 3TTYA 2WMIA 5GPRA 1RWAA 5C70A 1CGVA 3II1A 3SCTA 1V0LA 3KZSA 4AYSA 1EDGA 1GOKA 1RPKA 2E24A 2O9OA 1ZBWA 3WDHA 4WKHA 1K9EA 1SMDA 2V3EA 3RJYA 4PEEA 3PZOA 1DEDA 1LL4A 1EDQA 2WCOA 1JNEA 2CITA 2YOCA 5HPOA 2JEQA 1DP0A 1QNPA 3W6LA 2D0FA 1GOOA 1Y7VA 3ARYA 1CPUA 1E6QM 1Q6CA 3POCA 1MW2A 1BTCA 2D24A 2XUCA 3KEHA 2JE8A 1A3HA 3D3AA 2VNCA 1QHZA 2A3AA 5A94A 1J0NA 5BROA 1VBUA 1I8QA 2WW5A 3VX1A 4W8AA 2YL6A 3OLIA 5EB8A 4FLSA 3THCA 4ATLA 3GDBA 4QCEA 4JZ5A 2C0HA 3SUTA 1TCMA 2ZUWA 2VI0A 1MWOA 1NWUA 2VOTA 3VO0A 1NOUA 1V6WA 3MO4A 2Y24A 3TP4A 3WENA 3VD9A 2J7EA 3EDEA 1HJQA 4UFKA 3BXWA 2GJPA 3WDRA 1JZ4A 3L2LA 1NQ6A 2ZX5A 3AHYA 2JEPA 4FLRA 1UWSA 1AMYA 1E5JA 1C8XA 1KGWA 1WDRA 2BY3A 5E6YA 1WB0A 2VT0A 4ACZB 1QNSA 4S3KA 4AC1X 2E9MA 4AY1A 3RIKA 4JCMA 4UQBA 3NJ3A 3SUSA 2BV9A 5A6BD 2YL8A 3VDCA 3AROA 2Y8KA 4HMCA 2YL5A 3FN9A 4HA4A 3WBAA 4GI9A 1UD5A 3AS1A 1P6WA 1ZS2A 4D6FA 4D1IA 2AOSA 3RPMA 4D6IA 3L2MA 1KXVA 1RWHA 3VIPA 4AD0A 3M07A 1RWCA 2D20A 4YHEA 5D9MA 4AD2A 1NOWA 1BG9A 3CHCA 1QNRA 2CKRA 4EANA 4HZ6A 3CMGA 4UFLA 4X0VA 7A3HA 3QGVA 3AMLA 2UY3A 1OGSA 2WLZA 3PN8A 4OUEA 3NSNA 5M5DA 4DUWA 1C91A 1SYTA 1WKYA 4XUYA 3POHA 5E0FA 2ZUSA 2GVYA 1PAMA 2CHOA 4AZGA 4OIFA 1ODUA 3BSHA 2WK2A 2XVNA 4BF7A 1SFSA 2V3GA 3TTOA 3QOKA 4WK9A 4GINA 1R86A 3GBEA 3BLKA 1TA3B 1BF2A 1EO7A 1H0GA 2Y4SA 1B90A 5BXTA 1LWHA 4EKJA 3ARPA 1UYQA 4AZIA 4W88A 2XG9A 2CNCA 1OJOA 3L4YA 4TVDA 3SEPA 3PTQA 5GNZA 4J3SA 3W25A 1OJPA 2W62A 1DTUA 4QAWA 4GO8A 1UA7A 3AHTA 4LQ1A 3VIGA 5A6JA 7CGTA 4NRRA 5A2BA 5I6SA 3CPUA 2D3NA 4N42A 3W82A 2OLHA 3VGHA 1UWQA 3VNYA 1JZ7A 4XZBA 1L0PA 2YLLA 4GO9A 1BVNP 1FH7A 2WZEA 2PWGA 1XYFA 4MB3A 3MS8A 1R87A 2X09A 1ZBCA 4UQEA 3AXXA 3AISA 2Z1SA 3PZNA 2X05A 3AMCA 3VD5A 4TVUA 1DWGM 4D71A 3WD3A 1PIGA 3BCDA 1E5NA 2VUYA 1RP9A 5A6AA 2YA0A 1NM9A 3PZIA 3T08A 1KQZA 1QHPA 3K8KA 1RD6A 1UOKA 2YDRA 5I0DA 1LJYA 3KL3A 4CVWA 1GUVA 3ZIZA 4HOZA 1EHAA 1SR0A 3WF3A 4P7LA 3UG4A 4P7RA 3CUHA 3N04A 2DQXA 4MTVA 3ZJ6A 1UQYA 3EMZA 3KL0A 2WM0A 1ZBVA 1WPCA 3T0AA 1AQ0A 1KWGA 2OSYA 2C7FA 4W85A 1JZ3A 4OOZA 4MB4A 5FL0A 2G3IA 3L4TA 4Z2IA 3G6MA 1LOHA 1AQMA 4B16A 1GORA 3FHQA 4L4PA 4JCLA 3WNMA 4AD1A 4PTMA 1CIUA 3WIJA 6TAAA 2YA1A 2O9TA 1H0IA 1B2YA 2XVKA 3VDHA 1JZ5A 1W3JA 3ZOAA 4IUGA 2ESCA 3ZJ8A 1BSIA 3O6AA 1J0HA 2WVUA 2J7FA 3VIIA 4CN6A 1WZAA 4Q22A 5HDRA 3CZKA 5HXMA 1EQCA 4P7OA 4W93A 5EMYA 3B9AA 1BYBA 1E1FA 2GDVA 2FGLA 3NYDA 1E6ZA 3WQ8A 4BCEA 5DMYA 2XGBA 4P8VA 2V3DA 3EYPA 3HU7A 3BAWA 5EBAA 1N82A 2XVPA 1XH2A 1CGWA 4NZCA 1V3IA 4QLLA 5A6MA 5AY7A 1X1IA 1VB9A 1U2YA 1G5AA 4S3JA 3GZAA 2OWWA 4ATWA 1FH8A 2FH6A 3A4WA 3BMVA 3OGVA 4KRTA 4E8DA 3GXDA 3CZEA 3L4WA 3N11A 1J0IA 1G94A 1ZJBA 3CHDA 3OA5A 4AD5A 1X1JA 2A3CA 1OT1A 2VQUA 1UZ4A 4PMRA 3BAJA 1N7RA 4NI3A 2V5DA 4UFJA 4X9YA 5ECUA 5IHSA 3OLEA 2YKKA 1UKPA 1TMQA 3VUPA 2CERA 3VIHA 2BRVX 1H3GA 3DHPA 3SUUA 2J7DA 5A3HA 4XV0A 2YBTA 5C71A 3CZJA 1V02E 2XM1A 3WL0A 1EOMA 4M82A 5E0CA 3WQVA 1UG6A 3AYSA 3EDJA 4W5UA 1J0MA 3WH6A 3TTSA 3WH9A 1DWFM 1PIFA 3LMYA 3OLDA 1EXPA 3RILA 5AC5A 2VCAA 2WAGA 4DM2A 4IPLA 3OIHA 3WN6A 3WFZA 4LX4A 1V6UA 2UWFA 5I5RA 3AOFA 4U5IA 3RJXA 2XFYA 2CETA 5M17A 6A3HA 2XIBA 2AAAA 1LG2A 1NP2A 2WWDA 4F9DA 4R27A 3OGSA 1B3ZA 1BQCA 1NP0A 4BS0A 4IM4A 1VRXA 1GHRA 2CXGA 4PUEA 1JXJA 4F9JA 4C7FA 3F5LA 2XWDA 3VD7A 3UG5A 1VAHA 1ISXA 1E3XA 2HISA 1CBGA 2W63A 3N15A 1UR1A 1E6RA 1VFFA 3CZ8A 4J3VA 4DUXA 1HJWA 3AS0A 4JL2A 4LYQA 4IISA 2FDMA 2ZWYA 3NUKA 1HN1A 1RWGA 4JHOA 4HOWA 5LYRA 1OJNA 3AS3A 2DT2A 2JF6A 2XYLA 2EJ1A 5AC4A 2CKSA 1E0XA 3WH8A 3NDZA 1PX4A 4CD8A 3ARQA 1J01A 1OJMA 5E09A 3AZSA 1CNVA 4QLKA 4B9YA 5M03A 4D6JA 1OIMA 4Y7EA 1N7PA 3QOMA 3FAXA 2VZVA 2EEXA 2DEPA 1HP5A 3GM8A 2D2OA 2F2HA 3M46A 4FMVA 1U30A 2ZOXA 1R7AA 1EHNA 2J47A 1CWYA 2V5CA 1KR0A 4AZBA 1J18A 1CGXA 1GVYA 2C8NA 2DPEA 3VGBA 3CTTA 3MUZ1 3IJ8A 4P8XA 1B3VA 4TTUA 1JZ6A 4AD3A 1VEOA 2F61A 2ZUNA 3SCSA 2UY2A 4JFVA 3JUGA 2G41A 3SUVA 2E0PA 1ISYA 1TE1A 2V38A 2CEQA 4QDMA 4J3WA 1V3KA 1H4PA 3MANA 1ZJAA 3W38A 1DHKA 3L4XA 1UWRA 3THDA 1HIZA 4BQ4A 2WMIB 1B0IA 4CCCA 3BAIA 3AJ7A 1NWTA 3BH4A 4GQQA 2VQTA 5CGTA 1FH9A 3SUWA 2VVSA 1H49A 1W3KA 3VGFA 3BGAA 5I77A 2GJRA 4W7WA 1JAEA 1EA9C 3ZQ9A 1JZ2A 3CLWA 4P8UA 2DH3A 1FOBA 2WBKA 3CHEA 4KH2A 5CSUA 4HPGA 4CD6A 1CXLA 1JYVA 2CBVA 4HOXA 4GZIA 2WVTA 1B1YA 3WD2A 5FD0A 1BYDA 1VJZA 2VZTA 4M81A 1UH3A 4M1RA 2CYGA 1QW8A 2EPOA 4ZXLA 1MW1A 1PEZA 3PZTA 4UQ9A 1J10A 1XSIA 1V6VA 2BHYA 3WNKA 2E9LA 2CBUA 1UD2A 4LYRA 4MNJA 4JKKA 2VTFA 2XSBA 5CPTA 5IDIA 5D9PA 5CPQA 3DECA 4PMZA 1QI3A 2Y8VA 3WNOA 2EPNA 2VX4A 1PZ3A 1V0NA 1NWSA 2OYMA 5A2CA 2WC4A 2CCRA 4PSPA 4AMCA 1KXHA 2J8FA 1ISZA 2YDQA 1C3FA 5D9NA 4MDPA 4PBGA 2YBUA 3IJ7A 5BRPA 1W9XA 4AZCA 1KWKA 1XCWA 3HN3A 1N7NA 1VENA 1ITCA 3VIKA 3K8LA 5I79A 1XH0A 3EBVA 3VILA 1KGXA 1QPKA 3W29A 4MB5A 1HKJA 3A6OA 3RDKA 3WQ4A 2JFEX 3N18A 4D6GA 1XGZA 2JIEA 4JL1A 5CLTA 1J0KA 5ABEA 1CDGA 1FFRA 4HU0A 4E2OA 3WL1A 1HN0A 1PJ9A 2D0GA 2W66A 2VR5A 4H8VA 1PPIA 2EXOA 5FOOA 2J4GA 3ZM8A 4UZUA 3WEZA 4J3UA 2ZXBA 5A6BA 5HOSA 3HJEA 5JIPA 4Z2JA 2GSJA 1V3LA 3M6DA 1WAWA 4ZENA 4RL3A 3WSUA 3N1AA 2ZIDA 4AEFA 3T0DA 5FIPA 4W87A 1ESWA 4FLOA 3WUEA 2FGZA 3BAKA 1Q6FA 1CENA 3PTMA 2G8ZA 1VEMA 1G1YA 4PMUA 2BY2A 1QI4A 1CXHA 4UOQA 5BWFA 2Z1KA 1JYXA 1UHVA 2DSVA 4MJ4A 4F66A 4LYPA 3U57A 2WC7A 2BVDA 3DHUA 4E4PA 1CLXA 2QV4A 5ABFB 2VX7A 1E4MM 2GJXA 4WLCA 5TD4A 1GZJA 1V08A 2X8RA 3VGDA 1S46A 1M7XA 3TOPA 2BRWA 3VMPA 1Q6DA 3MMUA 4H8HA 4PSRA 2IXUA 3O2LA 4CD4A 2NW0A 1E4IA 1MW0A 2X03A 1GJWA 3W24A 2J78A 5ABFA 1M01A 1UR2A 3AIQA 3RM4A 2X0YA 2DIEA 1H1NA 5FKYA 5AYIA 1JD7A 4UQAA 1R7OA 1UKOA 1QI0A 3VIMA 1O6IA 3ZT5A 1KGUA 4PMYA 1ZU8A 4CKQA 2ZXAA 4TOQA 4MNMA 1N7OA 1Q4NX 5CXPA 5A6LA 1TZ7A 2PWDA 1FA2A 3B8SA 1EO5A 2GUYA 3WFLA 4CCDA 2QPSA 4W7UA 5F7UA 2PWEA 1HM2A 1LG1A 2PI6A 1D7FA 4AEEA 1YQ2A 4OOUA 1BHGA 3N17A 1XV8A 3F5JA 4MNLA 1V02A 4QLJA 3T2OA 1XSKA 3BC9A 1KCKA 4Z2KA 2G3MA 2GFTA 5JIWA 3VX0A 1OGGA 2DT3A 4ZXOA 2EPMX 2OYKA 4UQDA 2XFFA 1JDDA 3WBEA 3AHXA 4B15A 1EOKA 2CESA 1WE5A 2J7BA 3VMOA 3CH9A 4PCSA 3PBGA 4GI8A 5E70A 4BQ5A 1V03A 3KL5A 4AZ6A 2JALA 3RM9A 2J75A 3ARSA 1W2PA 2TAAA 5IFTA 4XX6A 2WC3A 2X1IA 4V27A 4J7RA 2WVVA 4AZHA 4PMXA 3AYRA 1RW9A 2CBIA 3CBWA 2W5FA 2DSZA 1B3WA 4UCFA 2PWHA 3FHAA 1MFUA 3ZMRA 1HJUA 4CGTA 2VJXA 1FFQA 1M53A 4KWUA 2VX6A 1E56A 1H41A 1VFMA 1FP9A 3AMDA 2J7HA 1E1EA 4HMEA 5IXEA 3DYOA 3WNPA 3BAXA 3FXYA 4BZYA 4WKAA 3OZOA 2WXDM 2BS9A 3UETA 3U7VA 2ZUMA 2YDSA 1Z32X 4IPNB 5EFFA 9CGTA 4YPJA 3W81A 1GJUA 5A95A 5BXRA 1NOFA 1QVBA 3ARRA 1GVIA 5CSYA 1E6XM 1GOWA 5A8QA 1MXDA 1C90A 2CBJA 2Q8XA 1X6LA 5JBEA 2J77A 1F9GA 1NARA 1W9DM 3GNOA 1C92A 4DM1A 3VU2A 3HMCA 4CD7A 2E8YA 2YIHA 1JF5A 1JI2A 4PUDA 3W37A 3BLPX 1MQRA 4UR9A 5DT5A 4BQ2A 2XVLA 4PMNA 1BPLB 4C7GA 1LLOA 2DSUA 2VMFA 3WDQA 1JZ8A 3ARZA 2J74A 4ZE4A 2X0HA 1JGIA 1F1SA 1R8LA 1UH4A 5D8WA 1B30A 2WCSA 1UUQA 3OLGA 1NH6A 1W2VA 1OIFA 4AZ7A 1HP4A 1KFWA 2D3LA 3UEQA 5M3WA 4OBSA 1UD3A 1KBKA 3RM8A 1E71M 5IFPA 2WPGA 1KBBA 2VVNA 1UR9A 3IANA 1VBRA 4FLQA 1RP8A 3SCWA 2BFGA 3WDPP 3O9NA 3ARUA 4QP0A 2ZUTA 2VRKA 1GOIA 1HJVA 1W3HA 3VTRA 4PMQA 3EDDA 2Q1FA 2G4FA 4ML4A 4AIUA 5KEZA 2O92A 1GQJA 1XRVA 5E6ZA 2WWCA 2ZICA 3SCPA 1WO2A 2Y2WA 3WNLA 1CXFA 4GKLA 1ZB5A 1CGUA 3ZO9A 2VURA 1M04A 2DT1A 3EMQA 2WZHA 1J0ZA 3QR3A 4ZFMA 4N0RA 4GIAA 3LPFA 1FHDA 1TUXA 1KR1A 1W9BM 5A8NA 1W9UA 2VC9A 5FCZA 3DYMA 1KXTA 3KE0A 1V6XA 1IT0A 1XSJA 4JFWA 1V6YA 3ARVA 5IHRA 4CVUA 4JKMA 3ALGA 1LXKA 1UR4A 1H11A 1C93A 1LL7A 4RE2A 4MB1A 2QHAA 3AICA 5DT7A 1QNOA 4MJ2A 1JI1A 1BGAA 1PX3A 1BYCA 4V2XA 3U5UA 1HL8A 1M03A 4C7DA 3BCFA 1CTNA 1LL6A 5E9AA 3WMCA 1W9PA 2PC8A 5DO8A 2BXZA 4M56A 1OT2A 4H04A 1BG4A 1JIBA 1MYRA 2XVGA 3CUFA 3OGRA 3UR8A 1GPFA 1GQLA 3SCUA 4FK9A 1DWJM 2ZX9A 5LA0A 2CHNA 1WZMA 3MU7A 5GNYA 3PZMA 1CXKA 1UA3A 3WUGA 4QCFA 5HNNA 3AIBA 1QI2A 3WD4A 1ZL1A 1E9LA 1W3YA 3WUBA 3VNZA 3GH7A 3WEMA 4A4AA 1US2A 1C8QA 1HM3A 2OSXA 3GXIA 2YLAA 1GQIA 4W8LA 3WELA 1E55A 4CN1A 1O7AA 5A6KA 2O9RA 3PHAA 3MUAA 4D72A 3NSMA 1HKKA 1HL9A 2YJQA 2D23A 1MW3A 1CB8A 4CU6A 1WDQA 3K8MA 4U3CA 4DWSC 2EPKX 1L8NA 4Z2LA 4F79A 2D22A 2ZE0A 3SIMA 2WMJA 1N7QA 3MMWA 3NIYA 3WF0A 1E4NA 4U3AA 2J25A 2EQDA 3ZR6A 4AIOA 5CGMA 2QLYA 1I1WA 2Y5EA 2OWCA 2F8QA 4B3LA 3ZJ7A 2HVMA 1TR1A 1CXEA 2G3JA 1OD8A 3GXMA 1C82A 3MV01 2PF0A 3AS2A 2VL4A 3FNDA 3CUGA 4U33A 4L4OA 1MFVA 1XCXA 5CZKA 5A1AA 3MUY1 2BY1A 4DWSB 2WANA 1VIWA 3PZVA 3BSGA 2WMKA 1V0KA 2ZX7A 4UFHA 2BY0A 2D1ZA 3N9KA 3NSXA 2BRPA 5I24A 3SURA 1UKQA 4M29A 1ISWA 1R85A 1UD4A 1GNXA 3VINA 2DT0A 3AFBA 2WMFA 2J7GA 2EPLX 4ACYA 2WB5A 4WF7A 3NCOA 3OG2A 1MQQA 4U31A 4DWSA 1TG7A 1E6SM 1JD9A 1H2JA 1J0JA 3GBDA 4CU7A 3WH7A 2W61A 1E0WA 3IK2A 4EK7A 4PRWA 2FHBA 1FHLA 2D0HA 3OZPA 3S6TA 3AIVA 4P7QA 3ZT6A 3GH5A 4LGXA 3TONA 1PBGA 1E0VA 3ALFA 1JFHA 1F4AA 1MQPA 4W8BA 1BAGA 1LF1A 1JF6A 4X0NA 1B3XA 1NWRA 3AIUA 3E1F1 5ABGA 2BHUA 5D4YA 5C8BB 5JBDA 2XIIA 3CZGA 3WQWA 4TX8A 3ARTA 3M7SA 4OKDA 1UKTA 1JAKA 3AZRA 4AZCB 1OWQA 4H7VA 1KQYA 2W91A 1CECA 1G0CA 2WZIA 1G01A 1WDSA 4J28A 1E40A 4HA3A 1RH9A 8A3HA 1CGYA 1VFUA 2J8GA 1XD1A 2DSKA 3WQ5A 2PBGA 1DWHM 3AIEA 4E8CA 3T0BA 3FW6A 2XPKA 4UFIA 5HPCA 3I3EA 4NRSA 1F4HA 4AIEA 3WNNA 1U33A 4PN2A 3N12A 1GOMA 3A4XA 4MAVA 4HZ7A 4UOZA 4JHZA 1GCYA 1CEOA 4Z2GA 7TAAA 3AHZA 2NSXA 3A3HA 2OYLA 4H41A 1JXKA 3KWXA 2BNJA 3SCRA 1UR8A 4W7VA 3FAWA 1GHSA 3MKKA 4MAZA 3VD4A 2MANA 1VEPA 3GNRA 1CGTA 3VKKA 5HBFA 1OD0A 3F5KA 3VDAA 1LWJA 2O9PA 1HX0A 2VCCA 2VCBA 1J9YA 4HMDA 1V0MA 4PYSA 3ZR5A 1JNDA 4UTFA 2J79A 4WJXA 3MSDA 4HTYA 3FY1A 4M24A 1EQPA 3VD3A 1JFXA 4K68A 1BLIA 3A47A 2NT1A 3NDYA 2GJXB 1JL8A 1BFNA 4AZ5A 1QHOA 1EDTA 4H8UA 4V28A 4PTWA 2WNWA 3K4AA 1E73M 1X1HA 1W1TA 4D6CA 4ACZA 5CG0A 2RGMA 4HPHA 3IAPA 4GPNA 2G3NA 4QFUA 4AD4A 1C7TA 3EDKA 5LA1A 5I78A 5A8PA 2BVTA 4CCEA 2WMGA 5A8MA 3T09A 2WVSA 3ZSSA 4PCTA 2VZOA 1MXGA 2BXYA 3VMNA 2DH2A 1HKIA 1UD6A 4ZE5A 1W32A 2QPUA 3SCOA 3CO4A 1J12A 4J3XA 4AXNA 5DEZA 5CQ1A 4TTGA 5LA2A 1W91A 1US3A 8CGTA 1XD0A 6CGTA 4KMQA 3K1DA 1QI5A 2UY4A 2XJ7A 1HJXA 4TUFA 4JFTA 1JYNA 2OWXA 1UKSA 4A3YA 3U7BA 1XC6A 2WHMA 2E22A 4AW7A 1HKMA 2W92A 3K46A 4DUVA 4WKFA 4YHGA 4HZ8A 4JKLA 3ZT7A 4CD5A 3LPOA 3L4VA 4XB3A 1GONA 3GTNA 4KGJA 3AZTA 4UZSA 2ZXQA 2DSWA 4WSKA 1D3CA 2E9BA 3VIJA 2VO5A 1TA3A 3CHFA 5AYBA 1W1VA 2WHJA 3SCVA 4BA0A 4U2ZA 4NSBA 4J27A 4RE4A 5D8ZA 4AWEA 2GDUA 3I3BA 3CUIA 2WVVB 5JUVA 3BAYA 3WKZA 4A3HA 2W67A 3WQ6A 2QMKA 1C7SA 4Q7NA 3UG3A 2WKGA 4ZEPA 5I3DA 3WUFA 4UFMA 2OSWA 1B31A 2BVYA 2A3BA 3GXFA 2ZUVA 1WP6A 1TVNA 2FHFA 5BYWA 2VRJA 4W84A 4EAMA 3TA9A 1UWUA 3OBAA 3RMEA 1GOQA 3AHVA 2WDAA 1V3MA 2J7CA 1WZKA 3D5HA 3W53A 3WMSA 1HMUA 3L4ZA 4PMVA 4D6EA 2XSAA 2VZUA 4GZEA 4W5ZA 2E4TA 1OCQA 3IJ9A 2VR4A 4J3TA 3AQUA 1ECEA 1BVZA 4Z2HA 4P8WA 5EFDA 1JG9A 4MDOA 1LXMA 4U2YA 1VFOA 4LPCA 1K9TA 1J11A 1ISVA 1HXJA 5A2AA 3K4DA 2A3EA 1Q6GA 1GW1A 4PMOA 3VGGA 2YL9A 1DWIM 3QHMA 3F4VA 4GQRA 1OSEA 5CPSA 3PZ9A 1PX8A 4WIWA 1K6AA 2XWEA 3BMWA 4M8UA 3CZLA 3PTKA 4W89A 1EIBA 3LPGA 3N13A 4RE3A 1OM0A 4URIA 5BCAA 2W4XA 2ZUUA 2IXVA 3W4RA 1E6NA 1E4LA 4TX6A 3UR7A 3W6MA 1JDCA 1CYGA 1SMAA 2GK1B 2DIJA 1HMWA 5CJ5A 3PZGA 4M80A 3W26A 2XTKA 1BYAA 1KXQA 1W1YA 1MVYA 5FL1A 4GXPA 2QF8A 3UESA 2ZWZA 2IUZA 2E3ZA 4OBRA 4PTXA 3CMJA 1HT6A 1OBAA 2WMHA 1E72M 3VIOA 4MADA 3DYPA 3VOCA 2AMGA 2VZSA 3B9DA 3T2PA 1KB3A 4MNKA 4B3KA 1CZ1A 3T2QA 3U5YA 2GK1A 3AIRA 3SCNA 3VIFA 4YN5A 1BGGA 3GNPA 5I23A 1JDAA 1WNOA 1A47A 2DDXA 1UZ1A 1XYZA 3RO8A 1WZLA 1RWFA 2PB1A 4H2CA 2JF7A 1UWTA 1H09A 1QOXA 3ECQA 4AISA 2DGAA 2RGLA 4UOJA 5DF0A 1W9VA 3AMGA 1UQZA 2CPUA 1V3HA 3MUIA 3WD0A 1C8YA 3VPLA 5DFAA 3ARWA 5A6SA 1PZ2A 4JFUA 2X2YA 2XFRA 1VF8A 4PTVA 4XZWA 4LXFA 2XM2A 1HVXA 2PWFA 3L4UA 2WCGA 1X1NA 4PMDA 3ZSTA 1UH2A 3APGA 1FP8A 2UY5A 1OINA 2VRQA 2E8ZA 3WH5A 1K9FA 4CU8A 2PBOA 3VM7A 1W1PA 4TXEA 5CLWA 3TTQA 5GQBA 3UERA 3CGTA 3WMBA 2A3HA 1UWIA 3J7HA
chains in the Genus database with same CATH superfamily
4FPSA 5JQ9A 1Z44A 4LY8A 3S2CA 4OZOA 4Y9PA 1UP3A 1E3ZA 4E4FA 5LZLA 1G9HA 3NXFA 1OGBA 3AIWA 3EMCA 1TO3A 3BLFA 2NVCA 3KVLA 5I2UA 1TELA 4C6DA 2EO7A 3E9AA 4LYKA 1UR0A 1XHGA 2FH8A 4B9ZA 2JGQA 5D38A 2CLLA 1ZBKA 1ITXA 5BXSA 3T7VA 4JEQA 3QM3A 1DWAM 1VFTA 3LHVA 3WF2A 3IIXA 3TCEA 1GG0A 4XTIA 1FQ0A 1ZAIA 4UNIA 4AIBA 3MBFA 3TYDA 3I3DA 2PDMA 2Z1WA 4LT9A 5D9OA 2ZTKA 3MP3A 4P7NA 3N19B 4UQCA 2BASA 2G3FA 1EX5A 4KRUA 3OB8A 4BEQA 3PPCA 1J4EA 3O6DA 2ZXDA 3VGEA 2QT3A 4JIPA 5EYWA 1S2AA 3IV8A 1DJXA 3WDJA 4M6UA 3FV9A 3C2OA 1PTAA 4LBUA 5KZ6A 3P81A 1HJSA 2FJKA 1TTIA 2VX5A 4D6DA 3L2IA 1R9ZA 5JBFA 2WCAA 3TJLA 4DJFA 5ABHA 1EB3A 3LZ3A 1IQ8A 1GT8A 1KCLA 3V4BA 5A69A 2ZQ0A 4CQBA 3DU0A 4L56A 3AC0A 3C0QA 1GEHA 4HK5A 2Q3RA 3CIVA 3IAQA 1PDYA 2YXXA 4EOUA 4GYFA 3HIJA 5C9RA 4FX8A 3WJSA 2XHYA 1YNPA 4Y9NA 1TR9A 3NQ7A 3U2OA 1ICQA 1CLVA 4DWSD 2YA2A 4QJ3B 2XGIA 4R5EA 1TVPA 3KP0A 3UVAA 3WEOA 1QBAA 1X7IA 5C2CA 3R0UA 2JIWA 3CV7A 2WSYA 4LSBA 1AJ2A 3W1LA 5C70A 4O13A 2OT0A 1TPVA 4AYSA 3W2MA 7REQA 4HD5A 2BSLA 5TAOA 3SFKA 1EC7A 4E5TA 3WDHA 4O4VA 4DXVA 1DEDA 4MWAB 2DW7A 4K8GA 4AWTA 5HPOA 1FXQA 2VELA 3B05A 1XF0A 4GBUA 5I3HA 3ARYA 2OZTA 1MW2A 3W76A 4KF1A 2D24A 1OEPA 3D3AA 1QHZA 5HUPA 2WW5A 4W8AA 1AQFA 2YL6A 3TWBA 5EB8A 3GDBA 4JZ5A 2C0HA 3KCJA 4JR5A 3V18A 3M43A 1FWFC 2Z00A 3EX6A 1XG4A 1NWUA 2PU1A 2GZXA 3NGJA 3TWAA 1NOUA 4I7VA 3G1HA 3OYXA 3MZ2A 3MO4A 2HPIA 2V8ZA 1HJQA 4UFKA 1MI3A 4ROQA 1TQJA 1AL8A 3S9ZA 3KFTA 2OKOA 1JZ4A 2ACSA 3CASA 5B7YA 4LF2A 1KRCC 3I7QA 4R3UA 1E5JA 4Y90A 2BY3A 5AHNA 1AW1A 3OODA 4FR6A 4JCMA 4UQBA 4C6PA 1UPMB 5F2MA 3P74A 3OA3A 1P43A 3UFYA 4PZVA 1EJVC 1HQTA 3AROA 2Y8KA 2YL5A 4UIOA 3WBAA 3SM0A 4OECA 1SJAA 2QAFA 3VZZA 1EEXA 4O1CA 3BLDA 3APTA 4D6FA 1TX2A 4H4IA 4D6IA 3DBPA 1KXVA 2PTDA 1Q7QA 1S5TA 2D20A 3BLEA 1G67A 5HNTA 3MPGA 3G77A 4HNTA 2E6DA 4HZ6A 2GL5A 1XIJA 3LLDA 3QGVA 3AMLA 4MZ8A 4HQVA 1OGSA 4ZB5A 4OUEA 3PN8A 1C29A 5M5DA 4DUWA 1WX0A 1C91A 1ALDA 1SYTA 1WKYA 5CZSA 2TODA 1JDFA 2Y7FA 4FX7A 3VCRA 3GYEA 1UC5A 2GGHA 4ZO9A 1JQXA 4GXMA 4AZGA 2ABBA 4O17A 3TH6A 4OIFA 4IPIA 3V5CA 1M7PA 2WK2A 4U4MA 3GLCA 3NXLA 4WK9A 1VKFA 4GINA 1R86A 2FB3A 2ZC1A 3S2NA 5C2GA 3CC1A 2PD9A 1BF2A 1EO7A 2Y4SA 3ARPA 1TCDA 2ON3A 3TKFA 4FSAA 4W88A 3TZFA 2HK1A 1OJOA 3L4YA 5BU9A 4GX9A 1F7BA 3W25A 2QJNA 1YKWA 3TW6A 1ME8A 2W62A 1DTUA 4PEKA 4QAWA 3AHTA 3NGFA 4NRRA 5A2BA 4S3FA 3W1XA 1RY8A 4B91A 3EEZA 1YIXA 2E5BA 3TOYA 4GUIA 4KESA 3VGHA 4F2TA 2HQAA 3FVDA 3KBWA 2QCLA 2JBMA 2YLLA 1A5SA 1I45A 1NF0A 3NG3A 3UWUA 4MB3A 1XYFA 1R87A 2X09A 2Y5SA 4I5XA 3MYPA 5D2VA 1PIGA 4H7ZA 1E5NA 4HB7A 1ECQA 5KMYA 2NUWA 1MRQA 2C71A 2YA0A 1G4EA 1QHPA 1RD6A 2Y1HA 3H2EA 3PWIA 3URBA 2YDRA 3G0SA 3UF9A 5I0DA 1DHPA 1VRAB 2EG8A 4CVWA 4HOZA 1EHAA 2R14A 3DAQA 4DYKA 4H8NA 3BV4A 2YGYA 3D0CA 4MTVA 3QC3A 3Q2DA 3WG6A 4XBSA 4FIQA 3HG3A 4S39A 3FYYA 4EF9A 5H1WA 3N25A 1AQ0A 4WQ6A 5DXYA 5FL0A 1AQMA 1GORA 3FHQA 3KBTC 4NY2A 4DIAA 2YZ5A 4NZJA 4Z1AA 4J3ZA 3NZRA 3NQCA 5AYXA 1PHWA 4Y9AA 4QJ5B 1FWTA 4IJRA 1JZ5A 2OGYA 4IUGA 4GFSA 1GZGA 1JUEA 2ANUA 4ZTXA 3V1HA 3VIIA 2ZZ2A 2A79A 2AQWA 5HXMA 4XD6A 4PE8A 5CAKA 4P7OA 4JTGA 4W93A 5EMYA 1SFTA 3B9AA 1E1FA 4NYUA 3WQ8A 5DX7A 3BQ5A 4H6QA 4K36A 1QO5A 4QAIA 4P8VA 4LAMA 2PC4A 4LVFA 1P1XA 1S2VA 3PBWA 1PVNA 1SFLA 2ZVRA 2DU2A 3NAVA 4DELA 5FACA 4DAFA 3CMFA 3GZAA 1OFBA 4M7SA 3W83A 3F4DA 5CPOA 2QQ6A 2IPFA 3A4WA 2XIOA 3L4WA 1X1JA 1SGJA 2A3CA 4INFA 2HPMA 4UFJA 1H60A 2FZ9A 1N7RA 3A22A 3BAJA 3IEBA 4X9YA 4GVGA 4S3EA 3RN6A 2DZAA 3VIHA 1H3GA 2HCVA 2DZWA 5AZ1A 5LHEA 3EDJA 4W5UA 3TTSA 3WH9A 1DWFM 1PIFA 4DF1A 1EXPA 3QV9A 4E8GA 2VCAA 4DM2A 2PTWA 1REQB 3TAOA 3DFPA 1MDLA 4IX2A 5I5RA 4U5IA 2XH4A 3PSVA 4HYRA 1SW3A 5M17A 4JTFA 6A3HA 4NNCA 3IK4A 2XIBA 2AAAA 3TSBA 1F74A 1EJWC 1B3ZA 1YPFA 3QV6A 4BS0A 2GLKA 4C6NA 1JPDX 1PO9A 2PD5A 4MSSA 5H2ZA 1OZMA 1ZQ5A 2XWDA 3UG5A 1ISXA 1E3XA 2PDIA 2W63A 2OX4A 3N15A 1E6RA 4PULA 1VFFA 1XM3A 1H7OA 1XKJA 2QPXA 3BJTA 4LYQA 3URQA 4ZMGA 1XL9A 4N9CA 3W70A 2ZWYA 3UNTA 1HN1A 3S47A 4MZYA 3M0LA 1OJNA 3AS3A 2DT2A 2JF6A 3GR7A 2XYLA 3URAA 3ANVA 3ARQA 1KRMA 3CUXA 2VGBA 5FA5A 1VGAA 3VAVA 1S5NA 2OJPA 2VZVA 2R1KA 2F2HA 4C5YA 3K13A 2Y63A 4L64A 4EWJA 4QSFA 3RMJA 3N6QA 3R43A 2J47A 5HATA 1KR0A 5G4EA 1J18A 3CAQA 1CGXA 1GVYA 1GPWA 1ITQA 3VGBA 3BWWA 4R88A 4Y9MA 4S2BA 2P0OA 3QXBA 2ZUNA 2ABAA 5BNKA 3GD6A 1NSJA 3KAOA 1TSIA 2G41A 3SUVA 3SN4A 1RCOB 2EG7A 2E0PA 3CH0A 1LROA 4LRTA 4CNUA 1L6FA 1H4PA 4Q8WA 2DZPA 1ZJAA 2WJFA 3W38A 1UWRA 3MZNA 4PUUA 1ME7A 3THDA 4QM1A 4L1GA 3W7PA 3CIXA 4CCCA 2QUUA 2P10A 1NWTA 1UIOA 2ZRUA 4QQUA 5RUBA 2G37A 4Q8QA 2PWUA 1F6KA 3DKJA 2VVSA 4QNEA 1W3KA 4RXGA 3BGAA 1EZ2A 3ZQ9A 4QE1A 3GVWA 3CLWA 2A21A 4KH2A 3P8IA 3H55A 2WVTA 3UQNA 2VZTA 1SZRA 1ZSXA 4M1RA 3GG7A 4YIWA 1EBHA 2C6QA 4BI7A 1PEZA 1FHVA 1XIBA 2OT1A 3WNKA 2E9LA 4EXBA 3RAOA 3CEUA 4PC8A 2XSBA 4LUIA 5CPTA 4ZVJA 5D9PA 2PDUA 1EL3A 1TX0A 3KDNA 3UJEA 1TPUA 3WNOA 4DBUA 3M7WA 1PZ3A 4QEHA 3FEQA 2C79A 4DJDC 2WC4A 1CW2A 3WK3A 1KXHA 5EL1A 3T40A 4GD0A 4PBGA 3W02A 5G2WA 3SJNA 4NILA 1FXPA 1KWKA 4YJ5A 4GI4A 1VENA 3VIKA 1XLEA 4ROPA 3VOJA 1R9YA 2ZDRA 5KZEA 3EBVA 3VILA 1KGXA 3W29A 1DE5A 3ZVHA 4D6GA 1XGZA 4JL1A 3CLMA 3M4HA 3NL3A 4JTTA 4KWWA 1CLKA 2HNHA 2EKCA 3H2NA 2J4GA 1S2CA 2Y85A 5HOSA 2NQ9A 4IL0A 1IXPA 3W2LA 1WAUA 4MUPA 4Z2JA 4HU4A 2GSJA 1M7JA 3KRBA 4RL3A 2P88A 3RF9A 3N1AA 3CT2A 1O95A 4AEFA 1TUFA 3T0DA 2V9DA 1ML1A 4OQVA 1KM4A 4W87A 4FLOA 3Q94A 4KPLA 2FGZA 3T0TA 1FWNA 1A0EA 3PJTA 3I68A 1G1YA 4DPQA 4A8LA 1Z69A 2VFDA 2HEJA 2DSVA 1IWBA 4GRSA 3EXTA 4LYPA 1VFHA 1T7LA 3EPNA 2WC7A 3QFWA 1P0EA 5IDZA 1CLXA 4A35A 4I8DA 5ABFB 2VX7A 1Z3NA 1U1JA 1WKDA 1V08A 1DORA 1S46A 2PTXA 3DH7A 4NJGA 2B4GA 2YCJA 1IEXA 1P0BA 1KBLA 3O2LA 4O15A 3N2TA 2NW0A 4GIYA 3OW1A 1O1HA 4BY3A 3DG3A 3W24A 1HKWA 1M01A 1ONXA 1UR2A 3RM4A 4AEOA 3OQEA 4JQ4A 2X30A 1JD7A 1UKOA 4NAEA 1F6YA 3ZT5A 4L7ZA 4YWSA 4JTEA 1OCBA 4TOQA 4ERAA 4MNMA 5DY2A 3QF0A 1SR9A 3AYTA 3BOLA 2GUYA 3WO8A 3LRLA 3S4TA 3QW4B 2CLEA 2PWEA 3UNDA 1HM2A 4ZOEA 3BV7A 1LOSA 4OOUA 2GQAA 3NZPA 3F5JA 5IOBA 3UT0A 4MNLA 1X8FA 1XSKA 4CQAA 4B2DA 2GFTA 4WHBA 5JIWA 4K8HA 3VX0A 1ONEA 1XDMA 2PCQA 2GWGA 3WBEA 1L2QA 3QMSA 5DMMA 4MKNA 4DX3A 5E70A 4GI8A 1SZNA 4AZ6A 2JALA 1O1ZA 4H6EA 4AVOA 4Z1DA 2XIQA 4XX6A 5C7VA 2WC3A 1Q6RA 2Z1XA 5GVJA 1RW9A 2E25A 2CBIA 1I6NA 1MFUA 4Q4MA 2J27A 2VJXA 3C0SA 1FFQA 1ENUA 4CGTA 1EPXA 2PZ0A 5D2XA 1EC9A 4FR1A 4GNKB 3DYOA 6ALDA 4ZODA 1L9WA 3FXYA 3IGSA 1E1CA 7XIMA 4IPNB 9CGTA 1BRLB 3VNIA 3ZWSA 1XIIA 5BXRA 3O6CA 1YTEA 1Y8BA 5ENLA 5CSYA 1YEYA 5A8QA 2FVMA 2J8TA 1OG6A 1X6LA 4PTDA 1BEUA 1PCKA 4EP8C 3MJYA 1UC4A 4DM1A 2V2DA 1JF5A 1JI2A 4PUDA 2FGBA 2JKAA 1MQRA 3BLPX 5DT5A 2XVLA 3KDOA 4IMFA 3UJSA 1BPLB 1QO2A 2WO5A 2GOUA 3WDQA 3WFAA 4LCRA 2QKFA 4RDVA 3ARZA 4JEJA 3CAWA 4ZE4A 3GHRA 1F1SA 1TPC1 1H61A 1UUQA 3MO7A 3OLGA 1W2VA 1HP4A 1KFWA 2D3LA 1UD3A 4MGGA 3IJQA 1E71M 1XISA 5IFPA 5DBUA 2WPGA 2VVNA 1UR9A 3IANA 2VGFA 3LHYA 1W5PA 2QDHA 5D02A 3O9NA 1GOIA 4L6HA 3VTRA 2JK2A 3EDDA 2PDLA 2Q1FA 2O92A 1YYAA 2OO6A 3GAKA 2QJHA 2OELA 2D2JA 2VURA 4L6DA 1JVNA 4N0RA 2Z1VA 3LPFA 3FKKA 2AKZA 1TZZA 5A8NA 1KFCA 3H2FA 2VC9A 2CZ5A 3RNDA 3A5VA 3S46A 1XSJA 1YRRA 3ARVA 3QLLA 3ALGA 2G96A 1LXKA 1UR4A 1H11A 1C93A 3M0YA 4ZOAA 4RE2A 5LIKX 1HO4A 3DI1A 1QNOA 4MJ2A 1JI1A 3CQJA 4V2XA 2WNZA 2WNQA 1PB0A 3ZXWA 3R11A 6PTDA 1CTNA 4DQWA 4O18A 1LL6A 5E9AA 1GTEA 1Z42A 1NFPA 3NQEA 3AALA 2VFFA 4CEXC 2XVGA 4DNMA 1Q13A 4MY8A 4FK9A 1QWKA 4Y8FA 3W84A 1WUEA 5LA0A 1NF7A 1WZMA 3MU7A 3PUOA 4QCFA 3GK0A 4E38A 3CWHA 4KS0A 4AMAA 3WUBA 1ZTVA 1EC8A 2OLAA 4HN4A 2GGGA 2YR1A 3GXIA 4F0KA 1HFBA 1CB2A 2PF8A 4NJHA 3LV5A 1Z9AA 5A6KA 4NZ5A 1V77A 2WSRA 2YJQA 4HKPA 3DGBA 4QR6A 3K8MA 1ZFJA 3W86A 2D22A 4FNRA 4RNIA 3BGGA 4NQ1A 3NL6A 3WF0A 5D30A 2EQDA 3P8JA 1HKVA 2PDHA 3VNDA 3LHWA 3GXMA 2PF0A 4KW2A 1M7OA 3W1NA 1R3SA 1A5KC 1XCXA 5CZKA 2YFOA 3MUY1 1F3WA 3WLNA 2BY1A 2V68A 2OO0A 4JYDA 1WUFA 3GB6A 3BSGA 4UFHA 5I24A 1JRBA 3S9YA 2V6AA 1R85A 3IPWA 1GNXA 3VINA 3ELFA 2DT0A 3SR7A 4ACYA 2ACRA 1QAPA 4WF7A 1YDNA 4HNNA 3DFSA 5CJMA 4DWSA 1TG7A 1E6SM 4CU7A 3A9BA 3GHSA 2W61A 1E0WA 1Q85A 1P7TB 3AXMA 4LUSA 3B0XA 2A3LA 1IXQA 1QPQA 3VFCA 5LNUA 2C91A 2WJZA 5D2TA 1E0VA 1IGWA 5G2HA 1JFHA 3BW2A 2Z2UA 4R7JA 2DORA 1WQ5A 1GVFA 3SQLA 1B3XA 1NWRA 4UTUA 3LTPA 3E1F1 3LQGA 5C8BB 2Q3OA 1FWHC 2XIIA 3CZGA 1I60A 4TX8A 3ARTA 1A50A 1TPDA 2XIMA 3VCCA 1UKTA 2D73A 4JTDA 2ZRXA 4AZCB 1OWQA 4JY9A 1KQYA 1CECA 1G0CA 4JHMA 1A80A 4FALA 1US0A 3E3HA 2FJUB 4HA3A 3TQKA 3CNYA 4ZOCA 8A3HA 3EEGA 2A7PA 2Z2AA 3KOYA 4O8RA 3SBFA 5DRCA 1AG1O 1OK6A 2AL1A 5HPCA 4XAGA 3GAYA 1F4HA 4UMCA 4AIEA 2QDEA 2IPWA 4XG1A 1B5TA 1U33A 2Y61A 3TFXA 4IT1A 4IUOA 3L9CA 4MAVA 2H6RA 3W7RA 3O7UA 3G24A 3WQDA 3N2MA 2OGJA 3TJIA 1LM1A 2OYLA 2X7VA 3MI6A 3QC0A 1XLAA 3MKKA 2GYIA 4MAZA 5HMSA 3GNRA 1CGTA 5FJPA 4REQB 3F5KA 3E2QA 4BK9A 2P3ZA 2VCCA 3FGCB 2WV8A 2X16A 2BOFX 1V0MA 1TV2A 1XUUA 3ZR5A 4UTFA 1RA0A 1PV8A 4HTYA 4M24A 1EQPA 3NQ6A 3QPYA 4DZ5A 2OQYA 1DYSA 1X97A 4OVXA 2GJXB 5I3JA 1JL8A 1Q8JA 3DBNA 4ILSA 2E67A 4XZNX 2WZMA 4DJDD 1E73M 5LXEA 5CG0A 4IX0A 2PP3A 2YCLB 3IAPA 4GYPA 4HPHA 4JNYA 1KM1A 2G3NA 2INZA 4FOJA 2AQOA 4J9JA 4GIEA 2IPGA 4B5UA 3ITLA 3XINA 5K9CA 3LB0A 2WVSA 1DJGA 2BXYA 3GDLA 2DH2A 1UD6A 2XGZA 1W32A 3GU1A 4J3XA 1UBSA 5DEZA 4TTGA 4XBJA 1US3A 2R8WA 1KRBC 6CGTA 3K1DA 2RJHA 2XJ7A 4QIUA 3WLLA 3ITYA 3I65A 3MSYA 3O06A 1LRNA 3R25A 1T5AA 3OBKA 2E22A 4AW7A 2W92A 5F2IA 4DUVA 4JKLA 3C2RA 4CD5A 4XB3A 3UGRA 5CC3A 4TIMA 3GTNA 4QS6A 2DSWA 4ONVA 3W22A 5AOUA 2FFIA 2VO5A 4I6KA 5AYBA 3CPGA 3SCVA 1YDYA 1SZGA 1YDVA 4TV5A 4J27A 3I3BA 2WVVB 3UG3A 2WKGA 4ZEPA 4DVOA 1AH3A 3M41A 1MEHA 3E49A 3NQ8A 1XYAA 5LSMA 4A6GA 4I7UA 3MWAA 3IUIA 4WR3A 2FHFA 2VRJA 4DF0A 3GNDA 1RD5A 4RPQA 8XIMA 1ADOA 3GVQA 3OBAA 2AKMA 2E28A 1GOQA 3AHVA 3DHDA 1KNWA 2WDAA 2ZRZA 2J7CA 3M0MA 3BLOA 3W87A 5AN7A 3L4ZA 4DUOA 3NQ2A 2J24A 5TBOA 1P48A 2NXIA 3EPMA 2E4TA 1OCQA 3IJ9A 2F2KA 4K1WA 2ZRVA 1BVZA 3R2GA 1EP1A 2YB1A 1LXMA 1XCFA 3BPWA 3B4UA 3CUZA 1VFOA 4R85A 1IE7C 4LPCA 1ISVA 1KTCA 2TSYA 5GJMA 4L6OA 3HPSA 1Q6GA 4A21A 4GY1A 2PLJA 3BLIA 4GQRA 1OSEA 5CPSA 4B5XA 3U8GA 5DN1A 1PX8A 1YMYA 1Q4WA 1Y5WA 3BMWA 3L7RA 1XBZA 4W89A 3LCXA 3LPGA 3L0GA 1OM0A 3LHUA 2W4XA 2PP1A 3UR7A 3WK1A 3F7JA 4TR9A 1E0TA 5EPDA 1POKA 1HMWA 5CJ5A 4PH6A 3DN5A 3G8EA 1AUSL 1OJXA 1TV5A 4DO7A 2OPJA 1N8WA 4GKTA 3UESA 4XK2A 4OBRA 4PTXA 3DESA 4R7WA 4ZB2A 3LEPA 1Q63A 2VZSA 4B3KA 2FMOA 3ZR4A 2BX7A 3U5YA 1EXBA 3AIRA 3LI0A 3JZEA 1DJYA 1SO5A 3EX4A 3GX9A 4W9TA 3VIFA 2XZ9A 4E2DA 3RPDA 3U6WA 1ZHAA 2BLEA 5I23A 5EMJA 5K2ZA 1A47A 2DDXA 4QBXA 4DZAA 2CFFA 3Q4DA 3QY6A 2CLHA 1XQLA 1XYZA 1JCXA 5HWMA 3HO8A 3EA1A 3MUCA 5AECA 3UZYA 2INEA 3BARA 1XR2A 4H2CA 3NZ1A 1H09A 3H23A 3ECQA 2A85A 1O12A 3S1XA 3V0SA 1KM2A 3AMGA 1V3HA 3WD0A 3VPLA 1GKPA 4IP4A 4NJJA 5FJRA 5DFAA 1QWGA 5JU6A 2X1TA 1JPMA 4GGHA 1B57A 3S6DA 3B0UX 4UTWA 3B06A 2XM2A 5I3FA 2QIWA 4QSHA 2Q6ZA 1A3WA 2R94A 1OC6A 3DZ1A 2VRQA 1K9FA 4HGXA 3VM7A 4FNSA 4TXEA 1LQ2A 3V0UA 5CCZA 3CL8A 1XYLA 5CC7A 3TTQA 1ZP3A 3NPXA 3C2VA 5GQBA 2NV2A 4S2CA 4DLFA 4OU1A 3KX6A 3WMBA 1UWIA 2PU0A 4GI6A 5HAOA 3ATZA 4AY8A 1WDPA 2Z29A 4YS1A 9RUBA 1HF6A 1X6UA 2F6KA 3S42A 4JAWA 3CYVA 3H4GA 1XLCA 3L12A 3NO3A 2QCEA 1ODZA 3W2UA 1W37A 2QMJA 3ES8A 4FF5A 1E70M 4JFSA 1NJJA 3LLXA 3SAZA 3WF1A 3V3WA 1SW0A 3M64A 3GC4A 1CB7B 4HTBA 5LHFA 3G6LA 2YBVA 1E6PA 3CAVA 3TZNA 4CUCA 3AMKA 3DC0A 4ZL1A 2E1DA 2ZRWA 2E7FA 1MUMA 1XS2A 3WF4A 4MPQA 5K4XA 1H5VA 2F7FA 3W00A 3LGEA 1JJKA 2CZDA 3AXIA 3W28A 4BQ3A 1OB0A 2H3DA 4O52A 4W86A 1RA5A 1RJRA 3GYCA 3ABOA 1RY0A 3V35A 1J2WA 3JU2A 5EMLA 3W0KA 4PR4A 4BWLC 2QYGA 3V5OA 1BWVA 3ZJKA 1SJBA 1IYXA 2Z7GA 1E43A 2R1MA 1IGSA 3VOFA 3FFSA 4NU7A 2FTYA 2I14A 4OJYA 3FCPA 1O5KA 4A8RA 3PPFA 4EX4A 2ZTJA 4QE4A 1DIOA 4WRHA 1XFCA 1V3JA 3G18A 2FKPA 3QHNA 2WLYA 3C2YA 3EDFA 2PTYA 1YHTA 4GUGA 2CWXA 3RLVA 2WBGA 4A2SA 1LQ0A 4JTKA 3T6CA 1IV8A 4K1GA 1X8CA 1IZKA 1VJSA 3W7EA 2NXGA 4HK7A 3NQAA 2J62A 1H63A 3NZQA 1B3YA 4AB4A 1J0YA 3G1RA 3Q58A 4P61A 4FNPA 7REQB 1IIGA 3VM5A 4YU1A 5BXPA 3WDIA 4RE0A 2V69A 3W27A 1KM5A 1O0SA 5GPRA 1RWAA 1CGVA 4PA8A 3KZSA 2HS8A 1EDGA 1IT7A 3P80A 2O9OA 4POCA 1MXSA 1GKRA 7ENLA 2V3EA 4JDYA 4PEEA 3TE9A 4Z0SA 2GVLA 2WCOA 1F07A 4FXFA 3PF3A 4O0QA 1JNEA 2YOCA 1JGMA 3BE7A 3G1SA 3O3RA 1GOOA 1FWRA 3EGJA 4MFDA 1Q6CA 3LA4A 4AH7A 1VBUA 1L6WA 1RJQA 3VX1A 5IBXC 4FLSA 4LU0A 4ATLA 3O15A 4JQ2A 1JPKA 1NDZA 2TPSA 4C5ZA 5D2WA 1V6WA 1NEYA 2J7EA 4EPKA 2PAJA 1RBLA 4UC5A 3GC2A 2YEPB 3UCCA 1YE6A 1NQ6A 3L2LA 3DIPA 3GIYA 4V1XA 1C8XA 1WDRA 5KINA 3QN3A 1QNSA 3RIKA 3NJ3A 3F59A 2NV9A 4N6FA 5A6BD 4K2SA 3VDCA 2QGYA 3MCMA 4HA4A 5ABTA 4K38A 3AS1A 3TR2A 1ZS2A 3HGJA 2QJJA 4D1IA 3RPMA 1V79A 4MYAA 3L2MA 3BGJA 3O6YX 3M07A 4H9MA 4YHEA 2BGNE 1NOWA 4HJFA 1QNRA 5CSRA 4EANA 1SSGA 1VHCA 3CMGA 4UFLA 2Z4GA 1FTXA 1IEQA 4JQ1A 3GQYA 4DXKA 1Y5XA 1C9WA 2WLZA 3PK7A 4J40A 1VFSA 3LTYA 4XUYA 1TIWA 3W7GA 2ZUSA 3WQPA 2VKZG 2GVYA 1ODUA 2VFHA 4GACA 2BGQA 2BZNA 3OHMB 3QOKA 4XAZA 1YPXA 1M3UA 3GBEA 2POTA 1TA3B 4FA3A 5BXTA 1B90A 1LWHA 3NL5A 1Z41A 3M16A 3N3TA 3RXZA 1HL2A 2XG9A 4DJEA 2GJLA 1XGEA 1OJPA 3NQGA 1L2UA 2FDSA 1F3EA 4Q4QA 2CZEA 3G5EA 1OFQA 2FTPA 2IQ0A 2P76A 7CGTA 5A6JA 5I6SA 3CPUA 3K30A 2D3NA 3U4FA 4N42A 3SW6A 3VK5A 3W82A 1T8QA 3B8VA 1UWQA 3SJ3A 3VNYA 1AA1B 1ZPTA 1BVNP 5E1QA 4NIRA 2WZEA 2PWGA 4L80A 3P61A 3G2GA 2X05A 3B8WA 3VD5A 4IIBA 4D71A 4RZBA 4WEVX 2KZHA 5A6AA 3K8KA 2PDBA 3PB2A 3RX3A 1FWWA 4IGNA 4GA8A 4RCXA 4XVDA 3KL3A 3QGAC 2VEMA 1OC5A 1GUVA 2CXEA 4C6BA 3ZIZA 3E0IA 1ZNNA 3FIGA 3UG4A 1NTHA 4I6VA 3T8LA 2YB4A 3N04A 1TJPA 4HCHA 2R6OA 3MB9A 4GJ1A 4YMZA 2PMQA 3FOKA 3QY7A 1DQUA 4IPPA 3DGRA 2PCEA 4OOZA 4MB4A 4O1BA 2G3IA 2RDTA 4Z2IA 1DIKA 3G6MA 4B16A 4C6FA 1V8EA 1PWLA 4ZQPA 3VI2A 4M6QA 3PY2A 3WIJA 4O57A 3A12A 4K8EA 3NQBA 1B2YA 2I5GA 2XVKA 3DUGA 3VYLA 3FXGA 1KLZA 1VFLA 5D04C 1BF6A 5F2GA 4HJWA 1R3TA 5CGQA 2TMDA 2VEKA 1TV3A 1VS1A 3P0XA 1WZAA 2CZFA 1OHLA 5HDRA 3CZKA 2C18A 2VC6A 1EP2A 1EQCA 1QK2A 4IWWA 2GSEA 1K1DA 1UCWA 3KBNA 1EUAA 2QUVA 4IQEA 1PE1A 2POZA 4BCEA 5DMYA 3E0WA 1BRLA 3SQSA 2V3DA 1CGWA 1V3IA 4XWUA 1UPPA 2IW0A 1VRDA 3WLSA 4H9UA 1Q8AA 1U2YA 4GUFA 4ATWA 2ZZ5A 3OGVA 4KRTA 4E4UA 1N8IA 4O1DA 1J0IA 3CHDA 3TMLA 4AD5A 4KEVA 1ONWA 3TMQA 5ECUA 1E9IA 1UZ4A 4H7CA 4NI3A 1FWAC 4QXIA 1R3YA 3A24A 1UKPA 2CERA 4X63A 1W0MA 2J7DA 5C71A 4XV0A 2YBTA 3GZ3A 4OV4A 3CZJA 2XM1A 1DQXA 1EOMA 5BMXA 3WYZA 5E0CA 3GUWA 2PGEA 4AAJA 4LV9A 1J0MA 2FPVA 5C2XA 1G4PA 3RILA 1AH4A 4QRNA 5AC5A 2QDGA 4PUKA 3STGA 3LRKA 4LRSA 1ELSA 1XIEA 2ACQA 2VDGA 3WN6A 2NX3A 4LX4A 1V6UA 4IMAA 3AOFA 1XFBA 5H8PA 2V5KA 3W7QA 4O50A 1EWDA 2CWNA 1GG1A 2WZTA 1LUCB 1LG2A 2FZMA 2ATMA 4F9DA 1F2JA 1BQCA 3EOUA 1TVLA 3MKCA 3VKJA 1P5BA 3VD7A 1VAHA 1VP5A 1CBGA 4IQDA 2Y62A 4WGXA 3AS0A 3Q37A 1W5MA 1WXZA 1TRIA 4IISA 1RWGA 4DJFC 4HOWA 3S2MA 2EJ1A 3SN0A 2CKSA 1RVKA 3WH8A 1PX4A 5BMWA 2E5DA 3AZSA 1CNVA 4B9YA 1ZRQA 3PBYA 3V75A 2P53A 1OIMA 1I8JA 2E5CA 4Y7EA 4QG8A 3VKBA 3FAXA 1HP5A 3PC0A 4EWND 2XIJA 4NG3A 3OVPA 2OZ0A 1XW8A 5FESA 1B3OA 1WKFA 4KFNA 1I9CB 4DBDA 3CTTA 3MUZ1 5FAGA 4R9XA 1FVPA 3LM7A 3IJLA 4P8XA 1XI3A 4AD3A 1FDYA 1VEOA 3FS2A 5DXXA 3S5ZA 2UY2A 2DZTA 3W07A 3PP7A 4C6QA 2CEQA 1J8VA 3T78A 1TPFA 4QDMA 3MANA 4KWVA 5H8UA 3RRAA 4U28A 3GWQA 1K7FA 2OOGA 1XLDA 2ZC8A 3T42A 1A5NC 3RU8X 4HVXA 5HMDA 4GQQA 4KEUA 2GSHA 3SECA 3DKLA 4GY7A 3UXLA 1V5XA 3W7IA 1BQGA 2UBPC 4FNTA 3AU6A 5C9ZA 5M2FX 3VGFA 2KX9A 5I77A 3NURA 4WY0F 1JZ2A 3N34A 1IXNA 3EKLA 1FOBA 4ZQRA 5CSUA 4CD6A 1CXLA 2CBVA 1TJRA 4GZIA 4HOXA 3KVJA 4F48A 1BYDA 3HG5A 5HJLA 4L1WA 1TJ2A 4ADUA 1QW8A 1P7TA 1MW1A 3PZTA 1A4MA 5G5IA 1SZEA 1V6VA 1QU4A 4LYRA 3C3NA 2VTFA 3HPAA 4LH8A 5CPQA 5I3GA 3EOSA 4O53A 4DZIA 4PRTA 1QI3A 2IKHA 2Y8VA 3I6TA 3BQ6A 2EPNA 1P0DA 2VX4A 5C9WA 1V0NA 1RSCA 2J66A 4PMJA 3TTEA 3E96A 2OYMA 4O54A 1S2TA 4DRSA 4G56A 2Y7DA 3ZVHB 3R4IA 3K2GA 2J8FA 1KFJA 4MDPA 2A0NA 4WDTA 5BRPA 3STPA 1W9XA 4AZCA 3QVQA 3JS3A 3HN3A 1N7NA 1K7XA 1ITCA 5HQLA 1XH0A 4HNCA 1XYBA 3WBWA 4GCXA 6XIMA 1AD4A 3DFHA 4QQ3A 2EPHA 1TPH1 4YVPA 4LBRA 2RFGA 2VR5A 1SUXA 3HPFA 2ZYFA 1PPIA 1UP0A 1VJIA 3ZM8A 3UW6A 1TWIA 2ZXBA 3QRHA 2V30A 4Q3MA 3TYZA 4F0HA 4QEEA 3EKGA 4JIQA 1RZMA 5JIPA 4CQ9A 3T4WA 3M6DA 1XDJA 1J79A 1W8SA 4DJDA 4UTTA 4J35A 5C9UA 1EZWA 1EYWA 4QGCA 3EXRA 3TV8A 1UB3A 4C6IA 4PUNA 6XIAA 3MHFA 2IKIA 3BAKA 3QYSA 4REQA 4TMCA 1CENA 1VEMA 4PMUA 4BFAA 2OG9A 1RQBA 1UHVA 4IHCA 4MJ4A 5HJYA 3OIXA 2QVNA 4J2PA 4NHVA 2QV4A 3W75A 1E4MM 3INPA 2GJXA 4WLCA 5TD4A 4ZQCA 3VGDA 1DJQA 2BRWA 3MMUA 2YCEA 4H8HA 4NAEB 4PSRA 3PFMA 4ML9A 1E4IA 2C1GA 5DLCA 1MW0A 2X03A 3GVVA 3O0KA 5CPMA 2J78A 3UZXA 3VC5A 1H1YA 2WQDA 3M1ZA 2Q01A 1I2OA 1H1NA 5FKYA 1QI0A 3B8DA 4US5D 2AMXA 3HPZA 4LEFA 1M6JA 1ZCCA 2NQLA 2MUCA 5FEXA 1TZ7A 4PUJA 1EO5A 3W2NA 3LGDA 4WY0A 2VEGA 3P82A 4W7UA 4LAKA 5F7UA 3EWUA 4KFPA 2PI6A 1D7FA 1V7YA 4M0XA 4M7TA 3NVDA 3GTXA 1MEIA 4ENLA 4WGHA 1V02A 3T2OA 3BC9A 3SB0A 4YYCA 4Z2KA 4JN7A 3STCA 3NPWA 1OGGA 2DT3A 1D3GA 3CYJA 2OYKA 1JDDA 2OZ8A 2ASHA 3AHXA 3UY8A 4B15A 2ONEA 3VMOA 3CH9A 4BQ5A 4ORIA 3KL5A 3W73A 3RM9A 4MYXA 3BZGA 5C54A 2IPJA 1W2PA 5IFTA 5J5RA 2X1IA 1OX6A 3LS9A 4J7RA 1KV5A 3KM8A 2WVVA 4AZHA 4RZ4A 3O07A 4PMXA 1E1CB 3W7OA 2IKJA 1MUWA 4YL2A 4D2JA 2RHGA 4N7QA 2PWHA 3E0FA 3FHAA 4RLIA 1HZYA 1HJUA 1D7KA 2PLKA 1D8CA 1H41A 3L5AA 1VFMA 3MSRA 1XLJA 3QQ1A 3BAXA 4Z08A 2ATSA 5B80A 2BOGX 3FVMA 4AVFA 3LU2A 5EFFA 1GJUA 3TFCA 5TQLA 4NKCA 1F5ZA 4JX6A 5CBIA 1BXNA 1C90A 1RV8A 2CBJA 3VABA 2PURA 2VZKB 2I9UA 3GC5A 4TMBA 2LLEA 3VU2A 2E8YA 4UNLA 4ZFCA 4BQ2A 1EPVA 2R24A 3H6OA 5LIYX 3PAJA 1RXOB 3KZPA 3O0FA 3MUXA 4XD5A 3P93A 3L21A 4DBWA 2J74A 5LIUX 2X0HA 1R8LA 2PEVA 1B30A 1XPGA 3K5XA 3W7DA 5AC7A 5DELA 4AZ7A 3W1TA 3LNMA 4OT7A 3E2SA 1UUMA 3UU0A 1BTMA 3FJ6A 1RP8A 5KETA 4QP0A 2VRKA 1HJVA 1K8CA 4PMQA 2VDIA 3BDKA 4AIUA 5E6ZA 1WO2A 1H7XA 1MZHA 4UUIA 1M04A 2DT1A 2J9ZA 2C13A 1AL7A 1FHDA 1YADA 1TUXA 1W9BM 2RDWA 4GH3A 5FCZA 3H70A 3HM7A 3HV9A 5BOEA 3EX2A 1VYSX 1V6YA 4L4LA 2FTWA 4CVUA 4M19A 4RUBA 3BSMA 4JKMA 4O19A 3WLQA 1EGMA 3UPWA 1QRQA 3SN1A 4HNVA 3H54A 2QHAA 3AICA 1AH0A 3HFTA 3ICJA 4X61A 1CI1A 5E9XA 1PX3A 3TNBA 2VP8A 1R6WA 3LOTA 4K7YA 5H91A 5M1TA 1M03A 3BCFA 4QG9A 3WMCA 1JCTA 1QOPA 4N9DA 1DOSA 1VZWA 1W9PA 4PL1A 1EEPA 1RK5A 1HGYA 2BXZA 4M56A 1BG4A 1JIBA 3CUFA 3OGRA 3E02A 1GPFA 2NUXA 1GQLA 4DLMA 5AHIA 1A5OC 3RO6A 4UNKA 5B7ZA 3SGUA 3FK4A 1GVOA 3KVKA 1TTJA 2ZX9A 1GK8A 1DJNA 1DBTA 2CHRA 1FBAA 2AL2B 3CHVA 5HNNA 3AIBA 3A23A 2PE4A 2YYTA 5CPLA 5I06A 1QI2A 3WD4A 1ZL1A 1E9LA 1W3YA 1GVQA 3NWRA 3F2DA 1W5OA 1U83A 1H51A 4A4AA 1US2A 1C8QA 2ADAA 2YLAA 4GZ7A 1GQIA 4W8LA 1O7AA 4L1XA 2O9RA 2OQHA 3IVTA 4RV8A 3VKCA 3NSMA 1LOQA 4WDXA 4CU6A 1WDQA 4O28A 2YEPF 5AVHA 4U3CA 1XLMA 1QTWA 4IFKB 3E2RA 5C5YA 4GIRA 3UWVA 4NZ3A 2OEJA 3MMTA 2WMJA 3QPEA 3MMWA 3NIYA 4J1OA 3G1AA 4U3AA 1EYEA 2F8QA 4B3LA 3WLJA 5HA7A 3IARA 1OD8A 4XQ6A 3MV01 3SDOA 2VL4A 2QUNA 3BVJA 3CUGA 4U33A 3HV8A 1KC7A 4NNBA 3CM4A 1T40A 4DWSB 3C2EA 3C2FA 2WMKA 1V0KA 2D1ZA 3NSXA 4DJFD 3A3WA 3UA4A 3LMZA 4LUSB 3H22A 3MHUA 2WMFA 2V4IB 3VFLA 1CT5A 2PS2A 4IFRA 2WB5A 2J6XA 2X1UA 3OG2A 3BJSA 1MQQA 4M5PA 3W6YA 2DFAA 1JD9A 2Z26A 1J0JA 3GBDA 1S2WA 4KWOA 3KTSA 3P0WA 2QEZA 4EK7A 2A7NA 5D03A 1GOXA 2D0HA 3CWOX 3OZPA 2X0SA 4PUWA 2CLOA 3EB2A 5LGZA 4RW3A 3TONA 1PBGA 3MJMA 3F2BA 4EVZA 3L5MA 3OJGA 2RUSA 1BKHA 5G1TA 3RK8A 4RNJA 1MQPA 3AO0A 2INFA 1F76A 4LAOA 4NZFA 1ITUA 3AIUA 1S38A 3LV6A 5CZTA 3O63A 4RJEA 3QH2A 3SGGA 1WOBA 1JAKA 4O11A 3SADA 3PJUA 4XZMX 3G0UA 5K7JA 1YW1A 3A9IA 2W91A 3VE7A 1WDSA 2P3EA 5TF0A 3GFZA 3KRUA 2J8GA 1XD1A 3ZWTA 2I5IA 1DWHM 2P5NA 3T0BA 3FW6A 4UFIA 3DHFA 3I3EA 4NRSA 3TU9A 1NDVA 4HHMA 1OVDA 4PN2A 5JH1A 1TKKA 4W4QA 5DCBA 1GOMA 4LEQA 2C15A 5K9DA 3W1UA 4QDWA 4UOZA 1X96A 2VGIA 1GCYA 3WK2A 2MNRA 1OG0A 4UWMA 7TAAA 3A3HA 3F1QA 1T99A 1JXKA 3TYBA 4WVXA 3AAMA 3VKKA 5HBFA 1PXGA 4AC7C 3N4EA 4IGHA 3VDAA 3R6IA 3B0PA 2O9PA 3USZA 1XYMA 1TQXA 4C91A 3WLKX 4A05A 1TTPA 3N4AA 1DXEA 5JH2A 4PYSA 1XWYA 1FCVA 1FWJC 4B3ZA 3FY1A 3VD3A 3GU2A 4WOZA 2Z25A 3WJXA 4K68A 2NT1A 5FI8A 3NDYA 4XKYA 3S1VA 4ZQOA 1EJRC 4AZ5A 1BSLA 1EDTA 4H8UA 4IZGA 4V28A 3GW3A 4PTWA 5DMLA 3T9PA 2WNWA 3K4AA 4Q6XA 3W7HA 4O12A 3IGXA 1Q3NA 1W3TA 4AD4A 2IS7A 3EDKA 1XDLA 2VGGA 1LRTA 4S3AA 1MMFA 5I78A 4CCEA 5A8MA 1AD1A 3TYUA 4IG2B 3T09A 2VZOA 1MXGA 1OCJA 3EKZA 3AUOA 2CLFA 1OFRA 3SO7A 3CO4A 4MY1A 4YLWA 3T4CA 1HW6A 3DX5A 2HMCA 1RCXB 1W91A 4UTJA 3P62A 1R5YA 1XD0A 4L61A 3CEPA 2VFEA 3F03K 1JYNA 3GDMA 3TYAA 2OWXA 1UKSA 5TNVA 4A3YA 1TPWA 5T9BG 3E6EA 1UMLA 1GKQA 4LAUA 4YHGA 5BRBA 3G22A 4J4KA 2CLMA 2O55A 5DRIA 1TWDA 3V5FA 1M68A 3S3GA 2A4AA 3UCDA 3AZTA 1TWZA 4UZSA 4WSKA 2E9BA 2OODA 1A4LA 3LX9A 3LCHA 3M47A 1TA3A 3CHFA 1W1VA 4MOZA 2Q8ZA 3S1WA 1SO3A 2CLIA 1E51A 1ZCOA 2EAWA 5CAHA 1GYMA 4RE4A 1Z7AA 5D8ZA 2GDUA 3WKZA 5TIMA 5H8MA 4F4RA 1FUYA 4RK8A 2OSWA 3DCPA 3PPHA 4NJKA 4XVEA 3HB9A 3GXFA 1WP6A 5EGRA 5BYWA 2RKXA 2CLKA 4EAMA 5AKQA 3TEVA 1NDYA 3BW4A 3DFYA 3HG2A 3TXVA 1UWUA 1XRFA 1RLCL 1WZKA 1I2NA 3W53A 1XLKA 4GZEA 1WXYA 1DXFA 1JCYA 3LBCA 1H5YA 3EAUA 4G2DA 2VR4A 1QMLA 3ZVIA 4Z2HA 7TIMA 4HIBA 4NT0A 1ZGDA 4U2YA 1K9TA 2QCHA 3CQHA 3DFQA 5MKGA 4MF4A 3E12A 5A2AA 1W1B1 4RR4A 5D09A 4LANA 3HMJG 2CW6A 5C55A 4G9PA 1GW1A 4PMOA 3VGGA 1H7WA 2YL9A 1S5VA 4GE8A 4RDZA 3F4VA 1YNQA 3KRZA 2ZKMX 4XAFA 4GVFA 1AZ1A 4JQ3A 2ALDA 4X2PA 1EA0A 5BCAA 2Y6ZA 5FJTA 4IFOA 1E6NA 3D46A 1WA3A 1SMAA 1ICSA 3R0DA 4MKSA 3IJIA 4QS5A 2DIJA 3W26A 3V7PA 1KXQA 1Q6QA 1W1YA 2QF8A 2ZA2A 4Q8VA 2ZWZA 3P5YA 2Q71A 2E3ZA 3CMJA 5FAJA 3IGHX 2H8ZA 4B5WA 3T2PA 1Z8AA 1K02A 4KCUA 4C1LA 5DQPA 3S0CA 3QTPA 2GK1A 3M6YA 1B4EA 3MTWA 4NXKA 2QJGA 4J5NA 1DPMA 3N2BA 4C6CA 1XJBA 3LUTA 1UWTA 2RGLA 4UOJA 3VNKA 1W9VA 4ERGA 2REQB 4O14A 2CPUA 4L4MA 2W3ZA 3FX4A 3WQCA 1NDWA 1MSSA 5A6SA 1AK5A 1JQVA 5HNRA 2XFRA 1VF8A 3NVTA 1NELA 1JPHA 1FWEC 3PS7A 1FP8A 3APGA 3ANYA 3WH5A 1W1PA 2NSOA 2DY3A 3GU9A 4Z1YA 3NR0A 3R58A 4UTLA 4G7EA 3I7RA 4LWWA 3J7HA 3M0VA 2Z6IA 5BU6A 1H7NA 5A8OA 5AHFA 2PRHA 5BRQA 4Q4RA 3RRXA 5GNXA 4C60A 1N8FA 5REQB 3CAKA 1CXIA 1AQHA 4ZO8A 3NDOA 3WLOA 2P8CA 3M44A 1EIXA 4MPKA 1B9ZA 3GDTA 4NUWA 4AWSA 3MV11 2B31A 4R53A 1A0CA 1K7EA 3MA8A 1LUCA 4KGLA 4CN4A 3QQ0A 2EBNA 1K9DA 2EF9A 4ATDA 2BGSA 3MW7A 3V0TA 3A3XA 3BCJA 5FEWA 1XH1A 1EH9A 1M1BA 3VE9A 3TLLA 3UYCA 3F4CA 3ITOA 3WY1A 2BHZA 1O5XA 3MVIA 2GGIA 5FF4A 3GH4A 4O8AA 3CTLA 1I75A 4YWIA 3GHTA 3PFRA 3H21A 1XP3A 3PVFA 3EX1A 2FQIA 2WSPA 1UD8A 1LZOA 1EGZA 3I4EA 3SCQA 3AI0A 1EGUA 1NU5A 3KLKA 4B5SA 3HQ1A 4A8NA 3EOLA 3MSGA 3G1XA 3KOFA 2E40A 4F8XA 4DYEA 2WKLA 3LI1A 3DOPA 5K4ZA 3KP1A 3UWWA 3LXBA 5D2YA 4KIEA 3SRHA 3THUA 4HPJA 2BWGA 1HNYA 1GQKA 3TCSA 4PODA 2I9EA 3UCQA 1XICA 3PSWA 3A4JA 3OU8A 2WYSA 3TR9A 3LD5A 1EJUC 1HVQA 3GE7A 3T1GA 3PZQA 4GG9A 4Y9OA 3RCNA 3B9EA 2BVWA 2GVEA 2NT0A 3TIMA 1VYPX 1OYCA 2WSQA 1TFVA 2E6YA 3K1GA 4CNPA 4PBEA 3RHGA 4MWAC 2WHKA 1EF3A 4HSNA 1YNYA 3QZ6A 4NF7A 1I1XA 3N9SA 3QR0A 5A6TC 5PTDA 2VEPA 4DB7A 2R1LA 1V0LA 2H90A 3RG6A 1A5MC 5I3IA 1GOKA 2E24A 5DY3A 4WKHA 3TW7A 4JBRA 1K9EA 1SMDA 4WSHA 3RJYA 3MVTA 3PZOA 3H7UA 5E5CA 3IIOA 4RXFA 1LL4A 1EDQA 3B9OA 3GDRA 1LWIA 4MZ1A 1DP0A 2JKPA 4QISA 5LIWX 2D0FA 2J6VA 1WDWA 3KLLA 1F3XA 3KBUC 1MDRA 1YXCA 2ISDA 3KEHA 2JE8A 1A3HA 5BZAA 2ZE3A 5A94A 3TJ4A 3A13A 1J0NA 1A5LC 1FWDC 1I8QA 5EMMA 3W01A 1AMKA 2DVUA 3OLIA 3HBLA 2DZVA 3GNNA 4QCEA 2J9YA 2XFWA 3N4FA 1TCMA 2ZUWA 1MWOA 4GYPC 4D9PA 2VOTA 2XH7A 2W27A 2GUBA 5F1VA 1DVJA 3TP4A 3WENA 3UVIA 1H1ZA 3EDEA 3WBXA 4RNFA 4YXGA 1B9BA 4OHQA 3MCOA 1G7VA 2GJPA 3WDRA 3W85A 4FLRA 1UWSA 1AMYA 2ZZ6A 1KGWA 2ZZ7A 2VT0A 3TYCA 4ACZB 4RKAA 4S3KA 4UR8A 2E9MA 3R8HA 4AC1X 4AY1A 4C65A 1LBLA 4DXXA 3SUSA 4IIHA 1VPXA 2YL8A 4O10A 1FWGC 3UBPC 1PKNA 1ZAJA 2RJGA 4LVGA 1MNSA 4Q33A 1RWHA 4C1KA 3VIPA 4AD0A 1RWCA 2V82A 4PFHA 1GWJA 4AD2A 5AYZA 3KCLA 1XLFA 3ABQA 2PODA 4GYJA 1IIHA 4LVDA 7A3HA 1SJDA 2UY3A 3S9IA 2CC0A 3POHA 4YTUA 5E0FA 1OK4A 3T05A 3HGSA 3IUDA 2GPTA 3H2OA 3BSHA 2E09A 1SFSA 3P7YA 4AHQA 5HWNA 5U4NA 4A2RA 1OQFA 2YZRA 5I07A 3BLKA 1RLDA 1OX5A 1RCQA 1L8PA 3KS5A 1IWPA 3RLGA 2OCZA 2CNCA 4JTRA 4J3SA 3NEVA 1XG3A 4Q6JA 4LQ1A 1WBHA 1JR1A 2ZZ4A 3HQPA 1W3IA 1IR2A 3TK7A 3LCGA 2BODX 3RX4A 3EWYA 2XN1A 4DY1A 2XSXA 1YDOA 1P4CA 3MP4A 4XZBA 4NYYA 3E0LA 1FH7A 3GTFA 1OF6A 4MUZA 1XRSA 4IICA 4UQEA 3AISA 3BUVA 4MJMA 4B2DD 4YTTA 1S3TC 3AMCA 4DBEA 3FSUA 1DWGM 3IVSA 1F8MA 1NM9A 1NQKA 3EWDA 1UOKA 3VCNA 3WQGA 5DCDA 1LJYA 3KOWA 1PHQA 2IQTA 3SRKA 6ENLA 1W1ZA 1SR0A 4PB3A 4P7RA 5CBBA 3N14A 5BOOA 5DMNA 1KCZA 1UR3M 2PRLA 2A7RA 3ZJ6A 4JPGA 1UJPA 1UQYA 3EMZA 2PDYA 2P0IA 1R2SA 1UBPC 4JXCA 1KWGA 1MRAA 2OSYA 2C7FA 4W85A 1JZ3A 3UD1A 1VBGA 3NFUA 4L4PA 1XINA 4MG4A 4KEZA 4JCLA 3WNMA 3ZLGA 3E38A 1CIUA 4R34A 4H3DA 3MT1A 3E5BA 6TAAA 4I9JA 1H0IA 1UW9A 4NP7A 3VDHA 4BI5A 1W3JA 3ZOAA 3RCMA 1XUZA 3KBMA 2OMAA 4GCAA 1QPOA 2ESCA 3MKVA 4K3ZA 2V5JA 3O6AA 1J0HA 2WVUA 4LJ3A 1A3XA 3TN3A 3JZUA 3USBA 4JYEA 3WLMA 3DFTA 3RFAA 1BYBA 5FJUA 4RW5A 2XGBA 1OFAA 1LTDA 4GYKA 3QV8A 4QHRA 3HU7A 3BAWA 4LOCA 5EBAA 1N82A 4WOQA 1XH2A 4NZCA 5A6MA 4QLLA 1T0OA 1IXOA 3E2VA 1X1IA 1VB9A 3V16A 4S3JA 1NIUA 3MI2A 3GKFA 1FH8A 3BMVA 4B92A 1DKWA 4CNSA 1ZJBA 4H2HA 4UBPC 2D2HA 1OT1A 2BMBA 5IHSA 2V5DA 3OLEA 1BKSA 2YKKA 3VUPA 1ME9A 1TMQA 2BRVX 3P6LA 3DHPA 4DN1A 2PDCA 1XLGA 1RQEA 4ZO6A 3WL0A 4EAYA 4LC6A 3EWBX 4M82A 3RLUA 4FI4A 3WQVA 3AYSA 4MKVA 4DWDA 4CNTA 3WH6A 1TPB1 3I7SA 4YTSA 2WAGA 1YBQB 1R46A 4IPLA 1FRBA 2ZFAA 2XINA 4EIVA 3O05A 3RJXA 2PDPA 1VIZA 1WV2A 4KIRA 4XUGA 2XFYA 2PDKA 2YW3A 4HCDA 2O4QA 2HVNA 4AVNA 1R0MA 3R94A 1NP2A 4JIHA 1MO0A 5EKYA 2WWDA 4PCPA 4QJ4B 1SVDA 4R27A 3OGSA 4G1NA 1BXCA 4IM4A 3C5QA 2CXGA 4H00A 2FFCA 4PUEA 2V81A 4JS3A 4F9JA 4C7FA 5FSEC 3F5LA 3EB3A 1R38A 3BMXA 1J6OA 1UR1A 3H4WA 3Q67A 1EUNA 2ZCGA 3CZ8A 2O56A 4M6PA 2YXOA 6REQA 3VOHA 1SSDA 3T07A 3VC6A 5I7GA 1KM3A 2CU0A 2Y7EA 5AC4A 3T81A 1W1IE 1E0XA 2FLIA 2VFGA 3PNZA 3UZ5A 1OYAA 5M03A 4KKXA 4D6JA 2HK0A 1N7PA 2EEXA 1TZ9A 3GM8A 2D2OA 3M46A 3S5OA 4DHGA 4ZZ9A 2YPIA 1U30A 2AL2A 1N55A 2ZOXA 2PP0A 1ONRA 1F61A 3TQPA 1CWYA 5CG7A 4D8ZA 4AZBA 1EWEA 1ZJHA 2C8NA 3AXKA 4IJBA 3G0XA 3TYEA 2DPEA 1CCWB 4NNAA 3GDKA 2I16A 5FEPA 1OC7A 3PNUA 2QNEA 1B3VA 4BJHA 3IIVA 7ODCA 1JZ6A 2GQ9A 3PAOA 5JXQA 5J8LA 3A5FA 1QK0A 4JFVA 2GJNA 4I3GA 3WJYA 3K4WA 3UZWA 4IFKA 1DIDA 2V38A 2NXHA 2WQPA 3B0VC 2Y7GA 3CU2A 1DHKA 3U2EA 5CC5A 4LY4A 3L4XA 4CQCA 1KCXA 4V15A 3LCLA 4Z0JA 1Q66A 3I4KA 1HIZA 4BQ4A 4S3BA 4L65A 2WMIB 1L6YA 1B0IA 1Q65A 3AJ7A 1GYNA 1PYFA 2VQTA 2DV0A 4KRZA 3SZ8A 3SUWA 1AODA 3C86A 3QKZA 1NFGA 2WJEA 4PBFA 3TROA 3GVGA 2GQ3A 1L6GA 1F8IA 3BICA 1JAEA 3SY5A 3GSMA 4P8UA 1QT1A 4C6LA 2NQZA 3CHEA 3B8UA 4IXHA 5G1YA 1JYVA 2P50A 4K39A 4B90A 4IIFA 1B1YA 3SY8A 3EPOA 5FD0A 4M81A 1QCWA 1UH3A 1LP6A 2EPOA 2ZZ3A 3L66A 3OO2A 2NQJA 1XSIA 3FSTA 1HGWA 3L5LA 2BG5A 4PMZA 4LB4A 2DVTA 2PLMA 1FDZA 4QITA 1NWSA 4TQTA 2HS6A 2CCRA 4PSPA 3KBVA 4AMCA 1ISZA 4NZ4A 5D9NA 1OCNA 3M0ZA 4ICNA 4HSHA 3UXDA 3IJ7A 3DC8A 4LCQA 1P6CA 4UCGA 1XCWA 4MWAD 3PM6A 5I79A 3TQVA 5BW6A 1EFZA 4XZHA 1QPKA 3N6JA 1DJZA 4MB5A 4C1NB 1HKJA 3A6OA 1ADSA 2JFEX 3N18A 2JIEA 5CLTA 5ABEA 5CZJA 1YTDA 4OBTA 3W2KA 3OVGA 3CQKA 2W66A 4OWGA 1PJ9A 2D0GA 4H8VA 3CL7A 3M9YA 3I10A 3WLRA 2EXOA 3HTWA 2B0MA 4UZUA 3UJ2A 1IEVA 1OFPA 3HJEA 1O4UA 4DLOA 2B7PA 4G8TA 4NXSA 3QMRA 4ZENA 4CQ8A 3WSUA 1AW5A 3S6OA 1XPYA 4GISA 4ES4A 3WUEA 4JTUA 4DJEC 1U5HA 4C6MA 1Q6FA 4DAIA 4WXZA 2DZSA 3S5NA 4LALA 3QQWA 3RITA 1QI4A 3R0KA 3THAA 1CXHA 2V2CA 4UOQA 2Z1KA 3TNOA 4JIIX 4GBDA 1NAL1 3DHUA 3BO9A 4MIMA 2DW6A 4X60A 3HFYA 4GMEA 2YCIX 4DBSA 3GTIA 2X8RA 4A3RA 3BOXA 3TOPA 3VMPA 1RK6A 1Q6DA