4D6JA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 2 blood group a-tetrasaccharide (e558a x01 mutant)
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
586
structure length
586
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTASYWIWANDIENKAADYLKVSAKNGGYFIWAEQNVGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 215
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6jA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6jA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6jA02
4AZ5A 1HMWA 1V3MA 3G6LA 4V27A 1H41A 2W5FA 5BXSA 1UA3A 1WZKA 3DHPA 4ATWA 2IXUA 4D6FA 4M81A 4DWSD 4UFIA 4EAMA 2XSBA 3RM8A 3GYCA 4TUFA 2YL9A 3PZUA 5BYWA 2EJ1A 4MB5A 1GHSA 3LMYA 1E6XM 3VOCA 1W3HA 2VL4A 1WAWA 1G94A 4M29A 4K68A 4WSKA 3VD3A 3VUPA 1UD8A 2WHMA 3T2PA 2XPKA 2WMJA 3PTKA 1RWFA 2CYGA 3W29A 3JUGA 4GPNA 4FMVA 2BHYA 2QMKA 3GH7A 1WZMA 3EYPA 5FCZA 3GM8A 2D23A 4HOZA 2J7EA 3U5YA 3EDEA 3SEPA 2OWWA 3VKKA 2XWEA 2VC9A 1GOKA 1L8NA 4GZIA 1UWTA 3N15A 5C70A 4RE4A 5HXMA 4MJ2A 1E6RA 4JFSA 3UG3A 4J3SA 1N7PA 3IJ9A 4PBGA 3MU7A 2AOSA 4AISA 3AFBA 5E70A 1CTNA 2XVNA 1X1HA 1PAMA 5DF0A 1KGXA 1KR0A 2XHYA 5DO8A 5DMYA 2OSYA 4LYRA 1E1FA 2GDVA 2PC8A 1J0YA 1VEOA 4UFJA 3F5JA 3WUFA 1U2YA 2E8ZA 2W4XA 3WFLA 2OWXA 2ZUTA 1KWKA 4Z2HA 1JNDA 2ZUMA 4UQEA 5EFFA 3MKKA 4WF7A 2BXZA 2V5CA 3VU2A 5A8QA 3EDDA 5ABFA 1V3IA 4B9YA 1UD4A 3RO8A 2FGLA 1BTCA 3VNYA 2JEQA 5D9OA 4UZUA 2BVYA 3BGAA 4P7RA 2W63A 1L0PA 2ZX5A 1GOOA 1CEOA 4JIEA 4PEEA 4MB3A 1EOKA 1EHNA 1E0XA 1WNOA 5D9PA 3AYSA 1VRXA 2BY3A 4CN4A 1E6SM 1VFUA 4KGLA 2YDSA 3EDFA 2NT0A 3RM9A 1XRVA 2G8ZA 3GH5A 6TAAA 1FH7A 2XTKA 2WSKA 3N18A 2J7CA 4NRSA 3NIYA 1VF8A 3KWXA 5IHRA 1HJVA 3L4WA 1BF2A 3W26A 3AXHA 1JYVA 4UQCA 5ABFB 1V3LA 3ZJ8A 3WUBA 3OZOA 3ZM8A 3FNDA 2PI6A 1W9UA 3VD7A 5A6BA 2GVYA 3CPUA 1HKIA 4HMDA 1HMUA 4B9ZA 1RWAA 1B3XA 1VBRA 1UD2A 1PZ2A 3WNOA 1Q6DA 1J12A 4P7NA 2WMFA 2DH2A 1E6ZA 1H0IA 4JFVA 1UR1A 5A6LA 3AHVA 4GXPA 3N04A 2VQTA 4Z2IA 4ZXLA 4HOWA 1W1PA 5CGTA 3GBDA 1MXDA 1CWYA 4V28A 3ARVA 2J7HA 2D2OA 5E0CA 1DWJM 4AZCA 2QPSA 5E0FA 2CPUA 3W6MA 3A3HA 2GJXA 3BAKA 2YIHA 3VIMA 1ZBVA 2XWDA 4FLQA 3T09A 3WQ4A 8CGTA 1DTUA 4U3AA 4AD5A 3WNPA 3WNLA 2WANA 4YPJA 2VNCA 1QI0A 3WDRA 2EPOA 1EOMA 1BGAA 2EQDA 3FAWA 4HU8A 4PTMA 3U7BA 1MQPA 2WB5A 3ZT5A 3NJ3A 2F8QA 1UKTA 4GIAA 4HA1A 2ZXBA 2DSUA 3ZR5A 2TAAA 1ZL1A 2OYKA 2UY3A 3K4DA 3CHEA 1PX3A 3WIJA 4HA3A 5JBDA 1QNSA 4AZCB 5LYRA 5CLWA 1B3VA 2YOCA 1XSJA 4W86A 4OOUA 4JFWA 4Y7EA 1I1WA 1D3CA 1RP8A 3AQUA 2J4GA 4AZIA 2PBOA 1PPIA 2CITA 4TTUA 1KR1A 1J0MA 4HA4A 1QI5A 1EDGA 2WDAA 2C8NA 4BZYA 1LL6A 1B3YA 1UH3A 4BF7A 1YQ2A 4DM1A 2D3LA 4XZWA 1BQCA 1WPCA 4DWSC 1ESWA 2FH6A 3BMVA 1RP9A 1N7RA 1RH9A 3ARUA 1VFMA 1D2KA 4PMOA 4J3WA 1J0HA 1QI3A 1MW3A 2PWFA 1GJUA 2JEPA 2WC4A 3M46A 3WD4A 5DFAA 3SIMA 1HXJA 3D3AA 4PYSA 1N7OA 1NWSA 3VIKA 4ZENA 2VVSA 1WCGA 5AY7A 1E1EA 1B2YA 3B9DA 1F9GA 5M3WA 1JFHA 5ECUA 2XSAA 2W61A 3PZQA 3VGHA 1JF5A 1GQJA 4U3CA 4AIEA 3PZMA 2V38A 3F5LA 4OUEA 1E15A 3OLGA 4B16A 5D8WA 1NM9A 4PMNA 1AMYA 1KWGA 1BYCA 1HP5A 4UNIA 1OSEA 1PJ9A 2ZUSA 4WKAA 3WSUA 4H8UA 1MWOA 4IISA 1V3HA 1HP4A 3OBAA 4X0VA 4D1IA 2DDXA 3BAJA 1QOXA 1HKJA 4UQDA 2WVVA 5A6BD 3WH9A 1J0IA 4C7FA 3MUIA 4KMQA 1M01A 2XFRA 4AC1X 1UHVA 1NP0A 2WCSA 1SMDA 2FHCA 1TR1A 3SCTA 2DH3A 1V0NA 4W87A 2WMHA 1LG2A 3T0AA 3WENA 2WCOA 2WZEA 1E6QM 1FP9A 1V0MA 3AMGA 2ZUNA 3EDJA 2PF0A 3OGSA 5KEZA 1BLIA 5ABEA 1XHGA 1UWRA 1V6UA 3RPMA 4PTVA 1EDTA 1LXMA 1BHGA 3OG2A 4D6GA 1NOUA 2BVTA 1LWJA 5AYBA 1E3XA 1XSIA 4J3XA 1G0CA 1I8QA 1IT0A 1HN1A 1CYGA 2WVVB 1CBGA 1Q6EA 4Z2KA 5I2UA 3BSGA 3ZSTA 4HZ8A 3TONA 1CGUA 1C8XA 2BS9A 2CBJA 1CIUA 4MNJA 1HVXA 3VGFA 5GQBA 1UOKA 1EHAA 1W9DM 1E43A 1WDQA 4AMCA 3L4UA 2XYLA 3K4AA 4H7VA 1E70M 3MSDA 1RPKA 5GPRA 3OGRA 1LG1A 2YKKA 4TX6A 3T2QA 1TUXA 2J62A 2VCBA 1TVNA 1BFNA 5EB8A 1A47A 1V6YA 2WK2A 3KZSA 1W9VA 3APGA 1TE1A 4AXNA 4TVDA 1DWGM 4HPGA 1X1JA 2YLLA 7A3HA 3VD5A 2GUYA 4AD4A 1XYFA 3ALGA 4UFHA 3VIGA 3L4ZA 1GQIA 3AXXA 1C8QA 4MAZA 2QF8A 2G41A 5A8MA 2GFTA 3ZO9A 3M07A 3DECA 1MW0A 2E0PA 1GPFA 1KGWA 4QCFA 1C92A 2BY2A 4HZ7A 1OD8A 2QMJA 1R87A 1H0GA 3CZGA 3GNPA 3VD9A 3ARYA 1RWCA 4U5KA 3AICA 2WHKA 3GXIA 1CXKA 1C8YA 1HN0A 1GNXA 1PX8A 1WZAA 2BFGA 4OBSA 2GJPA 1R85A 2E9BA 2FHBA 2VX5A 4ATDA 1H09A 4MNKA 3CZLA 5BXPA 4J27A 1AQ0A 1UKSA 2PWHA 5CPSA 1MYRA 5HPOA 1J9YA 3GH4A 4UQAA 2JF6A 1MXGA 1E71M 2ZUWA 1FOBA 4QLJA 1LLOA 5AC5A 2CBUA 1E4MM 1CLVA 3BAXA 2V3GA 2UWFA 3IAPA 3ZJ7A 4KRUA 3WEMA 5A6JA 1ISZA 4W85A 4GO9A 1FHLA 4E2OA 3WL0A 3WN6A 2VVNA 1V02A 1NOWA 3WF4A 4QLLA 3RILA 3QOMA 3WF1A 5HOSA 5A1AA 3WMBA 2HISA 2XG9A 4XZBA 3RJXA 4BS0A 2CESA 2XGIA 2DT3A 3SUVA 1V3JA 1UZ1A 3AHYA 4JKLA 4D1JA 3VTRA 4P8VA 3AXIA 4Z2GA 3WFZA 5CPTA 1JDCA 4PUDA 5IDIA 3W0KA 1VENA 3WH6A 4Z2JA 1CXHA 3AJ7A 2EPKX 4OJYA 3CGTA 5A8NA 1W1TA 2W66A 3VPLA 4MJ4A 1WDRA 3UR8A 2BNJA 3AHXA 4FLRA 3RMEA 2DQXA 2ZX6A 3BC9A 5CLTA 3WH5A 4UOZA 3ZQ9A 2XFFA 1X1NA 1UKQA 2Y8VA 4R5EA 1OJNA 5D8ZA 3OA5A 3EMQA 1B3ZA 3MANA 5D4YA 2ZUVA 1UQYA 2OSXA 1QPKA 1WO2A 1XD1A 3ARRA 2O9PA 3E1F1 5I23A 1JYXA 3WQ8A 1KXVA 2J7BA 4PTWA 1UWSA 1CGXA 1MW1A 1JZ3A 3VDCA 5DT7A 1CZ1A 5M5DA 3CHCA 1DEDA 5EMYA 1JXKA 3K8KA 3I3DA 1SYTA 4W89A 4UOQA 1LQ0A 1W32A 2WW5A 3WDJA 2ESCA 3PTQA 3VNZA 3BCDA 1CLXA 1NQ6A 2WXDM 1CXIA 2Y2WA 1GZJA 2YA0A 3GNRA 4ZXOA 3ZJKA 5HPCA 1NWUA 2GK1A 2XJ7A 3K46A 4LGXA 4GINA 1B3WA 1V6VA 3CHDA 1XC6A 2NSXA 1E73M 2WHLA 2JE8A 1DWHM 4RE2A 4PMUA 4F8XA 1TG7A 5FIPA 5E6ZA 3BCFA 5GNXA 2E4TA 4HU0A 4UQBA 1G5AA 1M53A 1PX4A 1JZ7A 3O6AA 3ZT7A 2J7FA 4RE3A 1H11A 1JYWA 2J7DA 1FA2A 1UR4A 1ZBWA 4W8AA 3WUEA 4TTGA 3AMDA 5A6SA 3VMPA 4NRRA 2XM1A 4WKFA 3VIIA 1HJWA 2X09A 1W2PA 4UQ9A 2E9MA 2WHJA 4PSRA 4U2YA 4J3UA 4TOQA 2GK1B 4H41A 1JXJA 3QHNA 1X1IA 1KQYA 3PHAA 3AIUA 3WQ6A 1V03A 2XVPA 2J47A 1HF6A 4S3KA 1KFWA 1GVIA 2ZX8A 1PEZA 3ZT6A 3AI0A 3RCNA 2J79A 1GOIA 3TTYA 2C0HA 4E8CA 1XH2A 1W9BM 4TVUA 9CGTA 2BY0A 1EO7A 3UG4A 2VX7A 3SCWA 3CH9A 2WBGA 1LL7A 2VRQA 3AMLA 3BAIA 2X1IA 5A6KA 1C7TA 2QPUA 2C7FA 2JALA 1MFUA 4J7RA 3ARQA 2BRVX 2B31A 3PZVA 2J8FA 3L2MA 3VMOA 4WKHA 1UA7A 1HL9A 3GBEA 3VGBA 2ZXAA 2E40A 3MO4A 2VRKA 3LPFA 2IUZA 3WF2A 4AZGA 3HU7A 1LWHA 1DWIM 1M03A 3ZSSA 5CGMA 2EBNA 5A2AA 5I78A 1JGIA 3POCA 4HMCA 2PWEA 5I0DA 3FAXA 1H49A 4AD2A 3GDBA 3N9KA 3L2LA 2O9RA 3ZIZA 2XGBA 4HTYA 3EMCA 1EA9C 3U7VA 5A8PA 2J7GA 5A69A 2WLZA 1C91A 2WYSA 1GUVA 2G4FA 1MQQA 2VCAA 4B15A 4GQRA 2G3NA 5JIPA 4LX4A 4AZ7A 1V08A 3UERA 1BVNP 4ZEPA 1CPUA 3W38A 3CIVA 3ZMRA 4D71A 4GZEA 4GZJA 4UZSA 3EMZA 4F66A 4BQ4A 4YHGA 4NF7A 3BSHA 3OLEA 4NZCA 2J74A 2VUYA 3FW6A 1QVBA 3N17A 4WSJA 4MNLA 3O2LA 4F9JA 2Y24A 1HIZA 2Y5EA 1E3ZA 5A8OA 2ZXDA 5BXTA 5C8BB 5CPQA 1QHPA 5BROA 4AY1A 4E4PA 2O9OA 3CHFA 3VIHA 2WVUA 1B0IA 2WC3A 4XUYA 2G3JA 5FOOA 2WAGA 1IV8A 4WK9A 1ITCA 3B9AA 2PB1A 4XV0A 4MPKA 2XIBA 3QR3A 5A2CA 4X0NA 3L4TA 4IUGA 1XSKA 2XUCA 5I3DA 1UR0A 1GOQA 2QHAA 3N11A 4JKKA 1BGGA 3VIFA 1QBAA 2VR4A 4UFMA 1J18A 4CGTA 2QLYA 4S3JA 1WZLA 4P8UA 2EO7A 2ZXQA 1ODZA 3WDPP 3WEZA 3GZAA 2E22A 2CHOA 4CCEA 2YL5A 1HJXA 2EPMX 1E0VA 1OGBA 4BA0A 1BAGA 4CU6A 4PCSA 4AWEA 2F2HA 3VDBA 3BMWA 4PTXA 4R27A 5DT5A 3O9NA 2E9LA 3UG5A 3SUSA 1DP0A 4EANA 1KB3A 1OGSA 2UY4A 5FL0A 1HKMA 3AIVA 3DYOA 1NWRA 2Y8KA 2VRJA 2BV9A 1J01A 1HM3A 3UEQA 5I6SA 3WL1A 3W25A 4DUXA 3EDKA 1GHRA 1UKOA 2GDUA 1PBGA 2E3ZA 2CXGA 1KXTA 1WDSA 2CBIA 4PMXA 1MVYA 5ABGA 3FHAA 3OIHA 1XD0A 3SUUA 2A3EA 1CDGA 4HPHA 1FH9A 1CENA 1JFXA 4U2ZA 3THDA 2PWGA 1KBBA 2W92A 4CUCA 4AIOA 1RWHA 3CZKA 1CGVA 2WMKA 4QLKA 4ZE5A 3SCPA 2WCAA 4W7VA 1K9FA 5LA0A 1J10A 3AIWA 2ZWYA 3VMNA 2O92A 2W67A 3AS0A 3BAYA 2E24A 3WD1A 3AISA 2DEPA 4YN5A 2CBVA 4QDMA 2A3AA 1OD0A 1E4NA 4QP0A 3IANA 1TVPA 4PMZA 3ALFA 1J0ZA 1VJZA 1BSIA 1V0LA 3BLPX 1KQZA 4OOZA 2WKGA 1H1NA 1JIBA 3NSNA 1QI4A 1F4HA 1HNYA 5JBEA 3UR7A 2X0YA 4D6CA 3MV11 1UKPA 5CJ5A 4MDOA 1P6WA 4HZ6A 3U57A 1EDQA 1UR8A 1GCYA 5BRPA 4A3YA 3FN9A 5I77A 3WD0A 1F1SA 2BY1A 4F79A 2D3NA 2JF7A 3M6DA 3PN8A 3MSGA 1GW1A 4EE9A 2CCRA 2VO5A 1UQZA 1OIMA 1QNQA 3PZTA 1UD3A 1GJWA 1A3HA 1I75A 2ZOXA 2DT0A 1OINA 3A47A 1LJYA 2NW0A 4P7OA 5CSYA 1BYAA 1E40A 4MAVA 6A3HA 3AIEA 4CCDA 5FL1A 4AZBA 2WZIA 3FXYA 3WY1A 2EXOA 4D72A 2WSPA 3GTNA 4JHZA 3UETA 3MMDA 1US2A 5LA2A 2CERA 4MTVA 5E6YA 2D20A 5TD4A 3AIQA 1OBAA 5JIWA 1JL8A 5DEZA 3MUY1 1NH6A 4CN6A 4TX8A 1XH1A 1UR2A 2VMFA 3RM4A 4TVCA 4MB1A 3CBWA 4XX6A 3NYDA 1C3FA 1J0JA 3II1A 3WKZA 1W1YA 4AZHA 4ACYA 1JZ4A 4IPNB 3WD2A 3F4VA 4PRWA 3SCVA 1JG9A 1TFVA 5I24A 3QHMA 3CUJA 5HBFA 4PN2A 1C7SA 1WKYA 2YLAA 4PUEA 2CETA 3W53A 1ZBKA 3ARSA 3ARZA 2BXYA 4OKDA 1JYNA 1EGZA 4M24A 4HMEA 2YL8A 3TP4A 3B8SA 2X05A 1HJQA 1W9PA 5A95A 1M04A 1OWQA 3ARWA 3PTMA 1GOMA 5JUVA 1KXQA 2RGLA 4P8WA 2A3HA 1K9DA 1NP2A 2CEQA 1G9HA 1ISWA 3AS2A 2MANA 3A6OA 5JBFA 4PMYA 3W24A 1NARA 3WH7A 3MUZ1 1VB9A 4ATLA 3DC0A 4LQ1A 3D5HA 2VJXA 4JFTA 5D9MA 5A6AA 4DUVA 1E5NA 2ZWZA 1KXHA 5GNZA 1UZ4A 4FK9A 5IXEA 1B1YA 1ITXA 1IZKA 3BXWA 2V3EA 2VZVA 5E09A 1Y7VA 2WM0A 3W27A 4M8UA 5BCAA 3IJ7A 4N42A 1KCLA 2D24A 1UH4A 3AS1A 4UFKA 3WQ5A 1GONA 1X6NA 2D0FA 1F4AA 5M17A 2AMGA 2FHFA 1E6NA 3CO4A 2ZIDA 3W4RA 1KGUA 1J0NA 1W3YA 4W8LA 1OM0A 2D1ZA 4AD1A 4B3LA 1QI2A 3QOKA 3ARPA 3DYMA 4U5IA 3L4XA 1ZBCA 1K9TA 2A3CA 4CD8A 4URIA 1DHKA 2WWCA 3NCOA 3VX0A 1HT6A 3UESA 1BYBA 1RWGA 2J75A 4NI3A 3J7HA 7CGTA 4JCLA 3NSMA 1JAEA 2CNCA 4OBRA 3MMWA 3MUAA 1QNRA 5D9NA 4AEEA 2VX4A 5CZKA 2Q8XA 4P7QA 3HMCA 2ZICA 1JD9A 2Z1KA 2X8RA 2Z1SA 2WWDA 1SMAA 4ML4A 1S46A 4JKMA 4J3TA 1O7AA 1FP8A 3WF3A 1XGZA 4KWUA 2F61A 5CQ1A 7TAAA 2DSZA 1C82A 3A4XA 3UCQA 2PWDA 4CKQA 4C7GA 1UWQA 1JD7A 3WBEA 2OLHA 3KE0A 3NSXA 3WQWA 3VD4A 1KCKA 1AQHA 4CD6A 3LPPA 3GXDA 3RIKA 3T08A 4W7UA 3WDQA 2OYLA 2JFEX 4LYQA 1SFSA 4W88A 1K6AA 1NWTA 1VEPA 3VILA 4F9DA 2OYMA 1EGUA 1AQMA 2X03A 3I3BA 2EEXA 4GQQA 2PBGA 3ZOAA 5HNNA 1GQLA 1R7AA 1JZ5A 4H8VA 3KL3A 1QW9A 2VZTA 1LF1A 1TZ7A 5A3HA 4MADA 3W6LA 1VFFA 3CUIA 3NDZA 1E5JA 2CKSA 4WJXA 1TCMA 2XM2A 1XH0A 3VGGA 3SCQA 4JL1A 2WCGA 4D6JA 2WMGA 4KH2A 2DT1A 3ZR6A 1EIBA 1VIWA 3N12A 2JIEA 1BG9A 1V6XA 3FY1A 2WVSA 4WLCA 3MV01 1JF6A 1QHZA 4CD4A 1W91A 2V5DA 2ZX9A 4AEFA 1HJSA 2E8YA 3FHQA 3AHZA 4AIUA 1K9EA 3AIRA 3WF0A 1JDAA 4OIFA 2FDMA 2ZX7A 2WPGA 4D6IA 3AOFA 3ARXA 3VX1A 2CIPA 3M7SA 3WNMA 1VBUA 3CUHA 1UD5A 4EKJA 1UD6A 3A4AA 4ZE4A 3T2OA 1UG6A 3IK2A 1NOFA 3SCOA 1E6PA 1FFQA 4FF5A 4U33A 5KZ6A 4PMVA 4UOJA 1E56A 4D6HA 4PMQA 1ZJBA 1Z32X 3OLIA 5EFDA 1W1VA 1GOWA 1JAKA 4PSPA 3SCUA 1UWIA 2XVLA 3VDHA 4JFUA 3MS8A 1PZ3A 5E9AA 1I1XA 1DWFM 2VX6A 3I3EA 3CMJA 1OGGA 2YA2A 3WEOA 1R86A 3IAQA 1US3A 5AYIA 5IFPA 1EXPA 3S6TA 2XVKA 3F5KA 1XYZA 1QNOA 1UR9A 1Q6CA 1CXLA 4QFUA 2UY5A 5A2BA 2VR5A 1JZ2A 5CXPA 4B3KA 2A3BA 1CXFA 5A94A 3TOPA 3TA9A 1QW8A 1OCQA 3WDIA 1CB8A 1JNEA 4Q22A 5F7UA 3WDHA 1EQPA 2HVMA 2GJRA 4WIWA 3VIPA 2XFYA 4AYSA 1V6WA 2XVGA 4A4AA 4LXFA 2DT2A 2AAAA 1VFOA 3AZRA 1WE5A 3PZNA 1ZJAA 4JZ5A 1H2JA 3AMCA 1CGYA 4MDPA 3CUGA 1JI2A 2W62A 2WNWA 3AHTA 1N82A 4D6EA 1UH2A 3QGVA 4JHOA 3PZOA 4W84A 1TMQA 3SUWA 1E55A 1B30A 3DYPA 5AC4A 4AZ6A 4E8DA 3N13A 4M1RA 5HDRA 1XCWA 1H4PA 2FH8A 1MQRA 3KL5A 4H8HA 1GQKA 1FHDA 1DWAM 1X6LA 4RL3A 1OT2A 1TA3A 3AZTA 1JZ8A 5ABHA 5LA1A 1ISXA 4YHEA 3DHUA 1GORA 4Z2LA 4W5UA 1H3GA 4J28A 4P7LA 2V3DA 1U30A 2X2YA 4JL2A 3BLKA 5C71A 5CG0A 3TTOA 3KL0A 3SURA 1OB0A 2X0HA 3WD3A 1MFVA 3AIBA 1XCXA 1E4IA 2GJXB 4ACZA 2YBTA 1XV8A 4FLSA 2G3MA 4BQ5A 4D6DA 3WMCA 2DPEA 3VVGA 4PMDA 1N7NA 3AMKA 1YHTA 2D22A 1B31A 1OJPA 2WMIA 2G3IA 1AVAA 3WUGA 2EPLX 4OZOA 3CUFA 1LOHA 3AYRA 1J0KA 5IHSA 3CLWA 2BRPA 1Q4NX 4J3VA 1E72M 2W91A 2Q1FA 3GXFA 2D0HA 5FD0A 4CD7A 1LL4A 4V2XA 1OJOA 3BAWA 2O9TA 2IXVA 2YDRA 1TA3B 1JI1A 1HKKA 3N1AA 1E0WA 1UUQA 3WNNA 3W37A 4GI8A 4A3HA 4KRTA 2OSWA 4W8BA 2Y4SA 2J25A 4QCEA 2CKRA 3W81A 2ZUUA 4L4PA 4FLOA 4TXEA 3CMGA 3OB8A 3TTSA 2WKLA 1PIFA 4ACZB 3AROA 1ISYA 1CECA 3K8LA 1R7OA 3CZJA 4UCFA 4JCMA 1FH8A 5GNYA 4H2CA 2YDQA 4PMRA 1EO5A 1RD6A 2WMIB 1G1YA 4X9YA 4H04A 3TTQA 4Q7NA 1U33A 2VZUA 2CHNA 4LYPA 1ZS2A 1ECEA 3EBVA 1JDDA 5M03A 3RDKA 3GNOA 4DUWA 4DWSA 3W28A 1IZJA 4M82A 4IM4A 1E4LA 2WBKA 1CGWA 4JAWA 4BQ3A 1OIFA 1WB0A 2NT1A 2J78A 1GVYA 3LPGA 2QV4A 3S2CA 3PZIA 1ISVA 1MW2A 3PBGA 4W5ZA 3VINA 3RJYA 3WQVA 2J8GA 3B9EA 1EH9A 1EQCA 1Q6GA 1QNPA 1W3KA 3NUKA 4AD3A 3VGEA 1JZ6A 4UTFA 2VTFA 1CGTA 4DM2A 2ZE0A 3SCSA 2VZOA 2DIEA 1W3JA 4GO8A 1BYDA 2XIIA 4MB4A 2WC7A 4CN1A 4IPLA 4CU7A 1M7XA 3AZSA 2BRWA 4M80A 6CGTA 3OLDA 1BG4A 1O6IA 1V3KA 2DSKA 3HN3A 1ODUA 1SR0A 4L4OA 3T0BA 3CTTA 1OT1A 5BRQA 2BVDA 4DWSB 1UWUA 2WZHA 2WLYA 4ZFMA 3SUTA 3CZ8A 2YA1A 2GSJA 4GKLA 3KEHA 1KBKA 1B90A 3WNKA 3OGVA 4MNMA 2VZSA 1V02E 4W7WA 3ECQA 4AD0A 4HOXA 2UY2A 3G6MA 2RGMA 8A3HA 1BVZA 1N7QA 3U5UA 2YJQA 1CXEA 3ZJ6A 4HP5A 2BHUA 1VEMA 2BHZA 3VIJA 3WMSA 3K8MA 1ZB5A 4CVWA 1W2VA 3VO0A 4BCEA 4AW7A 2VOTA 1E9LA 4BQ2A 1WP6A 1HJUA 2YBUA 2OWCA 1HX0A 3POHA 4U31A 3WH8A 2FGZA 4QAWA 5A6MA 1B9ZA 1G01A 4M56A 4CU8A 3AS3A 4C7DA 4XB3A 2DGAA 1D7FA 3T0DA 1FFRA 5IFTA 5BWFA 3WELA 1C90A 3VGDA 4KGJA 5EBAA 1QBBA 3VIOA 1CNVA 2DIJA 3QHOA 2VCCA 1VJSA 3THCA 3SCNA 4EK7A 4LPCA 1BPLB 2YL6A 3L4VA 3SCRA 3L4YA 4N0RA 1QHOA 4PCTA 3WBAA 1H5VA 2VI0A 1W3LA 1J11A 3PZ9A 3ARTA 2VT0A 3GXMA 1LXKA 1HM2A 1RW9A 1C93A 4NSBA 5I79A 5I5RA 3BH4A 4GI9A 3W82A 1ZU8A 2WVTA 1WDPA 3K1DA 3VM5A 5BXRA 2D0GA 3PZGA 2V3FA 2JIWA 1VAHA 3CZEA 4W93A 5FKYA 1PIGA 1R8LA 1UYQA 2VQUA 2DSVA 1W9XA 3A4WA 3HJEA 1HL8A 2J77A 3NDYA 3OZPA 4P8XA 1OJMA 3IJ8A 3VDAA 5CSUA 1HVQA 1V0KA 2EPNA 2DSWA 4CD5A 4UFLA 3LPOA 4CCCA 4CVUA 4UR9A 4GI6A 2VURA 3MMUA 1Q6FA 3VM7A
chains in the Genus database with same CATH superfamily
1S1PA 3E38A 3L12A 4DYEA 5LGXA 4V27A 1H41A 4IQEA 4MGGA 4IQDA 2DQWA 4C5YA 2OCZA 3GYCA 1LDCA 2EJ1A 4AU0A 1GHSA 3EOEA 1E6XM 5FJIA 3VOCA 2XN2A 1YDOA 3HGSA 3E0VA 5G1TA 4GQ0A 4QQUA 1G94A 4LOCA 4WSKA 3W22A 1UD8A 1KKRA 4C6MA 4UXDA 1ZP3A 4E38A 3THQA 2QMKA 4H4IA 3GH7A 5K7JA 2Z00A 2ZQ0A 1LQ2A 2TSYA 4HNVA 3M6YA 3DESA 3VKKA 2XWEA 3KHDA 3B9NA 1OYBA 3OQ8A 3R13A 4RE4A 3H7UA 4JFSA 4IMDA 4Q4MA 2NQLA 4J3SA 2FPYA 4OE7A 2YZRA 1TR9A 4AISA 3AFBA 1L6SA 3GFXA 1GK8A 2C0AA 2X1RA 1X1HA 1PAMA 1KGXA 5XIAA 3T55A 1D9EA 3GU1A 3GNDA 3AU6A 1E1FA 4M5PA 4BWLA 1PTAA 3T8QA 3F5JA 3LI1A 5DLCA 3OQEA 3URNA 3PPGA 3NQAA 3CM4A 5K9DA 1XUZA 4JQ1A 3W7LA 1KWKA 2QCDB 5EFFA 2ZUMA 4L6OA 1W0MA 1REQA 1FQ0A 2GYIA 2HBXA 5I07A 4ZO9A 5ABFA 3MVIA 1V3IA 4G56A 1UD4A 2PD5A 3W2UA 1BTCA 5TF0A 2PDJA 1A5AA 2YDAA 5U7SA 5AVHA 1FDZA 4F0KA 2ZX5A 1GOOA 4JIEA 1WNOA 4ICMA 5D9PA 3M0MA 3E2VA 3KP1A 3DFYA 3NYZA 1E6SM 2YDSA 3G1RA 1XIJA 1EEPA 1OX4A 1XRVA 3AWOA 1JPDX 4UTTC 1EP3A 6TAAA 1R3WA 4KCWA 2D2JA 3EX1A 2E1WA 4I6KA 2J7CA 3P93A 2PSNA 3KWXA 3Q65A 4R9XA 3ANYA 1BF2A 3L4WA 3P80A 3VCRA 3IVSA 3DKLA 3FNDA 4JY8A 5MHBA 8TIMA 4PUWA 4Q8UA 4PZVA 3VD7A 3S5YA 3BQ6A 3NZ1A 1XLGA 1ZCCA 4U28A 3CQHA 1Q6DA 3VOHA 3V36A 3C0SA 1E6ZA 1H0IA 4JFVA 1FWGC 4GXPA 3CYVA 4Z2IA 4ZXLA 4HOWA 3GBDA 4LC6A 4V28A 3M0VA 2ZADA 1DWJM 4WCJA 5G2IA 3PQIA 4TMCA 2NQJA 3A3HA 3BAKA 4HN8A 4J35A 1SW7A 4WHBA 2P8CA 2I9EA 2W0UA 1D8CA 1L6YA 5CZ0A 8CGTA 1FWIC 4AD5A 4FNPA 4KQNA 3WNLA 5J04A 1QI0A 3WDRA 1G7VA 4JTTA 4LUTA 4PTMA 2VC7A 1LP6A 4LFYA 5A5WA 2WB5A 5XIMA 1X38A 4EVZA 3CYJA 1NIUA 3NOYA 2HCVA 3GDRA 4GISA 3FDGA 4MUPA 2DSUA 5BWAA 2TAAA 1ZL1A 1S2WA 1O12A 3TK7A 1PX3A 2Z26A 4RXGA 3WIJA 1OX5A 4HA3A 5JBDA 1QNSA 3TKFA 4CNUA 5CLWA 3BG5A 3T7VA 3NDOA 3VAVA 2Z1WA 3GUWA 1WBJA 4W86A 4OOUA 4AQLA 3MP5A 1I1WA 4WXZA 4B90A 1RP8A 1YIXA 2J4GA 3AC0A 1PPIA 1SZFA 2ICSA 3O07A 4J1OA 1QI5A 1EDGA 2OEKA 3WQCA 1UH3A 4R88A 4BF7A 2AL2B 4XZWA 1N7RA 4GVGA 2IQ0A 1RH9A 1V7AA 3I4EA 1Y0EA 2GGEA 1F8IA 4UTLA 4UR8A 4J3WA 4YWIA 1MW3A 4DEFA 2WC4A 1M68A 5DFAA 5EA9A 4UR7A 2YXGA 3D3AA 2VVSA 1B2YA 3B9DA 1LOSA 3OEXA 2XSAA 4NNAA 1QPRA 4U3CA 3F4CA 2V38A 3F5LA 3KOYA 1OYAA 4OV9A 3KS5A 5D8WA 4PMNA 4UNIA 3NAVA 1WV2A 1FXQA 4XIAA 4XAFA 3CEPA 4MYAA 1OC5A 3R4IA 3UCCA 4IISA 2PTDA 1EEXA 3KLLA 5A6BD 4GA8A 1BWVA 5CPLA 4HA0A 1J0IA 3R12A 4AHOA 4KMQA 1SMDA 1NFBA 1TR1A 3Q37A 3H53A 3U0HA 2WMHA 1XBYA 2WCOA 1GYNA 1DTNA 1W5PA 4H01A 5EMLA 4O53A 3VI2A 2PF0A 3R0KA 4IQLA 3GG8A 4F0LA 1XHGA 4XAZA 1LTDA 8XIMA 1B5TA 3SQMA 4UWMA 2C19A 4O14A 1LXMA 3B8UA 4GKTA 3KBJA 1Z3NA 3MMTA 3S9ZA 1XSIA 4J3XA 3IACA 4X61A 1IT0A 1EFZA 1CYGA 1FWCC 3BSGA 4AYGA 3ZSTA 1R3VA 1C8XA 1B3OA 3LSCA 4Y9PA 4DJED 1HVXA 3DEQA 1SO6A 1TPH1 4EF9A 5GJPA 3M5VA 3S1VA 4GH3A 4GNVA 1E70M 3MSDA 2VGGA 3PBUA 4NZ4A 4MHBA 2XISA 4YWSA 3HPFA 4TX6A 3T2QA 1XDJA 3E96A 1K7XA 2VDHA 3CQIA 3PWAA 4LVGA 1TVNA 1BFNA 5EB8A 5TIMA 2UZ9A 3KUMA 3MA8A 1V6YA 1PYFA 4ZFCA 4LV4A 3OBEA 3UVAA 1FKXA 1DWGM 3SGZA 4FXSA 4HU4A 3THAA 1XQLA 2GUYA 3GHSA 3ALGA 3IPWA 1GQIA 3AXXA 1TB3A 5A8MA 2GFTA 3ZO9A 1MW0A 1XISA 5EMKA 1M3UA 1TUFA 1C92A 2BY2A 3LTSA 4ZGYA 3VZXA 3GTFA 3CZGA 5HATA 3VD9A 1QWGA 3ATYA 3AICA 1SQ7A 2GUBA 4ZOCA 1CXKA 1C8YA 3M0XA 2OG9A 3A13A 2TODA 2BFGA 4OBSA 2GJPA 3B8TA 2E9BA 4ATDA 1FHVA 4MNKA 4DJDA 4WOQA 5FJJA 1DE6A 4Q4OA 2O7QA 5HPOA 3URAA 3GH4A 4GFIA 1UW9A 4UQAA 3NURA 1ADOA 1BXNA 4ZQPA 1CLVA 4N6FA 4WSHA 3E0IA 3HG4A 4RXFA 3WEMA 5A6JA 3CU2A 4W85A 3JR2A 1FHLA 4E2OA 2G50A 3WL0A 3W70A 2ABBA 3QGAC 1V02A 5H1WA 3ABXA 4QLLA 3EPNA 3R8GA 5DXXA 3QOMA 5HOSA 3RJXA 4CQCA 1XPGA 3P81A 3RMJA 3S2JA 1Z89A 2ZRYA 4AX6A 1UZ1A 1XLAA 4JKLA 4D1JA 4JTJA 3AXIA 3CQJA 5CPTA 5EGRA 3W0KA 1FWJC 1CXHA 2YFOA 3PUOA 3R0UA 3N6HA 3VPLA 3WLIA 2BWGA 3U2EA 3WLSA 1H7NA 2V2CA 4A3QA 1TREA 3BC9A 1KO0A 1X1NA 3EAUA 1U1HA 3TH6A 1U5VA 2R1KA 2AQVA 5D8ZA 5CC3A 5JU6A 1DQXA 1YXYA 2AL1A 3F2CA 2E25A 1UASA 3PPCA 3UBPC 1NEYA 2OSXA 1WO2A 4M1BA 3S2MA 4E6MA 4C6CA 3C8NA 4LV9A 3WQ8A 3WLPA 1JZ3A 3MSRA 4LS0A 3KOXA 2GWGA 3P8JA 2QGYA 4ORIA 3LU2A 1DEDA 1IF2A 1TWIA 3VOFA 3K8KA 5F2GA 5AHEA 4W89A 4AAJA 4UOQA 3LD5A 4DJFA 2NV9A 2PRLA 3WDJA 2ESCA 3VNZA 2WXDM 2Y2WA 3QGKC 1NWUA 2XJ7A 4IL0A 3DH7A 1GJPA 1MDRA 1XC6A 1AJ2A 1E73M 1TV3A 4ZO6A 4FO4A 3EOOA 1J93A 1DIDA 4PMUA 1B9BA 1K8CA 4BK9A 4UQBA 1M53A 2OQLA 3CL8A 3VC6A 4XBSA 1O5RA 4HN4A 4LBUA 2IKGA 1Q13A 2P1FA 2J66A 1JCJA 4OQVA 3TC6A 1YPXA 1Z8AA 4MWAE 2C1HA 4OFCA 4H7ZA 3VMPA 2BG5A 2I1OA 2XM1A 3O6CA 4LB3A 3BGGA 2X09A 1W2PA 1IHIA 1R38A 2E9MA 2WHJA 4PSRA 4LAOA 2GK1B 4H41A 5LIUX 3GNNA 3B40A 3HFTA 4N2YA 4Y9MA 1HF6A 2FPTA 1KFWA 1SPQA 3ZT6A 2PTWA 4HYWA 3RCNA 3TJIA 5DXYA 4E8CA 3CB3A 4ASTA 4H9XA 2VX7A 4RZBA 3SCWA 2WBGA 3K1GA 2Z2BA 4HHLA 4MKNA 3AMLA 3W2KA 3H8AA 3WJXA 2CLMA 1MFUA 3ARQA 5D2TA 4TO8A 2J8FA 3L2MA 1OK6A 1K8XA 4OU1A 4C65A 1UA7A 3BSMA 3VGBA 2ZXAA 3SB0A 3T07A 2ACUA 3MO4A 2VRKA 4RZ4A 1W54A 1GVOA 1LWHA 1S5MA 1AD1A 2EBNA 1MZHA 3QKZA 4WD0A 1DYSA 4QIUA 2VC5A 4BF9A 3H4GA 2AKZA 4AD2A 2OR2A 4HTYA 1XYAA 3UJ2A 4AZ7A 4PCPA 3W38A 3MZNA 2QGHA 2XGZA 2OLAA 3ZMRA 4D71A 4GZJA 4UTUA 4F66A 2ZYFA 4YHGA 4NF7A 2NX3A 1X1ZA 1OF6A 4LTSA 3TC3A 4C6PA 1QVBA 3U2CA 1H1YA 3IGUA 5C9WA 4PUKA 3O2LA 3FKRA 4BEQA 5DRCA 5A8OA 1E3ZA 3W02A 1PKLA 4GIEA 3LLDA 3PBYA 5EMJA 4E4PA 2IPGA 4O1CA 3R8HA 1AG1O 3S9IA 4QDPA 1UJQA 1S2AA 3VKAA 4G2DA 5EYWA 2ZZ2A 2EF9A 4WK9A 4IIDA 1ITCA 2OT0A 3HV9A 4XV0A 3W87A 2ZDRA 1VRDA 3VFLA 2DZTA 4IUGA 4NG3A 1EB3A 1UPPA 2Z0IA 5FJUA 2FZNA 4WDUA 4CGTA 3CV2A 4P8UA 3WEZA 5JH1A 3M16A 2OX4A 1MRAA 1BAGA 4YTSA 1S5WA 3FA4A 5J5RA 2CC0A 5DT5A 1E51A 2E9LA 3UG5A 1KB3A 3C2FA 3P74A 3C0QA 2WJDA 3KOZA 3LA4A 2Y8KA 4GH1A 4G1NA 2VRJA 3D6NA 5I6SA 1ONEA 3W25A 1NU5A 3B0XA 3BOXA 1FCVA 2CXGA 1KXTA 3ZZ1A 3H54A 2CBIA 1QATA 1RJPA 5ABGA 3UR2A 1EJVC 2OGYA 3F1QA 1CENA 1JFXA 3ELFA 1RWHA 2WMKA 2DZAA 1JCXA 2WJFA 3TJLA 4PTDA 2YCLB 3VMNA 2W67A 2BB0A 3W73A 4MIMA 4NHVA 4X60A 4RNIA 1HO1A 1ZNNA 4YN5A 3ITTA 3IANA 4IX0A 4PMZA 1J0ZA 1PV8A 1VJZA 4R85A 3TDFA 5AZ1A 4O17A 5JBEA 4D6CA 3ABOA 3I65A 4XAPA 1P6WA 1GCYA 5BRPA 4A3YA 5BMXA 4CNPA 5I77A 4WY0B 1GVSA 3MSGA 1GW1A 2YCKX 1TJ0A 2CCRA 2VO5A 1GVRA 1SSDA 2CW6A 4I7WA 1UD3A 1A3HA 4Z1BA 4NYUA 4CNOA 4ZOAA 1BYAA 3WLOA 3GDMA 3QTPA 4GLEA 6A3HA 4I8DA 3AIEA 4CCDA 5HJLA 3GE7A 3WY1A 2EXOA 4A29A 4D72A 1C9WA 1X8FA 3UETA 3H23A 2F84A 3LOTA 5LA2A 4MFDA 1SZGA 1OBAA 5HWNA 3W7QA 3MUY1 4TX8A 1M7PA 3RM4A 2DU2A 2VMFA 4G7EB 5LGZA 3HG2A 2BASA 3KAOA 3NYDA 1V5XA 3WKZA 1ZZMA 4AZHA 4ACYA 1JZ4A 4IPNB 4ERAA 4PRWA 3EKZA 3I6TA 4KW2A 2F2KA 4B5XA 4NAFA 3RCMA 3PANA 5HBFA 4QS6A 2YLAA 2CETA 4QE4A 1ZBKA 2VEPA 4NZ1A 5H8MA 3W7HA 1EX5A 4M24A 4DBUA 3PBWA 3B8SA 1W3NA 1M04A 1OJXA 4ERIA 3PTMA 1GOMA 3N4AA 4N9CA 2RGLA 3V4BA 4FF7A 1S2TA 2A3HA 1K9DA 1SO4A 1ZPTA 4MOZA 3W24A 5BNKA 2OPJA 3V3WA 1Q7QA 5E93A 1YNYA 4ATLA 2HBVA 3DC0A 3VE9A 1VLWA 2VJXA 3WZ0E 3FYYA 4JFTA 5D9MA 3VOGA 1E5NA 1F6KA 2BOGX 2NUYA 4GUIA 2ZWZA 2DV0A 1KXHA 4JTGA 1UZ4A 1ME7A 1SO5A 1XYCA 4ALDA 3V5OA 1O1ZA 5CH9A 1EC9A 2V3EA 4BR1A 3G0SA 4M8UA 4N42A 1F3XA 2D24A 1HTIA 4UFKA 3WQ5A 1NSJA 2CZVA 3ITCA 5K4ZA 3GTXA 5M17A 1XIBA 2X40A 3CO4A 3ZWTA 1KGUA 4GCXA 3WQFA 4B3LA 1QI2A 3QOKA 3ARPA 3QW3A 4U5IA 3L4XA 1K9TA 4XVEA 1A0CA 4URIA 1DHKA 1H7PA 1HT6A 3UESA 1H7XA 4NI3A 3N2OA 4WR3A 3OG3A 4JCLA 3EPOA 4LB4A 1JAEA 2YXXA 2GQAA 2QJIA 4LS2A 5FF4A 4E3TA 4RNJA 3UZYA 3H2FA 4A05A 2X8RA 4QG8A 4EXBA 4YVXA 2PCEA 1A5LC 4ONVA 4JKMA 4RKAA 4J3TA 1O7AA 5CBIA 2ON3A 3WJZA 3RR1A 4CKQA 1EJWC 4OBTA 5F2LA 3EX6A 4YMZA 3B0YA 1EX1A 1KCKA 1AQHA 1V77A 3LPPA 3G1SA 3GXDA 3SECA 3WDQA 4FA3A 3R10A 1H1ZA 1NWTA 1VEPA 3TYAA 3BUVA 2PBGA 1GQLA 3KL3A 2Z7GA 3PF3A 1TZ7A 1SW0A 3N6JA 2I56A 3HG5A 4FNSA 2CKSA 4WJXA 1R46A 3VGGA 3RN6A 2ISWA 2WCGA 1M9HA 3N9RA 2DT1A 3PPFA 3XINA 5D03A 1WXYA 4IP7A 2HS8A 4PR4A 4CD4A 1K4GA 1W91A 2V5DA 4FZIA 4AEFA 1Q45A 6ENLA 3AHZA 4Q8NA 4X22A 2DZBA 4OIFA 2P8BA 2FDMA 1S5NA 5C6MA 2EG7A 1HW6A 2WPGA 4L7ZA 3M7SA 1VBUA 4GMEA 4JYFA 5H91A 1ZJHA 4ERGA 2QAPA 2VD8A 2WJEA 1MNZA 1UD6A 4DAIA 4EKJA 4N6EA 2EKGA 4QR6A 1T7LA 3T2OA 1YBQB 3AUJA 3SCOA 2GQ8A 3B4YA 4Z1DA 2ZRZA 1E6PA 1IWAA 3ITGA 1FFQA 4FF5A 3UJEA 3NM3A 2HPMA 1QU4A 4D6HA 3TMQA 1Z32X 3TVAA 1VHNA 5EFDA 1NAL1 3PR2A 1MXSA 1K77A 1GOWA 4PB3A 2Y61A 4PSPA 1LOLA 4WOZA 3LX9A 3MS8A 3M0ZA 1JVNA 2P10A 1R86A 4PB4A 4EXQA 5AYXA 1LCOA 1ZCOA 3L23A 2XVKA 2Z4GA 1Y65A 3D46A 4M6VA 4B3KA 2XH7A 2A3BA 4DZIA 3FSUA 4AHQA 1JEZA 2BOEX 4I9MA 2X1TA 2WM1A 1QW8A 3PUDA 1CB8A 2O0TA 1JNEA 5F7UA 1EQPA 4Q8WA 3OU8A 1VBHA 4MJMA 2GDQA 3CMFA 2GJRA 5H2ZA 3TWBA 2VKZG 3T40A 2XFYA 2VDIA 3MDWA 4HPXA 1WE5A 1H2JA 2QJNA 4US5D 3AMCA 1CGYA 3UNTA 1N7KA 5C5YA 3GFZA 1ZTVA 3P5YA 2WNWA 4D6EA 1UH2A 2G97A 1KLYA 2HMCA 3V1HA 4AZ6A 5HDRA 2FH8A 1MQRA 3KL5A 1GQKA 1HKWA 1X6LA 4RL3A 4LNCA 1K7FA 4D9PA 5IOBA 1QOPA 3UZZA 4Z2LA 4W5UA 1CB7B 3LDVA 3REQB 1J79A 1HZYA 3KL0A 3SURA 4L6HA 2E5DA 5HMEA 3HG3A 3IS4A 3OJGA 4FNQA 1XCXA 4IPJA 1DKWA 2DVUA 1O66A 2C1GA 4B5WA 2YBTA 4D6DA 3WMCA 5HMSA 1N7NA 3AMKA 1UC5A 4RX0A 4IL2A 2NQZA 1AVAA 1TKKA 1HFBA 2BRPA 5AB3A 2W91A 2Q1FA 1LL4A 1W5NA 3XIMA 2C15A 1TA3B 1HKKA 3R6IA 4LCRA 5HNRA 1UUQA 4EPKA 3W37A 5T8GA 3NFUA 1WUFA 4A3HA 4KRTA 2OSWA 1UWAA 3BO9A 5BU9A 1C8VA 2PRMA 3NL3A 4NNCA 1YX1A 5LIKX 4FLOA 1SU5A 3BJFA 2WKLA 1PIFA 3C2EA 3AROA 1R7OA 3CZJA 4UCFA 2YEPF 3QMSA 4H2CA 3BK0A 4X9YA 3CUZA 3R94A 2I7GA 3LGEA 5KZMA 4ZR8A 4UMCA 2CHNA 4JPGA 4S1FA 3HOJA 4GXMA 3EBVA 1JDDA 3GNOA 3EX4A 4C1NB 1Q85A 5CG7A 4A22A 4JAWA 1WAUA 4H6EA 2QPXA 4IZGA 3KVMA 2J78A 1GVYA 3QTGA 4HJFA 1K8YA 4W5ZA 2DZUA 4S38A 1H62A 1Z48A 3DBNA 3WMLA 1EH9A 2YR1A 1Q6GA 1W3KA 4S3EA 3LBOA 1JZ6A 4O50A 4UTFA 4DM2A 4IFKB 3MDUA 2HZGA 1DJIA 4KERA 4O11A 5AOUA 2ZE0A 4PL1A 3QR0A 1SR9A 2X16A 3PUGA 3HFYA 3RO6A 4MLRA 4E3VA 4GUJA 1J4EA 1K4HA 4GO8A 2VGBA 2XIIA 4F48A 4PRRA 4IPLA 3S46A 4CU7A 2W6RA 3EX3A 1M7XA 3HPAA 2IPJA 1X7FA 1V3KA 1ODUA 1SR0A 3LV5A 3FLUA 1M6JA 4XD6A 2BVDA 2WQPA 1UWUA 1SJAA 3BJTA 2WLYA 2DZSA 3SUTA 4E0CA 2YA1A 4B92A 2CZFA 3KEHA 3D0CA 4X3ZA 3OGVA 1PYMA 1KC7A 4AD0A 1PWLA 1IZCA 2WZMA 1TMHA 1BVZA 4CEXC 1DXIA 1VEMA 1X98A 4CVWA 4BCEA 1M7OA 1RHCA 3EEZA 3PUEA 4MJZA 1W1ZA 1EWEA 3E2QA 2Y8UA 3QZEA 3IARA 4U31A 1XLFA 1VPXA 1CI1A 4PE8A 2FGZA 4QAWA 1B9ZA 4GIYA 4CU8A 1FDYA 4JTUA 4XB3A 2FZDA 2ZZ1A 3WBYA 4UMAA 3V35A 5IFTA 5TBOA 3WELA 3L0KA 1T8XA 1RK6A 4JYEA 3Q4DA 3SN0A 1DIEA 1NF0A 4KGJA 5EBAA 1QBBA 3UZXA 2DIJA 3QHOA 4NX0A 3THCA 4AVNA 4FX7A 2ZKMX 1TE6A 4XUGA 1P48A 4GBUA 3SCRA 1GTHA 3TOYA 3WBAA 4ROPA 3L7RA 1W3LA 3WQDA 1OYCA 4XD5A 3GXMA 4EF8A 4US6A 4LF1A 4AH7A 3BH4A 3TSDA 1DXEA 5AKQA 1ZU8A 1N55A 5FF7A 5G1MA 1RLDA 2ZZ5A 4JQAA 1R8LA 1UYQA 2NVAA 3R1ZA 3H2OA 4L5ZA 4KWOA 1VR6A 1RY8A 3GSMA 1OJMA 3VDAA 1KM3A 1V0KA 3ZXWA 4JNMA 5JXQA 4CD5A 4UFLA 3PNZA 3LPOA 1GKPA 3MP3A 3E5PA 4CVUA 5H8UA 4GI6A 3FX4A 4AZ5A 2D73A 4B3ZA 1PDZA 1KTCA 2A1YA 2W5FA 8RUCA 3DHPA 1S2CA 4ATWA 2IXUA 4D6FA 4M81A 4EAMA 1TJ2A 3OHMB 1K3UA 2YL9A 3PZUA 4A8RA 2GSHA 3LMYA 1FRBA 1W3HA 2VL4A 3A24A 1WAWA 2HVNA 1PKNA 4M29A 4K68A 2RDWA 3LUTA 4HNTA 3GVRA 2UV8G 3VFCA 2XPKA 1RWFA 2CYGA 4FX8A 3SGUA 4AF0A 5FCZA 2QCDA 2OB3A 3RX3A 2FJKA 1Q6LA 3EB2A 3MUCA 5RUBA 1IYXA 2PTXA 1GOKA 3DIPA 1L8NA 3PNUA 1E9ZB 4DF0A 1OFRA 3N15A 1HL2A 1O5KA 5C70A 3ZWSA 1E6RA 3UG3A 1TELA 4C90A 1N7PA 2XZ7A 4PBGA 4ZTYA 1FWFC 5E70A 4KS0A 1W5QA 2J8TA 2OSYA 1TTIA 2PC8A 4LSBA 1ECQA 3PP7A 2GL5A 3VK5A 2E8ZA 4FEZA 1SM9A 1YE6A 5D2WA 4WDXA 4OECA 3WFLA 5D37A 1JNDA 1D7KA 3WQGA 4K38A 3LCHA 4XVDA 2V5CA 3QVQA 3VU2A 3ENLA 2ISDA 3G1HA 1EJSC 1PZ0A 1TPDA 3DFSA 2FGLA 3W1RA 3A21A 5HMDA 1M41A 3HA1A 4NJKA 3BGAA 7ENLA 2W63A 4JN8A 3EWCA 4GYKA 4PEEA 2C91A 2GLKA 4JD4A 1MRQA 2ZZ6A 1Y5XA 1VFUA 1RPXA 3FIGA 2NT0A 3TIMA 1EJTC 4DF2A 4LNYA 5TQLA 2XTKA 1SJDA 2CZEA 4G5DA 3MHGA 3ZVHB 3DGBA 3N18A 2TMDA 3M5XA 4NRSA 4L80A 5AVNA 1VF8A 4Z1CA 1BWKA 3AXHA 3KCOA 5F2MA 3KBMA 1TV2A 2P0OA 1SFLA 5A6BA 4DBWA 2GVYA 4HMDA 3QR1A 1B3XA 4DXVA 4FIQA 3IJ6A 1PZ2A 4D8AA 2WMFA 2OQYA 4GD0A 3LERA 4K7VA 1SZEA 1NDZA 4MWAC 5A6LA 2RDUA 2VQTA 1WDWA 3N34A 1W1PA 3W7EA 4YYFA 1L6WA 3CUXA 1N8WA 3E02A 4C6QA 2CPUA 2PURA 2I14A 2VHLA 2XWDA 3W1MA 2EHHA 1E0TA 4FLQA 3RYSA 3WQ4A 4U3AA 4JNZA 3WNPA 3HO8A 4L61A 1K7EA 2H90A 2JGYA 4A35A 1BGAA 2R1PA 3CPRA 3WK0A 1O0SA 1MQPA 1Z6KA 4DJEA 2F8QA 3NQVA 3CNYA 4PULA 1Y5VA 3CIXA 2XIQA 2ZXBA 4HA1A 3SRKA 1P0DA 1LWIA 1KNWA 4HYRA 2OYKA 3MTWA 3HQOA 1A3XA 4Y8EA 4QRNA 4GUFA 4X2RA 1RCQA 1B3VA 1UBPC 2CLFA 3G1AA 1P7TB 2BODX 4C6IA 4JFWA 4Y7EA 5I09A 4LVAA 1OADA 3AQUA 4AZIA 1FCUA 2PBOA 4RUBA 4HMNA 4L9YA 4H6KA 3PBVA 3R7MA 3TLLA 1YW1A 4HA4A 3VA8A 2A7RA 1P0BA 4WJEA 1L9WA 4C6LA 1XFBA 1Q63A 4O0KA 1YQ2A 4GX8A 4B5TA 1AMKA 1WPCA 1J8VA 4DWSC 3QPEA 3BMVA 1XFCA 3W7DA 2DZWA 3G3DA 1G4PA 4Y9NA 5I3JA 2OZ3A 2PWFA 5CZTA 3LZ3A 2JEPA 3WD4A 5LXEA 3KOWA 2DJXA 4UUIA 1V93A 4S3BA 2VWSA 4S3CA 1WCGA 4MMWA 4GVIA 5M3WA 1JF5A 2DP3A 2XN1A 1GQJA 2WZTA 5J5DA 1GG0A 1YRRA 4AWUA 1PIIA 1OSEA 1KCXA 3CV6A 2EG6A 4WKAA 3WSUA 4K3ZA 1BXBA 4H8UA 4KFNA 4N02A 2PRHA 1HG3A 1HP4A 3EWWA 4X0VA 1THFD 1MZRA 3WQOA 3QYQA 4HK5A 3THUA 3KHJA 1YPFA 4UQDA 2QUMA 3P67A 3K2GA 4C7FA 2OODA 2L5HA 1G7UA 4YLWA 3NL6A 3T1GA 3QFWA 1A5MC 1WX0A 5FI8A 3T0AA 5LIWX 1Y5WA 3WENA 1NFPA 5HWJA 4MG4A 1TX0A 3D3FA 3VKBA 1RAKA 1UUOA 1UOZA 2Z27A 3H24A 3G2GA 4TQTA 5ABEA 4EP8C 4E2VA 2CLKA 4ZBCA 3RU8X 1UCWA 3UD1A 3LZ5A 1BHGA 4TMBA 4D6GA 1LWJA 5AYBA 1E3XA 1G0CA 4RE0A 1HN1A 3L5AA 1TRDA 1S38A 5AN7A 4HZ8A 3SRHA 3TWAA 5AECA 4C6NA 4XZMX 5ABTA 2VEMA 4MNJA 3VGFA 3OVQA 4XISA 1UOKA 1EHAA 5DMLA 1E43A 1WDQA 3L4UA 2XYLA 4R7WA 4E4FA 4DI8A 4H7VA 4XKYB 1WKDA 2B0MA 3OGRA 1LG1A 1O94A 2YKKA 3CS2A 5HJYA 5D33A 2VCBA 3T78A 4QEHA 4QM1A 2EGZA 1A47A 3KZSA 1XYMA 3BZJA 4TVDA 1EYWA 3RLHA 4JTDA 3ABQA 4HPGA 1X1JA 3B04A 3T6CA 4BY3A 3RNDA 4PUJA 1ZSXA 2B7PA 3HQNA 1ITQA 4UFHA 2PDCA 3VIGA 3L4ZA 4IJBA 4IJRA 4MAZA 5H6HA 5E9XA 1EXBA 5D2YA 4AHPA 1VBJA 3A64A 3LHYA 2D2HA 4HZ7A 2QMJA 4D2JA 1XQKA 5HULA 2JKAA 1QDSA 2VDGA 3RU6A 2RDXA 4H6QA 1Q2RA 3HIJA 4DZAA 1YADA 3ZLFA 3OW1A 1R3SA 1WUEA 3KLKA 1T99A 3F4WA 3VNDA 3CZLA 2FPVA 3G24A 3AUOA 4J27A 5CPSA 2X42A 4JR5A 2O4QA 5FSEC 1UZDA 2JF6A 4L9ZA 1FOBA 4QLJA 3UZWA 3TXVA 5AC5A 4M7TA 2CBUA 1VYPX 4OGZA 3BAXA 3WLLA 3P7YA 1RZMA 3W7JA 3ZJ7A 1U22A 2V63A 2I57A 4MPQA 5PTDA 3I68A 3LQLA 1VCGA 3WF4A 3W2LA 3FA3A 3TQVA 3F7JA 2E09A 3K30A 1OHLA 3PSVA 4XZBA 1MI3A 2CESA 1F73A 3MW7A 5M2FX 3VTRA 5REQB 4N9BA 4NASA 4Z2GA 3F03K 4QE5A 1JDCA 3QPYA 5IDIA 3QZ6A 4Z2JA 4G8TA 4OJYA 3CGTA 5HK4A 5A8NA 2W66A 4XZLX 4FLRA 4HU3A 1T41A 2DQXA 4BEUA 2ZX6A 3JRKA 3GW0A 3WH5A 2EG8A 4RV3A 5D38A 4DB7A 2Y8VA 3KOFA 1BKSA 1EYEA 1K02A 1A5UA 3NZRA 3EGJA 4UMBA 1W5MA 2ZUVA 1FWHC 4ZQRA 1QPKA 3KBUC 1HUVA 3T4CA 5I23A 4GK8A 3E9AA 1KXVA 1UWSA 3W7KA 1XS2A 5HQLA 1CZ1A 3MUXA 2INFA 3QXBA 5EMYA 1GVEA 1JCYA 3A5VA 1DL3A 2Q3RA 1S2VA 3GZ3A 3OTRA 3IT4B 2H6RA 3PTQA 3BCDA 1NQ6A 3R0DA 2GK1A 2R6OA 1TQJA 4LGXA 1B3WA 2H3BA 4JTKA 3CHDA 3PY2A 2Z1BA 2JE8A 4RE2A 1KM5A 4GNKB 1TG7A 2JQXA 3WLMA 5D30A 4V33A 3FYPA 1G5AA 1PX4A 3S5ZA 3O6AA 3ZT7A 1R3QA 2J7FA 1N8IA 2W3ZA 4B4FA 1JYWA 1A5CA 2Y6ZA 3L21A 4EIVA 4QROA 3AWNA 1ML1A 2ZDSA 3LXAA 1XIMA 3H2CA 4X9SA 2FIQA 3I6RA 4WKFA 1VIZA 5FJRA 3GDKA 4UQ9A 3GAKA 3DCPA 4Y2WA 4J3UA 3WQ6A 1WDDA 2XVPA 1JPIA 2W9MA 1PEZA 4NILA 2OO0A 4LAZA 3C2OA 1GOIA 3TTYA 2C0HA 4TVUA 4DAFA 1YNPA 1EO7A 1P6BA 4O8RA 4NYYA 1H60A 3CH9A 1LL7A 1RR2A 1C7TA 2NXHA 2CU0A 4WGXA 2C7FA 4Q4PA 2JALA 2O56A 4J7RA 3PZVA 4PB5A 5I3FA 1YPIA 3LI0A 4FP1A 1HL9A 5G2HA 4XK2A 4QX4A 3L66A 3TLQA 2IUZA 5CGMA 4O13A 1FVPA 2PC4A 1RVKA 2B81A 3POCA 5FA5A 2PWEA 3CK5A 3BLEA 1H49A 4RZ5A 3GDBA 5DCBA 3ZIZA 1LLQA 1TTPA 1KM0A 4YJ5A 3U7VA 3EMCA 4QJ1A 2WLZA 3H2EA 2WYSA 1SZNA 2G4FA 1Q8AA 1UROA 1UB3A 1CX9A 3CB8A 4CCZA 3W7MA 3UERA 4ZEPA 1CPUA 1MUWA 2EKCA 3CIVA 4GZEA 3IWPA 2WSYA 3EMZA 4BQ4A 5IBXA 3VNKA 1XC4A 3BSHA 2EJAA 2WNZA 3W1QA 2VUYA 1VCVA 2WSQA 4L1XA 3W72A 2Y24A 4F9JA 3W7IA 1HIZA 2Y5EA 1DQWA 2ZXDA 5C8BB 1XJBA 5BROA 3OZMA 4HQVA 4Q8TA 3VIHA 5CGQA 1B0IA 1JULA 2G3JA 3WCZA 5FOOA 1I60A 4GNJA 1EA0A 4K8HA 1IV8A 2FTYA 3NPXA 2RDTA 4A8LA 4MPKA 2XIBA 3W1AA 3EXTA 4FXFA 1ICQA 3W00A 3S5SA 2XUCA 5I3DA 1GOQA 4JKKA 3VIFA 3FK4A 1EP2A 2QLYA 3HF3A 1I2RA 1ODZA 3WDPP 2E22A 2CHOA 3TNBA 3U9IA 1UMYA 1ZAHA 2YL5A 2YCLA 4WXYA 1E0VA 1RA5A 4BA0A 3VDBA 5EL1A 3L67A 4UTWC 3EOSA 1MMFA 1E0UA 2R14A 3B03A 3LHUA 4Q6JA 1ICSA 1OGSA 4NKCA 5FL0A 1W6TA 1XLKA 2NX9A 4ZQOA 1NWRA 3RUBL 2QDEA 1F3WA 3GHUA 1F5ZA 1HM3A 1SVDA 3WL1A 1UKOA 1S2UA 1ZAIA 4OWGA 1XBXA 4WY0A 4YU1A 3A23A 4PMXA 3GNXA 4PH6A 3FHAA 3OIHA 3S6OA 1XD0A 1CDGA 1FH9A 3I7SA 3NR0A 4U2ZA 4I9TA 3TQKA 1KBBA 4ADUA 1CW2A 4CUCA 1CGVA 2DZVA 1A53A 5IM51 2WCAA 3LS9A 2R8WA 4ADSA 2LLEA 4ZL1A 5LA0A 1J10A 2ZWYA 2O92A 3AS0A 3T42A 3BAYA 2RAGA 3WD1A 2ZA2A 2X7WA 1VFSA 3AISA 3SW6A 2VZKD 3ZYZA 4JDBA 3P82A 1E4NA 4FXRA 3ALFA 2FZBA 3BLPX 2WKGA 1H1NA 3NSNA 4G7EA 2ONEA 1F4HA 2X0YA 3MV11 3AO0A 4MDOA 4HZ6A 3U57A 1UR8A 4HCDA 2WV8A 5LIXX 3WD0A 2BY1A 2XH0A 4F79A 3TMLA 2KX9A 4IICA 4GQGA 3CXOA 5DRIA 1EZ2A 3A9IA 1QNQA 3PZTA 1I75A 4O52A 2KAUC 3V0TA 2VC6A 3W23A 1FX6A 3O6DA 4AZBA 2Z29A 1BKHA 4PGLA 2WSPA 3GTNA 3ITYA 3O05A 4DO5A 1JR1A 2WSRA 4MTVA 2J9XA 4ICCX 2XIMA 3CV1A 5JIWA 1JL8A 5DEZA 4PUNA 3L9CA 2HRWA 4DPPA 1XH1A 4KCUA 5JMUA 4TVCA 1JJKA 3CBWA 4OV4A 1G6CA 1J0JA 3M5YA 1OZQA 1TMLA 5T9CE 2CZDA 3QEZA 1ONWA 3DHFA 2OO6A 3SCVA 2X41A 3CAQA 3E12A 3L0NA 2E68A 2QF7A 3CUJA 1UP3A 3UXAA 2FFCA 4HJWA 2W79A 4HT3A 4HNOA 5EPDA 2EAWA 3ARZA 2BXYA 3G1XA 1JYNA 2V81A 4Q7BA 5MF5A 3KZPA 4IGNA 4C6BA 2YL8A 3TP4A 4Q4RA 5A95A 5E5CA 3W1XA 5TNVA 3LMZA 4HCLA 1OWQA 3Q67A 3H2NA 4DYKA 3HM7A 1YTDA 3L5MA 4JICA 1ISWA 3AS2A 3A6OA 4CQ9A 3LV6A 1JUKA 3WQEA 3EA2A 1NARA 3LTYA 2PA6A 2QXWA 1Z41A 2REQB 3MUZ1 1W1A1 1X1OA 2VELA 4NX5A 2NUWA 4LQ1A 1NELA 3D5HA 4YCPA 4CNTA 3VYLA 5A6AA 2F6UA 3GUGA 1R9XA 5GNZA 4FPSA 5IXEA 2YEPB 5IDZA 5LZLA 4NJJA 2V9DA 2VZVA 1Y7VA 2NLYA 4IMEA 4EXAA 3L0GA 3STPA 2ATMA 4GY0A 1GWJA 5FEWA 3S0CA 2FHFA 1E6NA 2FMNA 1BSLA 4RCXA 1LBLA 1Q6QA 4KKXA 1K70A 1OM0A 4AD1A 2E6AA 3CO8A 1ZBCA 4LF2A 2A3CA 1VLIA 3MY9A 2WWCA 2OOGA 3VX0A 2JK2A 2V5KA 1AW2A 1RWGA 4US5A 1ZALA 1BD0A 3J7HA 3W2NA 2VEKA 7CGTA 3NSMA 4JIQA 3QFEA 3MMWA 3MUAA 5D9NA 3KVJA 3QSRA 1GYMA 1OFAA 2Q6ZA 7XIMA 2AGKA 4LRSA 5AHFA 2Z25A 1TPEA 2NX1A 2WWDA 1SMAA 4ML4A 1S46A 4LAUA 3QN3A 3WF3A 1EP1A 2F61A 5G4EA 2PWDA 1BQGA 1XLLA 2HS6A 4C7GA 2PFHA 1UWQA 2A0NA 1JD7A 3BV4A 2OLHA 3UQNA 3NSXA 3WQWA 2BGSA 3URBA 1EKOA 4CD6A 2GOKA 2AQOA 1BRLB 3T08A 4WDWA 2H3DA 2OYLA 2BMBA 1R3TA 2QCNA 2VGIA 4W88A 2MNRA 3VILA 2OYMA 3O0KA 1YBQA 1EGUA 4RPPA 4GQQA 4JEQA 2VP8A 1GW9A 3GC4A 4H8VA 4FALA 4AF0B 2VZTA 1T0OA 3UXKA 1P1MA 4R34A 4HVXA 3STEA 3W6LA 1VFFA 2YB1A 3NDZA 3ONBA 5F1VA 2OTDA 3F2DA 4JL1A 3ISIX 2WMGA 4KH2A 3V1PA 3ZR6A 7TIMA 2FFIA 3LSBA 1BG9A 1V6XA 3MV01 3UYIA 1H50A 1QHZA 2ZA1A 3TU9A 3UGVA 3FHQA 2V2DA 4Q8PA 4AIUA 3AIRA 3WF0A 2OZ8A 3BLLA 5CAKA 2PODA 3I4KA 2ZX7A 3NZGA 3ARXA 4KIRA 2CLIA 3U8GA 4QS5A 3IK2A 3WYZA 4PCFA 4PMVA 2HSAA 1E56A 3TW6A 3LHVA 3OLIA 4H6RA 3P8IA 4DX3A 3HQPA 4IP4A 1W56A 3DXIA 3LENA 3KRUA 3S1GA 1JAKA 3CT7A 3MT1A 5LKYA 4I5UA 1PL9A 4JFUA 2GQ9A 2DY3A 1I1XA 2VX6A 1I45A 3SBFA 3WEOA 3GKAA 3WJSA 2V8ZA 3E6EA 4ZO7A 5IFPA 5AC7A 1QNOA 1CXLA 1FWDC 5A2BA 1A5KC 3KRZA 5E1QA 4FHAA 1R5YA 3VNIA 5A94A 3TOPA 3DX5A 2GVGA 3REQA 1OCQA 5CC7A 3WDIA 3TCEA 3M41A 1UIPA 3EPMA 4UTTA 2YCJA 4JX5A 2XVGA 4GI4A 2DT2A 4INFA 4GGHA 4JZ5A 3R79A 4AIBA 3C3UA 5JVLA 2QV5A 4Q4SA 2W62A 1N82A 3BICA 3KDOA 3QGVA 1RCXB 4DN1A 1EJRC 2OLSA 1E55A 1LUCB 1B30A 3DYPA 5LNUA 4ORMA 5AC4A 2PDXA 3B0PA 4E8DA 4M1RA 4ML9A 4PA8A 4GJIA 1XBVA 3OYZA 3E0FA 1OT2A 1TA3A 1N8FA 2FJUB 3UWQA 4MLJA 1PB0A 4YHEA 3NL5A 2F7FA 3TYUA 5K3VA 1A0DA 1H3GA 1JGMA 4P7LA 4BJHA 4RDWA 2X2YA 5CSSA 2PLMA 3FGCA 1ICPA 2QAFA 2X0HA 6REQB 1RUSA 3B8DA 3AIBA 1E4IA 1KBJA 4FS9A 2VM8A 2DVXA 1PWMA 4B5SA 1EPXA 1XV8A 1S3HA 2G3MA 1XLEA 5C54A 3EX2A 2OKTA 3VDGA 2DPEA 4PMDA 2D22A 1T40A 2JKPA 1OJPA 4F0HA 3WUGA 2Y63A 2BDQA 4J4KA 3O06A 2DZXA 1F9CA 1Q4NX 4J3VA 1E72M 4XKMA 2D0HA 2YCEA 5FD0A 1DV7A 2R82A 3BAWA 2IXVA 3H7RA 3P84A 4C1NA 4JX4A 3WNNA 2VGFA 3GDTA 4MWAB 3EKGA 1AL8A 4W8BA 2V5BA 2Y4SA 2J25A 1DOSA 1TIMA 4YCOA 2ZUUA 2TYSA 4TXEA 2FQIA 3U4FA 3N2XA 2GVEA 2Z2UA 3OB8A 1IT7A 1A5NC 4EWND 2Q71A 4IFKA 4M6PA 3WLQA 1W3IA 3GLCA 4JCMA 5GNYA 2Z2AA 2Z6JA 1Y8BA 4PMRA 3ZLGA 3GXPA 5L6UA 1EO5A 4HNCA 2P5NA 2CLHA 5AFDA 5CEWA 1SFJA 3TTQA 2OEMA 4IUOA 4BI5A 4I5XA 3USBA 3B0VC 4AX7A 3C2RA 5M03A 3RDKA 4DUWA 1BF6A 1Q6OA 4PC8A 4IM4A 1E4LA 3QQ0A 1R47A 4BQ3A 3UW6A 4UTJA 4KWVA 3R5EA 3S2CA 2CLEA 3PZIA 1ISVA 7ODCA 1GT8A 4D8OA 3RJYA 3UD2A 2ACSA 2QQ6A 3NUKA 3VGEA 4F2BA 1CGTA 3GTHA 4OHQA 1XUUA 3SCSA 3TFCA 2E28A 1XIFA 1OCJA 1SUXA 2RFGA 4UTHA 2G95A 2BRWA 4J3ZA 4M80A 1EBHA 2RJHA 4FOUA 1BG4A 3HN3A 4HK7A 3CASA 2ASHA 3W88A 3ATZA 5BRQA 5LHEA 4DWSB 2WZHA 2A85A 4L1GA 4H83A 3MBFA 1VPQA 3EXSA 1KBKA 1B90A 3WNKA 2ZTKA 2VZSA 1V02E 3FCPA 1DJWA 3ME3A 1QR7A 4HOXA 3MBDA 4CLMA 2CHRA 2RGMA 4O1FA 3ZJ6A 5FACA 4HP5A 2BHUA 1GTEA 3AALA 4S39A 2BHZA 3VIJA 3WMSA 3TW7A 4MWAD 4NY2A 2QDHA 3LTPA 5K9XA 4BQ2A 2F38A 1XG4A 4QGCA 1PKMA 1TCDA 2OWCA 4HGXA 3E3HA 5A6MA 1FUYA 3NQBA 1X7IA 4JTLA 3IRDA 4M6QA 3T0DA 3BANA 2OELA 1UUMA 1YXCA 5C7VA 2P3EA 3NVTA 1C90A 4REQB 5M1TA 3UFYA 3IGXA 2VCCA 3I6EA 1PTDA 4EK7A 5FJTA 2Y7DA 5HA7A 1TYGA 5JH2A 5KINA 3L4VA 4ZVJA 4N0RA 3GB6A 2OZ0A 3PZ9A 3ARTA 4KBXA 1RW9A 1AZ1A 3LCFA 3QKEA 4GI9A 5C0QA 4GWEA 2WVTA 1LT7A 3K1DA 3GG0A 2ODOA 1VKFA 5I00A 2D0GA 4N4PA 2V3FA 2JIWA 4NAEA 3CV7A 1PIGA 2NUXA 1VZWA 4J9JA 2BLEA 3SZ8A 2RKXA 3UPMA 1W9XA 3A4WA 3V18A 1F8MA 4Q6XA 3KTXA 1C9DA 1GZGA 4XZIA 3OZPA 1SFTA 4V1YA 2P76A 4WUIA 1HVQA 3NQ6A 3ERPA 3GK0A 4NIRA 1OQFA 3UY8A 3TW9A 7PTDA 1F61A 1OG0A 2VURA 3ABZA 3UWEA 3MMUA 1KBLA 1Q6FA 1ELSA 1P1XA 1F3TA 1HMWA 4QTGA 1V3MA 5F4SA 3G6LA 1RQEA 1SJBA 1UA3A 5G2WA 1WZKA 4O12A 2MUCA 4RW5A 2PU1A 4DWSD 4UFIA 2XSBA 3MI3A 2BTMA 3W85A 5AHLA 3S5NA 2OVLA 5BYWA 2B7OA 4MB5A 2CLLA 1OFBA 1UP0A 4L9XA 2RJGA 5KZDA 3S83A 1OEPA 4GUHA 4XG1A 4I9JA 3T2PA 3IIZA 3W29A 4GPNA 1QOQA 1LLWA 3NQ8A 2V69A 3EYPA 5D2XA 3GM8A 1OFQA 3PB0A 4GY1A 4UCGA 3U5YA 1UJPA 3EDEA 3GRIA 3H2AA 4B2DD 1RSCA 4F3HA 3KXQA 1UWTA 5HXMA 4MJ2A 9XIAA 3H21A 2R24A 1KD0A 3N4FA 2XDFA 2AOSA 3JU2A 4JTFA 3IVUA 2VXNA 4C6DA 5DF0A 4JQ3A 4EWJA 5DO8A 3P6LA 1IXOA 1KA9F 4LYRA 3N2TA 1J0YA 1VEOA 3UWWA 2HXTA 2ZE3A 1YTEA 3DDMA 1Q7ZA 2GGGA 1NFGA 1U2YA 1XLJA 2W4XA 1J2WA 3UU0A 1VHCA 2OEJA 3ZVHA 1YYAA 1V79A 3NPUA 2BXZA 3GVVA 4N7QA 2HNHA 3FFSA 3EDDA 3LM7A 2YZ5A 3COTA 1PZ1A 3BVJA 4C1KA 5FAJA 3RO8A 1A5SA 4YNGA 3MCNA 2NV1A 3VNYA 2JEQA 5D9OA 3QY7A 3BJSA 3VC5A 1A4LA 4IHCA 1R2RA 1L0PA 4BI7A 5EY5A 1LLZA 4ZZ9A 3QRHA 4MB3A 1XLCA 1EOKA 5DANA 1VRXA 3HTWA 3E2RA 2E5CA 4CN4A 1PE1A 3A22A 3EDFA 1R3YA 5DMNA 3QY8A 3RX4A 1GYLA 4DLMA 3EB4A 1XG3A 3GH5A 2A3LA 5B7ZA 1F07A 3NIYA 2Y88A 1BXCA 3OODA 3ITXA 4P5UA 3EB3A 1E9IA 1JYVA 3PPHA 1V3LA 3ZJ8A 3UCDA 1YTKA 1FWEC 3OZOA 2PI6A 2WO5A 1W9UA 3HJZA 3G77A 3W7RA 2ZVIA 3BCJA 1Q66A 1WQ5A 2FTPA 4HPNA 3K13A 1RWAA 1VBRA 1XGDA 1OY0A 5DY3A 4G9PA 1UD2A 4DPQA 3WNOA 3PB2A 4IIHA 4P7NA 4IX2A 1XWYA 3AU2A 2P3ZA 3S6DA 4RNHA 3MI2A 1MXDA 1CWYA 2QCMA 3ARVA 3W6YA 2J7HA 2D2OA 4DBEA 3M5ZA 2YFNA 3SGGA 1KV8A 1P7TA 2FYMA 2YIHA 3IIPA 1MUMA 2PGWA 3W75A 4Z42C 3T09A 4Y8FA 2Z24A 3RF9A 1A0EA 3IK4A 5H8PA 2WANA 3CL7A 3BW2A 1EOMA 4G1KA 4LAMA 4O19A 4QISA 3N29A 2J9ZA 2NWSA 2YB4A 3OOQA 3NJ3A 3ITOA 4M7SA 4C6FA 1XR2A 4GIAA 4LUYA 5DBTA 5DCEA 2GWNA 1QASA 3MKCA 3MVTA 3LCXA 2UY3A 4GYPC 3CHEA 1KRBC 5CSRA 2Z6IA 3TQ0A 4AZCB 5LYRA 2YOCA 1XSJA 2PCQA 2XZ9A 3PS7A 1FTXA 3UJFA 2H8ZA 2XSXA 4TTUA 4S23A 3WK3A 1TWDA 3PAJA 1J0MA 2D69A 4JTQA 3DOPA 7REQB 2HPIA 1FWNA 3RGTA 3TE9A 2Q02A 3GC2A 2W27A 4DM1A 4WZHA 4Z17A 2Z1XA 2D3LA 1H7WA 1BQCA 4B4HA 2Y62A 2FH6A 1VFHA 2PDYA 3ARUA 4UNKA 5AHNA 3VKDA 1DIKA 3MJMA 1VFMA 4RDVA 4TV6A 1IR1A 1D2KA 2NWRA 5B80A 4WEVX 3W7PA 2XN0A 4ZOBA 5HQMA 1IEVA 3M46A 1Q6RA 5KTLA 1W1B1 4PYSA 3RPDA 2ZZ7A 2PDBA 3VIKA 4ZENA 2GJNA 2HV5A 1SO3A 2DJLA 1E1EA 1F9GA 5ECUA 2W61A 3BZGA 3PZQA 3VGHA 4AIEA 3GHTA 3B8IA 4OUEA 3CAWA 1E15A 3W7GA 4B16A 1NM9A 4MY8A 1AMYA 1KWGA 3SY8A 4KWSA 1PJ9A 2ZUSA 4QEEA 3RFAA 1MEHA 3TX9A 2OT1A 1V3HA 3OBAA 2ZC1A 4D1IA 4U10A 4UC5A 3BAJA 1QOXA 4EPDC 4LCQA 4QJ5B 1WKEA 4DY1A 2ALRA 2P53A 1RBLA 2XFRA 4AC1X 4BFAA 2FHCA 5IRPA 2G4JA 2GZXA 1N2VA 3PBMA 3DERA 4TV5A 4GVHA 1V0NA 4W87A 4XKYA 4YS1A 1E6QM 1FP9A 3EDJA 1NQKA 3JVAA 5KEZA 1BLIA 5HANA 1XLHA 1GKQA 3C2YA 3UZJA 1V6UA 3PSWA 4PTVA 1O5XA 5BW6A 1EDTA 4L64A 3OG2A 2C6QA 4NZFA 2OXNA 1I8QA 3N4EA 3Q45A 1V4YA 4Z2KA 2WVVB 5I2UA 1JUEA 2PDPA 4POCA 3TONA 3LXCA 4LEQA 5BOOA 1PTGA 2CBJA 5HUPA 5DCDA 4MUZA 3SM0A 4EPBC 3APTA 4WDTA 8XIAA 1E9YB 3K4AA 1Q5MA 1J6OA 1TV4A 2QCGA 1O1HA 3ABSA 2CLOA 1PCWA 1ZQ5A 5LIYX 1TUXA 4DRSA 1LM1A 1XIEA 4FNRA 1CT5A 4LU0A 2Y7GA 3WLRA 5FEXA 3RR4A 1VCFA 1H7RA 3BARA 3H4WA 1W9VA 1TE1A 3H12A 1WBHA 3N2MA 3W71A 2BSLA 3KBWA 2GUUA 2YLLA 3JW7A 2ZVRA 4AD4A 3T9PA 2QJGA 2VFFA 1C8QA 1EWDA 4GACA 3M07A 3DECA 4O18A 2E0PA 1KGWA 2DUAA 4QCFA 1QRQA 3RX2A 3G8RA 5I02A 4XIMA 4LUIA 1OD8A 1TPWA 1H0GA 3LRMA 2QJMA 3BV7A 1R9YA 5GVJA 2XFWA 3NXLA 4YXGA 4EACA 5C7HA 3JS3A 1EGMA 2WHKA 3GXIA 4DQWA 2PTZA 2NQ5A 1GNXA 3DFOA 4KPLA 2I5GA 2PGRA 2QUVA 1R85A 2FHBA 2VX5A 3VKCA 5REQA 3FJLA 1H7OA 1AQ0A 1UKSA 1RCOB 2PWHA 5HINA 4E2BA 1MYRA 3DENA 1OG6A 1DVJA 3A4JA 3O6YX 4PODA 2NLIA 2ZUWA 4PL2A 1LLOA 4AG0A 4BI6A 3ANVA 1KKOA 2GGIA 2V3GA 4KFPA 4YVPA 4KRUA 4LEFA 1ISZA 1X8CA 5I3GA 2VVNA 1S5TA 3CH0A 1J96A 5A1AA 3WMBA 1TX2A 1JCMP 3LEPA 4HHPA 2XG9A 4BWLC 4BS0A 3ZLHA 2RHGA 3AHYA 1AJ0A 1NJJA 2C1IA 4JTIA 4L6DA 4FR1A 3WFZA 4PUDA 1VP5A 3FV9A 3WH6A 3AJ7A 2EPKX 2VFHA 4FAMA 1W1TA 1P0KA 4MJ4A 1WDRA 2HK1A 3LN3A 2BNJA 3RMEA 3IIVA 4UOZA 1B57A 3NZQA 3PM6A 2AAMA 1SW3A 1DXFA 3LGGA 3G0XA 4HNLA 3FJ4A 2A2IA 1OJNA 1T6MA 1B3ZA 1QK2A 4S2BA 1ZJIA 2INEA 4ZQCA 1ZUAX 1P0EA 2J27A 2NVDA 4A2SA 1UQYA 2G37A 2A6NA 4K39A 1XD1A 3SSJA 2O9PA 2QDDA 3E1F1 4IJCA 1NDVA 3AXMA 4KEVA 2J7BA 1A5OC 3V0UA 1Q4WA 1MW1A 3GIQA 3P60A 3LBCA 3VABA 3BOFA 1L2QA 2D2GA 3I3DA 1SYTA 2AKMA 1QPQA 1O95A 1LQ0A 1W32A 2WW5A 3WQPA 3TSMA 1GZJA 2QT3A 2YA0A 3KW3A 3ONCA 4ZXOA 5HPCA 1VFLA 4ZB5A 4CQ8A 1A50A 4NXSA 1PXGA 3JZUA 1V6VA 2Z28A 4MVAA 2WHLA 2OJPA 1KFKA 3UA3A 4DIAA 3UZ5A 1DWHM 4F8XA 4YTTA 3H55A 5FIPA 5E6ZA 3BCFA 5GNXA 4AY8A 4I7VA 4F2UA 4PEKA 1JZ7A 3DFTA 4S2CA 2Y1HA 3K5XA 1ZBWA 5I06A 3WUEA 1S1RA 3O16A 1KRMA 2SFPA 1TWSA 1UBSA 4NRRA 3VOJA 3TSBA 1TZ9A 3FJ6A 4QQ3A 1R0MA 3QSTA 1JXJA 1F7BA 3QHNA 1KQYA 3AIUA 2PDKA 1V03A 1JCNA 4LUJA 1GVIA 2ZFAA 2ZX8A 3NOEA 4M51A 3O0FA 1MEIA 4JHMA 2QULA 1XDMA 1FKWA 2PDIA 3FS2A 3TN5A 9CGTA 2PF8A 1QO5A 3NTYA 3UG4A 1WA3A 1X97A 1KM1A 2PPGA 3HZ3A 5EKYA 3EZ4A 2VEGA 2HVOA 2VRQA 3CL6A 2X1IA 1Z9AA 4L56A 3MO7A 4HHMA 2QPUA 2INZA 2Y7EA 4ZA0A 3KBSA 1YMYA 4DVOA 5AZ0A 1NTHA 3VNMA 3RAOA 3VMOA 4RJEA 1ZFJA 3GBEA 3SJ3A 1XM3A 2I16A 2O7SA 3GG1A 3IJQA 3M0IA 1ITUA 3HPZA 5C2GA 4KF1A 4AZGA 4KEUA 1DWIM 1M03A 1OFDA 2CFFA 3M47A 4XSLA 5I78A 1B54A 2Q8LA 4OVXA 1AZ2A 1FCQA 2E5BA 1OK4A 1F3EA 4HMCA 3V75A 5I0DA 3FAXA 2O9RA 1ADDA 5A8PA 4LANA 2J7GA 5A69A 2QUNA 4ICNA 4E5TA 1GUVA 2VCAA 3GVGA 4GQRA 4O4WA 4B15A 1DJQA 5JIPA 4LX4A 4PFMA 2PDGA 4RZ6A 2DIKA 4QSHA 5JQ9A 3LCGA 3BG9A 4R33A 5B7YA 3LLXA 1MUCA 4UZSA 2GGHA 4OTKA 2B7NA 2ISSA 4NZCA 3MWAA 4MM1A 3VM7A 3W7CA 3KP0A 4WSJA 3BTNA 4L65A 3T44A 1GQNA 2JGQA 5BXTA 3M7WA 1QHPA 4AY1A 1P6CA 1TTJA 3TYZA 2WC3A 2HE8A 4FR6A 2WAGA 4K1GA 3B9AA 2PB1A 1IE7C 3IGHX 3WLHA 3QR3A 5A2CA 4X0NA 1Z69A 3L4TA 1TJPA 4N9EA 4YTQA 3W07A 3GO2A 5F4XA 3N11A 4UFMA 1WZLA 2EO7A 5A8GA 1LBMA 3GZAA 1XF0A 1I9CB 4CCEA 1OABA 3BQ5A 2YXOA 3QYSA 1HJXA 3U6WA 1OGBA 4CQDA 4PCSA 4AWEA 2BP1A 2F2HA 3G5EA