4D6JA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 2 blood group a-tetrasaccharide (e558a x01 mutant)
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
586
structure length
586
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTASYWIWANDIENKAADYLKVSAKNGGYFIWAEQNVGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 215
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6jA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6jA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6jA02
1VBUA 1GOMA 4M24A 4CGTA 4MAVA 2XHYA 1BG9A 3JUGA 5A1AA 1C8YA 2YL9A 4MB5A 1OIMA 2F8QA 3WFLA 2ZUSA 1UR9A 1OT2A 3PN8A 2BHUA 3NDYA 4AZ5A 2VMFA 2VR4A 4PN2A 5I5RA 2YL6A 1U33A 3QGVA 2ZXDA 1I1WA 3SCUA 4HTYA 4W8AA 1UD4A 5M5DA 3MUZ1 3GH7A 4HMCA 4W7WA 4KRTA 2PF0A 3BAWA 2XIIA 3PTKA 2GJRA 1HJQA 5E0CA 1E70M 1QVBA 2CEQA 1PPIA 3ZJKA 2J74A 1BLIA 5E70A 5A6LA 5A2AA 2OWXA 4UFMA 2X2YA 4RL3A 2BY2A 3VIKA 3CUGA 4B9ZA 3AIEA 4HMDA 2ZX9A 4J3SA 2EO7A 1GUVA 3WQVA 1U2YA 3AIRA 3NCOA 4PCSA 2FDMA 1ZBVA 3KEHA 1CLVA 1JAKA 2V5DA 3B9EA 3RDKA 2EBNA 1PX8A 3IAPA 3OLIA 1IT0A 3W53A 1W3HA 5ECUA 4ZXLA 4KH2A 1EDTA 5DF0A 3OB8A 2VZTA 3AHXA 4U33A 2ZX5A 3SUVA 1EDGA 1J0NA 1F4HA 1WKYA 1NH6A 1V6UA 3S6TA 1ZJBA 2X1IA 1Q6EA 4CN4A 1EDQA 2IXUA 4AEFA 4EE9A 3CZ8A 4D6DA 3BAJA 3K8LA 1TVNA 4A3YA 2ZX8A 2WWCA 1NP0A 2VUYA 2W5FA 3AROA 4V27A 2YKKA 3ZSSA 4FF5A 2E24A 4JKKA 4UFJA 5FD0A 3RO8A 1JYVA 4QLLA 1CTNA 5I79A 2G3MA 2XSAA 4F79A 1JDAA 2FH8A 3T0BA 4NI3A 5A6AA 1RWCA 2CYGA 4MJ4A 3QR3A 1WDPA 4D71A 3CHCA 1UHVA 1GORA 2GUYA 2VRKA 1QNRA 1MQRA 3CZLA 2EPKX 1WZKA 2DT0A 1TA3A 2WMGA 4H2CA 1QNQA 3VM5A 4JFVA 3ARSA 4Q22A 1UA3A 2ZUUA 1V6XA 2VQUA 4JFTA 4PSRA 4BZYA 5A69A 1XH1A 4AMCA 2NT1A 4BQ4A 4GPNA 3VMPA 4HA4A 1LF1A 1SMDA 2Y5EA 2D0FA 1FH9A 2E9BA 2WK2A 3UG3A 1E15A 1E4IA 1E6ZA 3T2OA 3ZR5A 4Z2JA 3ARYA 2ZUNA 2VR5A 2WDAA 2OSXA 1EHNA 2GDVA 3FY1A 4UCFA 1VAHA 4M80A 4UQEA 3FXYA 1R8LA 1Q6CA 1W1YA 5A95A 1QPKA 5A6MA 4N0RA 1JAEA 5JBDA 2G3NA 3VOCA 1J10A 1UWQA 5LA2A 2VX6A 3THDA 1EGUA 4AWEA 3UETA 1HM2A 4CN1A 1W32A 1WPCA 2DDXA 4MTVA 5DT5A 5JUVA 4BQ3A 2BVYA 3WBAA 2W67A 5D8ZA 6A3HA 1CENA 3ARQA 2YL5A 4M8UA 4W86A 3IJ9A 2NT0A 1JIBA 2O9TA 3MUY1 1OB0A 4AZHA 1XCWA 2JEQA 3BLKA 2A3HA 4ZXOA 1NWTA 5BXRA 2X03A 3WH8A 4EK7A 2XVPA 3MMWA 4WIWA 3ZMRA 3T2QA 3MS8A 1M03A 3OLDA 2PC8A 2WMIA 1I1XA 5D9MA 2NW0A 1KQYA 2Y8VA 3AXXA 1E6NA 2WSPA 3QHOA 4Z2GA 1RWHA 3TP4A 5C8BB 1K9FA 1N7OA 1E55A 4H04A 4HP5A 1XH2A 4CD6A 1JNEA 4R27A 4MB3A 2W63A 2XPKA 4J3VA 4IUGA 5AC4A 5CLWA 1HJUA 3PZOA 1H0GA 3M6DA 3TOPA 1C3FA 3KE0A 5GNZA 1H5VA 5CPSA 3WNPA 1BF2A 4BF7A 2WVVB 4AIOA 1X1JA 1X6NA 4MAZA 1Z32X 3SCSA 3MKKA 1G0CA 1W9VA 1HN0A 3U57A 2XM2A 3AHVA 2QV4A 3K46A 4WKHA 1LLOA 1W3YA 2OSYA 3AIQA 4LX4A 1J18A 1K9TA 5FL0A 1WCGA 2WCOA 1JFHA 4BQ2A 2E40A 2AOSA 3U7BA 3WH9A 1N7RA 1JZ3A 2C0HA 3HMCA 5JIPA 4NRSA 1W9UA 5A6SA 2X0HA 3AIBA 1XYZA 4HPGA 1E43A 1OJOA 1CXKA 1QI2A 3T09A 3J7HA 1SR0A 4JCLA 1E6PA 4ACZA 1MWOA 4TTUA 3BAKA 4YN5A 1MYRA 2PBGA 3L2MA 1HMUA 2YA2A 3CLWA 3AYSA 1DWIM 3WQ4A 4LXFA 3GXDA 4C7GA 5BYWA 4CCDA 4QFUA 2Q8XA 1UQZA 4UQBA 5BXPA 3NYDA 5CSUA 4PTMA 1UA7A 2J8FA 5I0DA 1SMAA 2J25A 4PCTA 3NIYA 1LWJA 2C8NA 3WDRA 4B3LA 1E0WA 4J7RA 2V3EA 4U31A 1ZU8A 3PZIA 1ZJAA 4WK9A 4CD7A 1V6WA 3L4YA 3RM9A 1BVNP 2ZX6A 4JKMA 3OIHA 5DEZA 4AD4A 2DT1A 3PZ9A 2BRWA 2D0HA 4FK9A 1HXJA 2OYKA 2CBIA 1A3HA 4CD5A 3T0AA 3ECQA 3MUAA 5HBFA 3ZM8A 1HP5A 2VTFA 1N7NA 3WMBA 1NOUA 1GJUA 2XJ7A 2ZUWA 1UWRA 2X09A 3SCQA 2BY0A 3T08A 3WH7A 1C82A 8A3HA 2RGMA 5EFDA 4IPNB 4UFIA 3F4VA 2D3NA 2YJQA 2WCSA 1MXDA 4UFHA 2GFTA 3BSHA 2W62A 3FW6A 2WC3A 5I77A 1O7AA 1OT1A 3ZT6A 1W1VA 4MADA 3VGHA 1QBBA 4GI8A 2VCBA 4MDOA 1ISXA 1RWGA 4JHZA 2VRJA 2WW5A 4UZSA 1GOIA 2XWDA 4CCCA 1W9PA 1CB8A 4NZCA 3CZKA 4PMXA 3RPMA 5A8QA 2EQDA 2BV9A 1UD6A 5A3HA 1UG6A 2E4TA 2WNWA 4UQCA 1OJNA 1KB3A 2O9RA 1B31A 2G3IA 1W9DM 4YHEA 1NWSA 3UG4A 3WENA 4UOJA 4WSJA 1W3JA 4OOUA 1U30A 3TTOA 1WB0A 1AQMA 3VX0A 3M07A 3ARVA 3WUEA 3ZJ8A 2XWEA 2GDUA 4DM2A 5IFPA 3N18A 1JF5A 4EKJA 1HJXA 2AAAA 2Y4SA 2BNJA 1OINA 4AXNA 3THCA 5A8PA 1OD0A 1W2PA 2DSZA 2G3JA 3SURA 1J12A 5CG0A 1UR0A 1VRXA 3AMCA 1GVIA 4AISA 2BHZA 1V3MA 1XSJA 4BS0A 1KR0A 1E0VA 1BG4A 4MNKA 3WNOA 1X1IA 4TOQA 1HL9A 1L0PA 1J0KA 4JFUA 4HMEA 1OD8A 3RIKA 1WP6A 1AQ0A 3BH4A 4JL2A 4Q7NA 3PZUA 2A3AA 3UR8A 1XHGA 3GYCA 5IXEA 2XG9A 2CITA 2PWFA 5BWFA 3W26A 3WNMA 5FKYA 3SCNA 4W5ZA 2DIJA 3AIVA 1TG7A 3GNOA 3AS3A 2BY3A 4XZWA 3GTNA 3CMJA 3O6AA 4FLRA 1FFQA 1MW2A 3B9AA 4V2XA 3I3DA 2VOTA 1HJWA 4W87A 3WEMA 4ATDA 3WY1A 1QI5A 2JALA 4MDPA 1VENA 2YDSA 3QOKA 4H7VA 2J47A 1RD6A 1B9ZA 2ZWZA 4Z2HA 4HOXA 4FLSA 1XH0A 3AXHA 1SYTA 1DTUA 1GOWA 2ZUTA 2Y24A 4QCFA 4ATLA 3CUFA 2YA0A 4M1RA 3VD9A 4AW7A 1HM3A 3U5UA 2BFGA 1N7PA 5CZKA 3MSDA 4AD1A 4AZCB 1JZ8A 1MXGA 4CU6A 2WC4A 1B30A 1V6YA 1G9HA 1UWUA 3B8SA 3W81A 1E56A 4A3HA 4D6EA 4PMYA 1HKIA 4P7NA 1E6SM 3KL0A 1UKSA 4RE4A 4AD5A 4IISA 3GXMA 2CHOA 5D8WA 5FCZA 2F2HA 3AFBA 1D2KA 1HJVA 1MW1A 1LL6A 4D6HA 1JGIA 1GQIA 3UG5A 4GQRA 2JIEA 3KWXA 3APGA 3ZT7A 1MFVA 3CO4A 3AXIA 1UR4A 1GOQA 2WKGA 4TVUA 1LL4A 3VGDA 1GVYA 5FIPA 4AZIA 3M46A 5BRQA 1NWUA 3EBVA 2X0YA 1E1EA 2V3GA 4UFLA 2UY5A 1RH9A 2DT3A 4C7DA 2XUCA 1VEMA 3RM8A 1RP8A 1TUXA 3ZT5A 2EEXA 3II1A 1FP8A 1O6IA 1H11A 1HMWA 3SCPA 1NWRA 5KEZA 3CZGA 3RJYA 2XVLA 2XFYA 1BYBA 4QP0A 2WZIA 4UR9A 4GZIA 4H8VA 1NP2A 5GPRA 4XZBA 1HKKA 1E4LA 1JYNA 1VIWA 5CXPA 5CPQA 3VGEA 2GK1A 3POHA 3WL0A 1ISWA 3FHAA 3ARTA 5I24A 5M3WA 4E4PA 3UEQA 1NQ6A 2WLYA 2XVNA 9CGTA 3CHDA 4AY1A 2WZHA 1F4AA 1C92A 2EXOA 2YIHA 2UY2A 5D4YA 4QLKA 1LJYA 1FHLA 3N11A 3WQ8A 1CBGA 1JI1A 5CPTA 4PMVA 4X9YA 3AQUA 1TVPA 3W82A 2UWFA 3FN9A 5M17A 4GXPA 1J0JA 3BSGA 2G8ZA 4PEEA 3POCA 5BXTA 2G41A 2XTKA 4U3CA 3W27A 5A2BA 2YBUA 2W4XA 1NM9A 2VZVA 3CHEA 4TVCA 3L4UA 3BCFA 3SCVA 2WVVA 1B90A 5IDIA 3ZSTA 1ZBCA 1W9XA 1UR2A 2W92A 3AIUA 3VIPA 2VRQA 1WDSA 2WMJA 2IXVA 2QLYA 2EJ1A 2J7HA 3GNPA 3VIIA 1HKMA 2DSWA 4OZOA 3PBGA 5DFAA 1CGYA 2QMJA 5A8MA 4U5IA 1C7TA 4GI9A 2D24A 3CZJA 3VD5A 1K6AA 3A4XA 1HN1A 1H3GA 4LYPA 3RCNA 2YOCA 2BRPA 4PTXA 2W91A 1CLXA 1G5AA 3LMYA 1EOMA 4QDMA 1QNOA 1CGXA 1KGXA 5CSYA 3VPLA 3L4ZA 1ISYA 4GQQA 1N82A 2VZOA 2VT0A 5E09A 1OGSA 1CEOA 5JIWA 1X1NA 2J75A 2VC9A 1EQPA 2YBTA 2J4GA 2XSBA 2QMKA 1EXPA 3EYPA 4Y7EA 1K9DA 1YQ2A 3AMLA 5E9AA 1V3LA 4DWSC 2C7FA 3TONA 2FH6A 4CVUA 5HXMA 3MU7A 3EDKA 1RW9A 1M04A 2J62A 1BGAA 3HU7A 4BQ5A 1HF6A 1V02A 1XCXA 3CUIA 1EHAA 4MB1A 5ABEA 1MVYA 3PZMA 3VD3A 1VB9A 4UQDA 1KFWA 4GZEA 1UZ4A 2CHNA 3I3BA 5ABFB 2E8YA 1GQKA 2D2OA 1C7SA 2G4FA 4JZ5A 1PAMA 1V0NA 3TTYA 4OJYA 1DWFM 4PSPA 1KR1A 3DECA 3CBWA 1QOXA 1CWYA 3PZVA 1W9BM 3VDBA 4UOZA 1CXHA 1HNYA 3A3HA 4AD2A 2WVUA 4RE3A 4AD0A 3VDCA 1AMYA 3ZQ9A 1LL7A 1CYGA 4P7RA 2CNCA 2E8ZA 3CZEA 1JDCA 1UYQA 1V0MA 3AHYA 2A3BA 3ZO9A 4LGXA 1UWIA 2JIWA 1UH2A 1KXTA 1YHTA 2D20A 4JIEA 3OA5A 1DWAM 1BAGA 2PWHA 4ML4A 1UKTA 4QCEA 4UOQA 1M53A 4UNIA 4D6IA 3VINA 4CN6A 1R85A 1JYXA 2VJXA 1M01A 3SUSA 3VIOA 3W6MA 1GONA 1PIFA 1BYAA 5FOOA 3CGTA 1NARA 3A6OA 3LPOA 3N9KA 3VGGA 1GQLA 1B1YA 4HZ7A 4DUXA 2CXGA 1LG1A 4W88A 1KGUA 4M56A 1E6XM 4JFSA 3U5YA 4D6FA 2JF7A 3MO4A 1X1HA 3WMCA 4DWSA 1XD1A 5EBAA 1QHOA 4GKLA 3WUBA 1GNXA 4AIUA 1L8NA 4HZ6A 4AZ6A 4W8LA 3W0KA 3WDHA 4EANA 5CQ1A 1BTCA 1KGWA 2F61A 3EDJA 5CGTA 4CCEA 2ZXBA 1QBAA 2O9OA 3CTTA 2CPUA 2FGLA 5HDRA 2W66A 1UZ1A 3K1DA 4ACYA 1VEOA 3PTQA 3UERA 1B3YA 1GZJA 3AHZA 2WXDM 4TUFA 3AMKA 3EDDA 2WB5A 4PMRA 1V3HA 3W25A 1LQ0A 1GW1A 1UOKA 3VKKA 1R7OA 1V6VA 3L4VA 3WEOA 3W38A 2CKSA 3A4WA 2WC7A 3GXIA 4LYQA 1E71M 7CGTA 1XRVA 1KXHA 4ZE4A 1KBKA 4OBSA 4HZ8A 4CU7A 1US3A 3BMVA 1MFUA 2TAAA 1B3XA 1CXLA 5AY7A 4D6JA 3MV01 1HKJA 1B3WA 1VFOA 1CGVA 1OIFA 1H49A 2RGLA 1HVQA 5CJ5A 2VX7A 5GNYA 2DPEA 4JCMA 3W24A 2FGZA 1ESWA 1EOKA 2J7BA 1XYFA 4AZCA 3WD4A 2Y8KA 4E8CA 1P6WA 1HP4A 4FLOA 1UD2A 1E72M 3GBDA 2CBVA 4XB3A 1PIGA 2E3ZA 4LPCA 8CGTA 2XGIA 1LXKA 4AD3A 1OSEA 4OBRA 3AI0A 3B9DA 7TAAA 4WKFA 1ZBWA 2BS9A 2GJXB 3KL5A 4KMQA 5A8OA 2B31A 2J8GA 1ZS2A 3WDPP 4BCEA 2VO5A 1GOKA 4W89A 2HVMA 2JE8A 1KQZA 3UESA 2J7DA 4ZE5A 1KBBA 3VGBA 4F9JA 3SUTA 1VFFA 4URIA 2WMFA 3CMGA 4AZGA 3OZPA 3ARZA 2WMIB 4EAMA 2ZUMA 2J78A 3AS2A 1QNPA 4CKQA 2MANA 5EB8A 2UY4A 4M81A 4W8BA 3WIJA 5HOSA 1NOWA 5BROA 1UWTA 1UUQA 2V38A 1WDQA 2OYMA 1JZ6A 1F9GA 3L4TA 2XIBA 3A47A 3VD4A 1OM0A 4P7LA 5C71A 2CBUA 5DT7A 1DEDA 3AS0A 3VIHA 4NRRA 2E9LA 3UCQA 1E4MM 4JAWA 3WUGA 1JL8A 3AMGA 2ZICA 5JBFA 3DYOA 3PZTA 4LQ1A 3GM8A 3WD2A 3TTSA 1QW9A 1EIBA 3K8KA 1C8QA 4HPHA 6CGTA 4GINA 3PZNA 3G6LA 2J79A 3AJ7A 1GOOA 5EFFA 2DIEA 4MNJA 2ZUVA 3ZJ7A 1OCQA 4UFKA 3K4AA 2JFEX 2V3FA 3VMNA 4AC1X 1OWQA 4IPLA 3OLEA 4W93A 1ODZA 4XUYA 1DWHM 3W28A 5KZ6A 3NSXA 3WBEA 4GI6A 2YLAA 3AYRA 4B16A 1ODUA 1Q6FA 2AMGA 5IFTA 1UR8A 3T0DA 4ZEPA 1LXMA 2D1ZA 3MANA 2WVSA 3SCTA 1JD9A 3SUWA 2Z1KA 5ABGA 1E6RA 3BGAA 3OGSA 1DHKA 1DWGM 1FH7A 1GHSA 4ZFMA 1FA2A 2HISA 5E6ZA 3GZAA 1OJMA 3OGVA 1HVXA 2VQTA 3ZR6A 4GO9A 1D7FA 3N04A 2UY3A 4Z2KA 4U2YA 1R7AA 1G01A 4L4PA 4PTVA 4PBGA 2WKLA 1GQJA 3WELA 1CXIA 2WSKA 5E0FA 1JZ5A 1XV8A 4D1IA 3NDZA 3VDAA 1UR1A 2GVYA 3L2LA 1WO2A 1Q6DA 2PWGA 5LYRA 1ZBKA 3QOMA 2PWEA 1JI2A 2DGAA 1RWFA 3WH5A 3DYMA 1TE1A 3RM4A 4WSKA 3CUHA 2D0GA 3F5JA 4P7QA 2YL8A 3OGRA 3E1F1 1Y7VA 1CECA 3FNDA 7A3HA 1BYDA 2ESCA 2WHJA 3CHFA 1UKQA 3OG2A 3RILA 4Z2LA 1EH9A 4HA1A 3PHAA 4R5EA 2WVTA 1GJWA 2VVNA 1V0KA 2JEPA 4MPKA 4RE2A 2OSWA 1UD5A 2W61A 1H0IA 3N12A 4PMNA 3VUPA 4D6CA 2E22A 1ISZA 1V3KA 1GCYA 3SCWA 1NOFA 3VTRA 1J0ZA 4CU8A 3EMCA 4K68A 4J27A 1AQHA 4J3UA 4ATWA 2OWWA 1KXQA 2Y2WA 1X6LA 5A6JA 3WD0A 2BVDA 1FH8A 1IV8A 2DT2A 2E9MA 1BQCA 4S3JA 1JZ7A 3WF2A 2YLLA 3AS1A 1CGWA 2J7CA 3NSMA 3QHNA 2EPMX 2PBOA 2CESA 1JYWA 1H09A 4PMUA 3WEZA 3WF1A 2DEPA 4DM1A 5LA1A 1TCMA 4JHOA 4TVDA 1B3VA 4UQAA 3ALFA 3AZRA 4M82A 2VZSA 5ABFA 2FHBA 1JZ4A 3HN3A 4GZJA 3GBEA 1Q6GA 4QAWA 3DHUA 5I78A 4DWSD 4MJ2A 4P8XA 1JNDA 2EPLX 4PMOA 2ZX7A 1J0MA 4TX6A 1I8QA 1J11A 1VFMA 3VX1A 1V03A 1J01A 4W7UA 3VM7A 2WCAA 1J0YA 4WKAA 4PTWA 2D23A 5I23A 3U7VA 1WDRA 2ZOXA 1LG2A 4MB4A 2WMKA 2EPNA 3WNLA 2WHKA 1JF6A 2A3CA 1CGTA 4C7FA 3F5KA 5A8NA 4UTFA 1UKOA 3ARWA 3D5HA 1M7XA 4IM4A 2VL4A 5A2CA 4P8UA 1W2VA 1HL8A 3WD3A 4H41A 3TTQA 1SFSA 3ARRA 2Q1FA 4J3WA 3W4RA 3SCRA 4CD4A 2VX5A 4OIFA 4W7VA 4CUCA 3IAQA 3WMSA 2ZWYA 2WPGA 1JXKA 4CD8A 1EO7A 3VNYA 1S46A 2ZXQA 3D3AA 2WLZA 4WJXA 1CGUA 3FAXA 3S2CA 4KGLA 5CLTA 1UD3A 3F5LA 2XYLA 4V28A 4PYSA 2VURA 1RPKA 1J0IA 3MV11 4PMDA 3WKZA 2WHLA 3WF0A 3IJ8A 3WDIA 3EDEA 1CXEA 4J3XA 1HX0A 3AHTA 3OBAA 4ZENA 5LA0A 4KWUA 1C93A 3LPFA 1E6QM 1RWAA 1PX3A 4MNMA 1E40A 3WNKA 3EMQA 3I3EA 4LYRA 3N17A 5A6BA 5E6YA 4B3KA 3G6MA 5FL1A 1E9LA 4GIAA 4D72A 2CCRA 2XVKA 3OZOA 4A4AA 1XGZA 4FMVA 3ZJ6A 1XSKA 1BYCA 1W1TA 3W37A 1PZ2A 3BMWA 2YDRA 2E0PA 1WNOA 3SEPA 2JF6A 4Z2IA 5AC5A 1GHRA 3WQWA 4U2ZA 1W3LA 2QPSA 4F9DA 3KL3A 4GO8A 5D9OA 2WZEA 3K4DA 3A4AA 2QF8A 3ALGA 4HOZA 1H2JA 5BXSA 1ISVA 2DSUA 4N42A 2WBKA 2CBJA 2Z1SA 1A47A 1VJSA 2CKRA 2VCAA 1CDGA 1B2YA 1E3ZA 1UH4A 5HPOA 1BGGA 3PZGA 4YHGA 1E5JA 3O2LA 4XV0A 3ARUA 1BSIA 3RJXA 5D9PA 5IHSA 4D1JA 1TFVA 3WN6A 3AISA 5M03A 4H8HA 1WZAA 4S3KA 4X0NA 1LOHA 3SUUA 3BXWA 1E73M 2GJXA 3M7SA 2GK1B 3IJ7A 2BHYA 1MQQA 4OKDA 1HIZA 1UWSA 3AZTA 1ECEA 1V3JA 3PTMA 2DSKA 4YPJA 3WDQA 1R87A 2FHFA 3WUFA 2BVTA 4XX6A 1Q4NX 5GQBA 5GNXA 2DQXA 2D22A 1E1FA 2ZXAA 1G94A 1TZ7A 3VIGA 4AZ7A 4MNLA 2CETA 4OOZA 1OBAA 4NSBA 5AYIA 2WM0A 1QHZA 3ZIZA 3MSGA 4FLQA 4U5KA 2ZE0A 4P8WA 2CERA 1FP9A 2VZUA 1B0IA 2J7EA 2V5CA 2BXYA 1J9YA 3GXFA 1JZ2A 1UKPA 3IK2A 5F7UA 1FHDA 3MUIA 1GPFA 2GSJA 1WZLA 4HU0A 4M29A 4AZBA 2WHMA 1VFUA 5DMYA 1CPUA 2XFFA 3WNNA 1XD0A 4WF7A 2QHAA 3VIJA 4AEEA 3BAYA 1TA3B 1C8XA 1XSIA 4JFWA 1KXVA 2D3LA 1N7QA 1E3XA 5A6KA 3AMDA 1KCKA 1V02E 3VVGA 2FHCA 2YDQA 3AZSA 5EMYA 5I2UA 1PZ3A 2WWDA 2YA1A 3WQ6A 4B15A 1DP0A 1C90A 3L4XA 1ZB5A 4WLCA 1EO5A 1CNVA 2O92A 1WAWA 4UQ9A 2DH2A 3CIVA 1C91A 3DYPA 1BFNA 3NJ3A 4JKLA 1PX4A 1CZ1A 1MW0A 2VI0A 1KWGA 2WMHA 3ZOAA 4H8UA 2XGBA 2V3DA 1VJZA 1KCLA 4DUWA 3BLPX 4TXEA 1V08A 3WL1A 2J7GA 4PMQA 3TA9A 1D3CA 1H1NA 3RMEA 3VU2A 3VD7A 1PEZA 2X8RA 3SIMA 4KRUA 5CGMA 1BPLB 2DSVA 1UQYA 1W3KA 2IUZA 2WAGA 1HT6A 4P8VA 3W6LA 4NF7A 4W5UA 1BVZA 3WQ5A 1US2A 3NUKA 5BRPA 5AYBA 1EA9C 1EGZA 3CPUA 1E5NA 2WANA 2A3EA 3VNZA 1JD7A 2OYLA 3WF3A 1MQPA 1FOBA 5I3DA 4PMZA 1W91A 1JXJA 3KZSA 3VIMA 4F66A 3NSNA 2X05A 2WYSA 1QI3A 3PZQA 1R86A 3DC0A 3O9NA 1JG9A 1RP9A 2CIPA 5I6SA 3GDBA 2GJPA 3VIFA 1QHPA 3N1AA 3N15A 1I75A 2OWCA 4D6GA 3LPPA 3QHMA 1K9EA 1JFXA 1BHGA 1LWHA 1OGGA 1W1PA 3ARXA 1PBGA 4U3AA 3HJEA 2BRVX 1G1YA 2QPUA 4KGJA 3W29A 4HA3A 4BA0A 3N13A 2VVSA 1EQCA 3GH4A 4X0VA 3FAWA 1QW8A 2VCCA 4AYSA 1H4PA 1PJ9A 1JDDA 1WE5A 3GNRA 5A94A 1OJPA 3K8MA 1J0HA 4P7OA 1UH3A 1ITCA 2NSXA 2J7FA 3AICA 3WH6A 4W84A 5DO8A 1CXFA 3VMOA 1CIUA 1IZJA 4F8XA 4UZUA 1MW3A 4OUEA 1FFRA 2J77A 1XC6A 3WF4A 4QLJA 4AIEA 3WFZA 1QI4A 3BCDA 4HOWA 1OGBA 1HJSA 3LPGA 2WCGA 4TX8A 4ACZB 4DWSB 1VEPA 1WZMA 3MMUA 1ZL1A 6TAAA 1AVAA 5A6BD 2VX4A 2BY1A 2DH3A 4TTGA 5D9NA 2O9PA 5ABHA 3GH5A 3ARPA 3FHQA 4B9YA 1QNSA 2ZIDA 4DUVA 1V0LA 3BC9A 3WD1A 4PRWA 1TR1A 3CH9A 3VO0A 1E0XA 3WDJA 2VNCA 5C70A 1F1SA 2EPOA 1VBRA 2XFRA 3EDFA 4L4OA 2PWDA 2XM1A 5JBEA 1IZKA 1QI0A 3VGFA 4E2OA 1VF8A 3IANA 4E8DA 3MMDA 4PUDA 1KWKA 5HNNA 3AOFA 1DWJM 4PUEA 2PB1A 1E4NA 1TMQA 3VDHA 5IHRA 3SCOA 3DHPA 3WSUA 1H41A 3UR7A 3VILA 5TD4A 3AIWA 2OLHA 1UD8A 4W85A 5BCAA 2XVGA 1ITXA 3CUJA 5HPCA 3L4WA 1B3ZA 4JL1A 2WBGA 2PI6A 4J28A 4CVWA 3T2PA 1V3IA 4HU8A 3EMZA 3BAXA 2BXZA 3BAIA 4J3TA 3OLGA
chains in the Genus database with same CATH superfamily
2BB0A 3GZ3A 3KX6A 4LNCA 2XHYA 3VA8A 3QLDA 2HS8A 3W7GA 4MB5A 3BTNA 3A5VA 1OT2A 3EWWA 2F7FA 2BHUA 3VOGA 1M3UA 1NDZA 4ROPA 4PN2A 2AGKA 3QGVA 4DI8A 4QE1A 1TELA 3UA3A 4AQLA 3L23A 1AD1A 2Y7FA 5M5DA 4HMCA 2V2CA 2HEJA 3EPNA 1PTDA 2GQ9A 4S1FA 4GFSA 3LA4A 4KRTA 2PPGA 1SU5A 4IMGA 2C13A 4JDBA 2AKMA 5A2AA 1MEWA 3P3BA 1XICA 4B9ZA 1S5TA 1VRAB 3HO8A 4O54A 2V9DA 3N2OA 1GUVA 3LQGA 2FDMA 3KEHA 4C6BA 3G3DA 1UC5A 4HK5A 3C2FA 1FWAC 5DCBA 1IT0A 3E02A 1W3HA 3FLUA 3KCJA 2D73A 3WYZA 4IGHA 5FJUA 1TV5A 1LZOA 4NILA 3AHXA 4MPQA 3TWBA 2A0NA 3FK4A 4E8GA 3E2VA 2GOKA 2CZEA 1ZJBA 2NX1A 2X1IA 3P80A 4DXXA 1YE6A 4O1FA 2R1MA 4NHVA 1VFSA 4IIBA 3CPGA 3BAJA 3K8LA 4HN8A 1NP0A 1UJPA 4GGHA 4KFNA 4V27A 2YKKA 1WBHA 3ZSSA 3HGOA 1JYVA 1QO2A 5AC6A 4RDWA 2YSWA 2G3MA 4F79A 2MNRA 1M7JA 3LBMA 2YYUA 1A4LA 2V5BA 4O11A 1OZMA 2CYGA 1WDPA 3BDKA 3HURA 3SJNA 4D71A 3DHFA 1QNRA 1OZQA 5CPOA 4YWIA 2YX0A 1KV8A 2DT0A 3SQMA 1TA3A 2WQPA 3TR2A 3ARSA 1LRNA 4JFTA 5T91A 1CB2A 5A69A 3HGJA 1BRLA 3KFTA 3U0HA 1RK6A 3LTPA 3PWIA 5JQ9A 2BX7A 3RNDA 1B4EA 2WK2A 1XDMA 1BXCA 1FHVA 1E6ZA 4Y9AA 2OSXA 4FNQA 4Q4MA 2J88A 4ERGA 3CO8A 3GTXA 1VAHA 1TPH1 1FWSA 4WOZA 1FDZA 3FXYA 1W1YA 4N0RA 1JAEA 3CAQA 4ZA0A 5JBDA 2G3NA 3VOCA 4L9YA 3QPZA 3GDTA 3THDA 4HU4A 4JTEA 3D0CA 3MWCA 1WPCA 3GVWA 2DDXA 4KEVA 2BG5A 5DT5A 2BVYA 5DLCA 3A5FA 3UU0A 1CENA 3ARQA 1M41A 2YL5A 4W86A 3LCLA 1JIBA 3GNDA 1OB0A 2JK2A 4DBDA 1J2BA 2CLPA 3LCXA 2ZZ7A 3UNTA 4WVXA 4A3RA 4GX9A 4EK7A 2VGIA 2XVPA 3MMWA 2EHHA 4YJ5A 5F4SA 3Q37A 5EMLA 3MS8A 1IQ8A 2RHGA 4JY8A 1M03A 3OLDA 1EJSC 3S2NA 2R91A 3T40A 5C7HA 1P0DA 4H9ZA 4DO5A 2RKXA 1R9YA 3NQMA 1PZ1A 4E5TA 3DG6A 2ZZ4A 4QQUA 3G8RA 3UXKA 3CT7A 2WSPA 1DE6A 3H2FA 5C8BB 1E55A 4H04A 4HP5A 4CD6A 2C14A 4R27A 4J3VA 5AC4A 1XBVA 5CLWA 1H0GA 3ABRA 4BF7A 4AIOA 4WY0B 3JW7A 1G0CA 4EXQA 1W9VA 1XUUA 3QF0A 4W9TA 3E0FA 1Z69A 2XM2A 3QMRA 2WSRA 1YXYA 2YCJA 1KBIA 3PFMA 7REQB 4ZTYA 1J18A 4ZOEA 3TAOA 2V30A 2YEPF 3URQA 5IBXC 3DUGA 1Y8BA 3U7BA 1ML1A 1JZ3A 2H8XA 3AIBA 1F6YA 1E43A 4L9XA 3T09A 1BEUA 3GVRA 3J7HA 4JCLA 1WX0A 1DHPA 5D02A 1Y5XA 4ACZA 4TTUA 1KCXA 3BAKA 1MYRA 3PR2A 5H6HA 3F59A 3GHUA 3TOYA 1A0DA 4E3TA 3WBXA 2YA2A 3CLWA 3VC6A 1DWIM 2Y88A 3WLMA 3O16A 4CCDA 1YRRA 3M9YA 3CV7A 4O0KA 1JDFA 3UNDA 4POCA 2J24A 2J25A 3FA5A 1O5KA 5FA5A 3NIYA 3BZGA 2IPFA 4B3LA 2GL5A 3OG3A 1E0WA 1TV8A 2DZWA 3MBFA 4I7UA 2NXHA 4FI4A 2WZMA 4WK9A 1A53A 2H9AA 5DY2A 3RM9A 3TW6A 1BVNP 2ZX6A 4JKMA 3UXAA 4AD4A 2DT1A 3S46A 3CAVA 1Z44A 4KETA 3T0AA 4Q8NA 1YDYA 3CC1A 1JJKA 3IUDA 1N7NA 1NOUA 3HQOA 2ZUWA 3QZ6A 3SCQA 1XX1A 4DPQA 4MWAC 1MEHA 1R9XA 3SGGA 5EFDA 4IPNB 1H7XA 3MUXA 2YJQA 2WCSA 1V4YA 3NQ2A 5IOBA 3RMJA 3QMSA 3FW6A 3GC2A 4FEZA 1O7AA 1W1VA 1A80A 3F1QA 1QBBA 5CC3A 2VCBA 4MDOA 1ISXA 1RWGA 4GA8A 5MKGA 1PO9A 3DH7A 3KRSA 2NSOA 1W9PA 4PA8A 4M7SA 4HIBA 3WK3A 4PCNA 1UD6A 1EYEA 3B97A 1OJNA 3DI0A 1B31A 4AMAA 1AJZA 1NWSA 4S2CA 3BW3A 3VOIA 4UOJA 3VFCA 4ZL1A 4HNTA 2FB2A 1S5NA 3M07A 2AKZA 3ARVA 3WUEA 3SR7A 1IEVA 3C6CA 4YTTA 4DPPA 3REQA 2BASA 1LOQA 4HKPA 1DJWA 1SW0A 1TZZA 4DQWA 5T9CE 5IFPA 2FYMA 1KRCC 4EKJA 3E3HA 2RFGA 3DEQA 3GNNA 1OD0A 3TV8A 3PUDA 1XXXA 2DSZA 2FTYA 3RCYA 4AHQA 5XIMA 1BWKA 1J12A 3NXFA 1VBJA 4IGMA 3PSVA 4IMEA 3NQFA 4RLIA 3OJGA 2BXVA 3B8DA 1GVIA 4C6JA 2E6FA 2BHZA 1V3MA 3W88A 1OF8A 1X1IA 2BGNE 3C0QA 4HZMA 2VHLA 4IWWA 1HL9A 4JFUA 1SJAA 4R7WA 5LIYX 1WP6A 3NYZA 2ZCGA 1YTEA 3GTHA 3GYCA 4MWAA 5LIUX 5BWFA 4PUMA 3W26A 2PEVA 5FF2A 1MSSA 1A5OC 1U5HA 1W1B1 4XZWA 3GTNA 2A21A 4LUTB 4FLRA 4LYKA 1MW2A 4O0QA 1UP0A 4W87A 1UBPC 1QI5A 2JALA 1VENA 1O1HA 4H7VA 3UPBA 1RD6A 3W00A 2V68A 3UD2A 1OADA 4MG4A 2CHRA 2ZWZA 4IFOA 1Z89A 4KWVA 4Z2HA 4FLSA 3V18A 3H54A 1FWJC 2Y24A 4QCFA 3MSRA 4M1RA 3G1XA 5FAJA 2V5JA 1EBGA 1N7PA 1TJ1A 3CWNA 5C9ZA 2WC4A 1UWUA 4ICNA 3E2RA 2ZZ6A 3OHIA 4XIMA 4ZO7A 3NQ8A 1XYMA 4C6EA 4P7NA 3ATZA 4YTQA 2QVHA 4E2VA 3DN5A 1OX6A 1VQTA 3GFYA 3UXDA 4IF2A 4FZIA 4O8AA 3O3RA 3STCA 2F2HA 2QJIA 5LXXA 1D2KA 3C4UA 4JHMA 3TQVA 1QWGA 1LL6A 4D6HA 3ANVA 4GQRA 4R33A 5FF0A 4JQ2A 5HINA 1XG3A 4LH8A 3MCNA 3CO4A 4NT0A 1GOQA 3K1GA 4G7EA 5FIPA 1RSCA 3M46A 2OZ8A 3IJIA 1NWUA 1WDWA 4C5ZA 1XIGA 3GVVA 4HSNA 5G4WA 1OFRA 2V3GA 3R13A 2OOFA 1H7OA 4C7DA 4EAYA 4NI8A 4LANA 3RM8A 2ONEA 1A5UA 1L8PA 4ILSA 1XYCA 3ZT5A 3DG3A 2EEXA 5I07A 3SCPA 5KEZA 2O0TA 2XFYA 4QP0A 2WZIA 4GZIA 4LBRA 3HTWA 1HKKA 2G5WA 3V1HA 1KC7A 1LCOA 2G4JA 1JYNA 3M4HA 2B7PA 2NXGA 3WL0A 1UMLA 9CGTA 3CHDA 1G4TA 3BQ6A 4AY1A 1TQJA 1F4AA 5D33A 1LJYA 4PCPA 5FJJA 5D09A 3WQ8A 1RCOB 4PMVA 4GISA 2XISA 1ZJHA 4RUBA 4EWJA 1TPEA 1VZWA 2DU2A 2G96A 4ERIA 1TJRA 2W4XA 1NM9A 1EEPA 3VZZA 4JTUA 1CLKA 3BCFA 3H7UA 3SCVA 4GQGA 3MHUA 2PDKA 1ZBCA 1W9XA 3GG1A 1OYBA 1US0A 2VZKD 3MQTA 2WMJA 5I3IA 5KMYA 2I14A 3TNBA 1O66A 4B5SA 2J7HA 1O4UA 2A1YA 3IIXA 1XLAA 3GNPA 3KHDA 5LKYA 2YB1A 1HKMA 3TCEA 5DFAA 4U5IA 5DMMA 4GI9A 5G4HC 1SO6A 2HCVA 2CLLA 3VD5A 4CQDA 1K6AA 3A4XA 4WJEA 3W7RA 2YOCA 2GZXA 2W91A 1KM3A 1K3UA 1CLXA 3PF3A 4AB4A 1RD5A 3STEA 5REQB 4QDMA 3R0UA 4X22A 3W1UA 3BK0A 1U83A 3VPLA 3WBWA 3L4ZA 2RUSA 1TB3A 4JEJA 1N82A 2VT0A 1WXJA 2TSYA 2VC9A 1PWMA 4XD5A 2OZ0A 2UZ9A 3OO2A 1AZ2A 1EXPA 3H4GA 5C2XA 5F2MA 1JCNA 4IP7A 1V3LA 2OTDA 1VR6A 3MU7A 3GDRA 4RNHA 1EP2A 4BQ5A 2IMRA 1PKLA 3W1RA 3KTXA 2RH9A 1V02A 3PS7A 1XCXA 3CUIA 1ZGDA 4GZEA 1EJUC 1UZ4A 4GCAA 4H19A 4JS3A 1GQKA 4O1EA 1C7SA 2VEGA 4OJYA 4C6OA 1H63A 2QEZA 4Q4OA 1XIMA 1QOXA 5F2IA 1CWYA 3PZVA 5B7ZA 3ZVIA 3B03A 1F9CA 1HNYA 3BLIA 1CW2A 4AD2A 3BOLA 4NL1A 4ECLA 3ZQ9A 4Q8TA 4P7RA 1VH7A 2AL1A 2XH2A 2PDQA 2CNCA 2E8ZA 1KTNA 3IIZA 4LGXA 2JIWA 3NTYA 3N3MA 4H4IA 4JIEA 4GYPC 4I8YA 1XQKA 3M64A 4GUJA 4IJRA 4NJJA 4UNIA 4D6IA 9XIAA 1R85A 2XH0A 4D8LA 4PULA 1JYXA 2VJXA 1M01A 1AZ1A 3SUSA 2DZPA 1NIUA 5IM51 2R8WA 3GHTA 1F07A 3M0LA 3CGTA 1TX0A 1NARA 3A6OA 1GQLA 2IPWA 2ZA3A 2W0UA 1Q7MA 1B1YA 4QISA 3RLHA 1KGUA 3WJWA 6XIMA 1RR2A 4GVIA 3RYSA 1TX2A 3C2VA 4DIAA 2VFGA 3GS6A 4LNYA 3VE9A 1X1HA 3ABQA 5AZ0A 3CQ0A 4OT7A 4GKLA 1GNXA 1L8NA 3GVGA 3W0KA 1BTCA 2GGGA 1EIXA 3QR8A 3VDGA 2REQA 5HDRA 1TMHA 2QV5A 3PTQA 4IFKA 4NKCA 3TSBA 4D8AA 1B3YA 1GZJA 3AHZA 2PDGA 1DXFA 3AMKA 1ONXA 3EDDA 4PMRA 3OTRA 1Z7AA 3VKKA 1GTEA 3WEOA 5LHFA 3BV4A 3W38A 4N6FA 1S2CA 2VP8A 4XBSA 1FWCC 1X6UA 2NV1A 1KKOA 3GG7A 4CU7A 3NG3A 4IMAA 1FTXA 1W3TA 2G97A 4DNHA 1B3XA 4D6JA 2XH4A 1X39A 4QX4A 4DUOA 4RV3A 3VZYA 2C91A 4UTWC 1CGVA 1FWIC 2X41A 3HPFA 5DRIA 5GNYA 1MUCA 1PIIA 4CNNA 2ZADA 1IWAA 2Y8KA 5HATA 1M5WA 1HP4A 4XZMX 1UD2A 3S2LA 1XLFA 2EKGA 4HNUA 4GYPA 4HU3A 1HQTA 2IQ0A 3GXNA 4GD0A 4CQBA 8CGTA 1LQAA 5AYYA 1OSEA 2X2GA 3O05A 1R30A 7TAAA 4WHBA 4AY8A 5BOOA 1EZ2A 2B31A 1ZS2A 2FPYA 3WDPP 4IIDA 4NASA 1KQZA 3H4XA 2QJMA 3G1HA 1YIXA 3SUTA 3I4KA 4URIA 4US5A 2ZUMA 1GGOA 4G1NA 3F4CA 1F76A 4CKQA 4MFEA 4W8BA 2I1OA 4XIAA 1WDQA 5K2ZA 4M3PA 1F9GA 3A47A 1OM0A 4P7LA 2CBUA 3VIHA 4XWUA 2EAWA 4JAWA 3GE7A 4UNLA 4TU1A 3DX5A 5CC6A 3URBA 4PMJA 1XYBA 4LAUA 4B5TA 3WD2A 4I9JA 4UBPC 1EIBA 4HNOA 1B3OA 1KBLA 4AFYA 3G6LA 1GOOA 1H1YA 3R10A 2ZUVA 4DJED 4B5XA 1S2WA 3K4AA 2JFEX 3DKLA 3N19B 3VMNA 3MI3A 3C3NA 4W93A 2Y7EA 1AL7A 1ODZA 1DWHM 1Q2SA 1W0MA 3NSXA 4UTWA 3HIJA 4GI6A 1H60A 2C1HA 3TROA 4A2RA 1F3XA 5IFTA 3VE7A 1LXMA 2D1ZA 4IUOA 2ADAA 1OYAA 3MANA 4L6DA 2FPTA 3UY8A 3BGAA 2OGYA 3V0TA 3WQCA 2VYOA 1V7YA 1DWGM 4PBFA 3TXZA 1E1CA 1TV3A 1PB0A 3GZAA 5CSRA 4GO9A 3VKJA 4U2YA 1HKVA 1LBLA 1XBYA 4PH6A 3XIMA 3CXOA 2WKLA 5I3JA 3WELA 3H4WA 5EKYA 1FRBA 3WLPA 1Q6DA 1QWKA 3ITXA 4BY3A 5LYRA 3QQ1A 1ZBKA 3QOMA 2PWEA 2B7QA 2DGAA 2WQDA 3NL6A 1C9DA 1TPVA 1R3YA 5T9BG 3OGRA 3E1F1 1OFDA 4ZQNA 1UKQA 4Z2LA 4GI4A 4IHCA 2A5HA 2OODA 1XLLA 4FOUA 2R1KA 4MPKA 4RE2A 4H9XA 4A8RA 3N12A 3V7PA 1JCTA 1XLCA 2P10A 1ISZA 3PWAA 4ZQOA 2E1DA 1J0ZA 1RVKA 2OFJA 1RY8A 1KXQA 2Y2WA 4ZR8A 1UZDA 1Q6QA 3WMLA 1DIKA 1JCXA 5A6JA 2QCDB 5AN7A 3W22A 4R53A 1FH8A 4S3JA 1JZ7A 3LGGA 1SW3A 2YLLA 1SO3A 5BMXA 3N2MA 1PV8A 5CJMA 3TC3A 2PBOA 3RR4A 3S9IA 4Q8MA 1H09A 1TYGA 3WF1A 4O50A 1B3VA 3ALFA 3AZRA 4M82A 3R0DA 1EJ7L 3GBEA 4I7VA 5I78A 6XIAA 3M5XA 4MJ2A 2J9ZA 1Q2RA 3C2YA 1I2OA 2ZX7A 4TX6A 1V03A 4XAZA 4PE8A 2B7NA 4A8LA 4PTWA 3W70A 1FHUA 4F0HA 4ZBCA 3PJXA 4IQLA 1XRSA 2WMKA 4HPJA 4C7FA 2TRSA 3DKJA 5A8NA 2I56A 3UVAA 5LSMA 1DJIA 3HMJG 4I5XA 1XBZA 3IRSA 3W07A 3L0KA 3FJLA 4IM4A 1I6NA 1H7WA 1JPHA 2Y7DA 3OVRA 3OZMA 4OE7A 4P8UA 4IGSA 2EKCA 1HL8A 1SFSA 2Q1FA 5L9FA 4GX8A 3W4RA 2C6QA 3NAVA 2VX5A 4JBRA 3T8QA 6PTDA 4BWLC 3NQVA 3OBEA 1EO7A 3VNYA 3SGUA 4FOJA 2ZRWA 1CGUA 3M41A 2ACRA 1KM6A 3F5LA 3P81A 1LOSA 3LHUA 1XJBA 2VURA 1RPKA 2ZC8A 4C6FA 4ZGYA 4EP8C 5DXYA 3IJ8A 2V8ZA 4QSHA 4C1KA 4GC4A 4HYVA 2C71A 1HX0A 4CEXC 1SZFA 4KWUA 1E6QM 4MNMA 4NVTA 3QQWA 5A6BA 5E6YA 4G1KA 4B3KA 2ODOA 3BURA 5FL1A 4ONVA 3LY0A 1E9LA 5BWAA 5G2WA 3GSMA 1ZCOA 2C1GA 4ZZ9A 2Z2AA 1QT1A 3HQNA 3IIVA 2ISSA 2QKFA 2PCEA 1FDJA 3QPYA 3I6RA 1EA0A 2R9RA 1O94A 4L4MA 2E0PA 3SEPA 1S2VA 1FBAA 1GHRA 2QUNA 3E2SA 2ZZ2A 1W3LA 3PPGA 4GYJA 1PDYA 4H9VA 3K13A 3ALGA 3MSYA 1H2JA 5T26A 3DENA 4AEOA 2HTMA 2VCAA 3JZUA 4S38A 2PTDA 5HPOA 4YIWA 4DYEA 3BO9A 3RJXA 5GJPA 5IHSA 1DKWA 2OQLA 2NQJA 1BD0A 1GK8A 3L68A 4KWWA 3C3UA 4ES4A 2GK1B 4JIRA 1FCQA 3KVLA 1DIDA 4DAIA 5BW6A 3L9CA 1UWSA 2ISDA 1R87A 4K39A 1VYSX 2J27A 3SRHA 5GNXA 1EJXC 2D22A 1E1FA 3GC5A 3VIGA 2A4AA 1TWZA 4GNVA 4AZ7A 1X7FA 3W74A 1EPXA 3APYA 4NSBA 5AYIA 3ZIZA 3T1GA 2CLKA 3LUTA 3FOKA 3E38A 4DRSA 1F3TA 1FP9A 2VZUA 4P5UA 1B0IA 2Z26A 2AQWA 2V5CA 4XD3A 3VNKA 2ZZ5A 1FCBA 3H12A 5IDZA 1KFEA 3IK2A 1FHDA 1LTDA 4FXJA 1KTCA 2ISWA 1WZLA 3BGJA 4JD4A 1VFUA 3CWHA 1HG3A 1PUDA 3WNNA 2YCKX 4WF7A 3NO1A 1MDRA 3CV2A 4AF0B 4N7QA 4AEEA 3BAYA 5JH1A 2I9UA 1ADDA 3HBLA 4IOTA 1KCKA 4BI6A 3HM7A 1KFJA 3VVGA 2DY3A 1RZMA 5EMYA 1PZ3A 3W76A 4CQAA 1F5ZA 3FDKA 1XDJA 1Z42A 1DP0A 1C90A 4WLCA 1EO5A 1TWWA 1BSLA 3JS3A 4QJ5B 3GK0A 1WAWA 4AG0A 1C91A 3RUBL 4LUTA 1MW0A 2VI0A 4D8OA 2WMHA 3GRIA 3W1QA 4B5WA 2Q8LA 2POZA 3EXTA 3F7JA 2BOGX 1DOSA 4IIEA 3BLPX 1IWBA 4TXEA 1D3CA 1G67A 2R1PA 5EU9A 3I6EA 2J9XA 2X8RA 3KM8A 4EIVA 4LAZA 4RE0A 3SIMA 5HMFA 2QCLA 1RQEA 3P6LA 3B40A 4AX7A 4TQTA 4P8VA 3W6LA 2QCCA 4L1GA 5AYBA 2PODA 3EA1A 1YKWA 3C56A 1S2TA 3S6OA 2GGIA 1W91A 3T55A 3S1WA 5CGQA 1ZAJA 3PZQA 1R86A 5BMWA 3W1TA 3WLQA 3DC0A 1RP9A 1M7PA 5I6SA 3SAZA 2FZBA 2VGBA 3THAA 5K9CA 1FWFC 1OEPA 1GVOA 3N1AA 3PANA 3W86A 2HZGA 5D2WA 2OWCA 1JFXA 1PXGA 2Z1XA 4C1LA 3ARXA 4GH1A 4PB4A 1PBGA 1FUYA 2HK0A 4GUIA 4U3AA 3V36A 3RRAA 4BEUA 3W29A 3N13A 2VVSA 1W54A 2NZLA 4X0VA 4ASTA 1XLMA 2VCCA 5AYXA 4PUUA 4AYSA 1H4PA 3WLLA 3GNRA 2VENA 3DG7A 1RV8A 3CAKA 2J7FA 2Q3RA 1XLJA 2IKHA 1TREA 4H7ZA 1I0DA 4F8XA 1X8CA 2J77A 3M0HA 4BI7A 3WF4A 3PG9A 4HOWA 1OGBA 2QUTA 2XH7A 3LPGA 7TIMA 3H7VA 3LB0A 1AVAA 2QIIA 4L65A 1LLWA 3URNA 2WNNA 5ABHA 3FHQA 4HTBA 3N2CA 1I4NA 1DIEA 5HNTA 1TR1A 3S1XA 3QV7A 2D2HA 2WJFA 4K7YA 5C70A 1H61A 1VBRA 3K2GA 4OV9A 3S3GA 2XM1A 3FFSA 1IZKA 4E2OA 4E8DA 3LBOA 5LNRA 1Q7ZA 3KS5A 3SJ3A 3BOXA 4NU7A 1SJCA 3ZWSA 4I9MA 1E4NA 3I6TA 1DQUA 3DHPA 1FWEC 1AW5A 3TZNA 5HQMA 3AIWA 1UD8A 3QPEA 1K8ZA 2PI6A 4DO6A 5FAGA 2V67A 4K37A 4A29A 4PUNA 1GZ1A 4OGZA 2BXZA 3BAIA 4LWWA 3A23A 3W73A 3OLGA 5REQA 3O06A 4J4KA 2OEJA 1OCNA 4QE5A 2PWUA 3ZFHA 2E1WA 4Y90A 5FEPA 4Q7BA 1HUVA 2PZ0A 3WFLA 3H22A 4QROA 4C1NB 2F6XA 3UW6A 5I00A 1TPC1 2RJGA 3S0CA 5I5RA 4IQEA 8TIMA 1KFKA 4Q4KA 4K7VA 4A6GA 3GH7A 3D47A 3V5FA 1TTIA 3EGJA 4Q4PA 2PF0A 2XIIA 3PTKA 1A3XA 2GJRA 4J2PA 1QVBA 2TODA 4JDYA 3A3XA 2J74A 1BLIA 5E70A 1HGYA 4NJGA 4RL3A 2BY2A 1VRDA 5C0QA 4XD6A 4HMDA 5LXEA 2ZX9A 3AIRA 2P0IA 3A64A 1NAL1 2V5DA 3RDKA 3W53A 2CZVA 3KBWA 3G77A 4WOQA 3M7WA 4KH2A 4WRHA 4ZQMA 3OB8A 1ME8A 3TIMA 1ZZMA 4OUIA 3A12A 1WKYA 1TMLA 1NH6A 5HWMA 1V6UA 3S6TA 4OVXA 1NTHA 5F2GA 2IXUA 1U22A 1R2TA 4EE9A 3CZ8A 3SECA 1TVNA 2WOQA 3FSTA 2QZRA 2YBVA 4Y9PA 4QJ4B 4IX0A 5FD0A 4QLLA 4RW5A 3LSBA 3MKVA 2XSAA 1OX5A 5FJRA 1Q4WA 1OFEA 1E9IA 5LNSA 1J93A 4B2DA 5A6AA 3TSMA 1RWCA 3W7LA 4MJ4A 1ME7A 3QR3A 3CHCA 1UHVA 2GUYA 5DMNA 1DPMA 2VRKA 1MQRA 3I10A 2EPKX 3BG3A 1YDOA 5JU6A 3VM5A 3OQ8A 4Q22A 2C79A 3NGFA 4O4WA 4X3ZA 4NJIA 4QBXA 2BBFA 4GPNA 1GYNA 1XYLA 2YR1A 3LNMA 2DZVA 4HA4A 5DBUA 2OJPA 3W7OA 2E9BA 2XIQA 3UG3A 5DCDA 3ZR5A 3ARYA 2ZUNA 3BLOA 2GYIA 1L2QA 2WDAA 2QJNA 4PCFA 2GDVA 1F8MA 4DYKA 1IHIA 4M80A 4N9DA 3EXSA 4UQEA 4FR6A 4LJ3A 3PUOA 3EX2A 1YXDA 4YTRA 4E38A 1J10A 4NYUA 1YYAA 3A3WA 3FVMA 5U7SA 3CU2A 4AWEA 4CQCA 4CN1A 1W32A 2VR2A 1O68A 4Q6XA 4BQ3A 1AK5A 1VBGA 2W67A 5AC7A 2HV5A 1AA1B 4AWTA 1X96A 4M8UA 2NT0A 2O9TA 4MZYA 2DJLA 4IL2A 3QY7A 2PLJA 1XCWA 5HA7A 3T44A 2JEQA 3B8VA 5HMEA 3UZJA 3SZ8A 1NWTA 5BXRA 1YBQB 3OU8A 3G1AA 3BPWA 3G0SA 4LVGA 4MY8A 5I03A 5KTLA 3TFCA 1A5MC 4G56A 3ITLA 5C2CA 1I1XA 3IK4A 4LALA 5D9MA 2PMQA 4Z0JA 2NW0A 1KQYA 1I2RA 1E6NA 4MWAD 3QHOA 4Z2GA 1RWHA 3TP4A 1K9FA 2I7GA 1N7OA 4GY0A 2CZFA 4GOAA 4M6VA 2OZTA 4R7JA 3WK2A 2PTZA 4ZTXA 3BUVA 3UWYA 4S3AA 3M6DA 4UC5A 1C3FA 1H5VA 5CPSA 1O1ZA 1BF2A 2WVVB 4GJIA 5G5IA 2HK1A 3MKKA 1UUMA 3FCPA 2Q6ZA 1XQLA 1FKWA 3IJDA 2OSYA 3IT4B 2OCZA 3LM7A 3RU8X 1MUWA 1WCGA 1JFHA 4BQ2A 4K36A 1NSJA 1N7RA 4HVXA 4FAMA 3FVDA 5JIPA 1W9UA 5A6SA 1ME9A 1QI2A 2Q01A 1E6PA 1J4EA 5XINA 1MWOA 1EF3A 5H1WA 2PCQA 3N6JA 1YPIA 3L12A 3V35A 3L2MA 4PEKA 1HMUA 3VABA 4AC7C 3WQ4A 2QCNA 1KM0A 1HW6A 4C7GA 5BYWA 3DI1A 4C6QA 3NGJA 5BXPA 4PTMA 5K7JA 5I0DA 3KBTC 3V3WA 2KXSA 1WOAA 2DQWA 2VDHA 4PCTA 4MKNA 2ZQ0A 3H21A 2V3EA 4U31A 1H62A 4S3EA 1ZU8A 3BG5A 3PZIA 3LERA 1OFPA 4ZB0A 3N9SA 4HGXA 5DEZA 3GR8A 2A6LA 2PGFA 1HXJA 3SRFA 3N3TA 1YPFA 2CBIA 1A3HA 3MUAA 3IEBA 3Q94A 3TU9A 3WMBA 3LM3A 4NIRA 3WLKX 1QATA 3M0KA 3T08A 5LGXA 1C82A 3UA4A 2RGMA 2P3EA 4UFIA 2RAGA 3F4VA 2GWNA 3IUIA 2OQYA 3WBYA 4UFHA 1AW1A 3BJTA 1KO0A 2PD9A 3ITOA 4JN8A 4RDYA 1SM9A 3W2JA 1OT1A 3ZT6A 3PPCA 3GB6A 4A05A 1H50A 4LB3A 4G7FA 4UZSA 1Y65A 3TMLA 4U28A 2YEPB 4NZCA 3RPMA 3CZKA 2DW7A 3LCGA 2BV9A 4PODA 2HBVA 4PTDA 4K8EA 2Y61A 1UG6A 2E4TA 3GY1A 3T8LA 4BEQA 1KB3A 4BKNA 4M0XA 1ZENA 1W9DM 2QCDA 5A6TC 5LGZA 3L5MA 4HQVA 3NPWA 4S2BA 4WSJA 2Y6ZA 1JPMA 4OOUA 5C6MA 4WQ6A 3MVIA 3MHGA 4L6HA 3OYZA 4IXHA 2GDUA 4DM2A 2AAAA 2Y4SA 1OX4A 3NQEA 3S5ZA 1H5YA 1OINA 4GJ1A 3K5XA 1W2PA 3NEVA 4MGGA 1XKJA 3R12A 4F0RA 3CM4A 1VRXA 3UWVA 4S3CA 4WGXA 4BS0A 1E0VA 3L0NA 4TOQA 1FCVA 4F40A 1VLWA 4HMEA 1GVQA 4Z08A 2HPMA 3N4EA 4MZ1A 1OD8A 2G95A 2V5KA 1AQ0A 4JL2A 2P88A 3S9ZA 3F4NA 3W1PA 3WNMA 4A2SA 1ADOA 3AIVA 3AS3A 3VKAA 1NF0A 4C5YA 1EEXA 3CMJA 2PU1A 2PS2A 4JN6A 4HNVA 3MP5A 4HA0A 1LLZA 1N7KA 3WY1A 1K03A 3P74A 4MDPA 2YDSA 1DYSA 3QOKA 5KETA 4XVDA 2PC4A 5HJLA 1R3TA 3W7HA 1ZSXA 4WUIA 4WDWA 1SYTA 4O1AA 5HNRA 4ATLA 3CUFA 3VD9A 5LIWX 4AW7A 1HM3A 2CWXA 5CZKA 4WJ8A 1W56A 1O5XA 4AZCB 4CU6A 5I06A 4EX4A 4RDVA 4RNJA 3GC4A 3LV6A 4M6PA 1HKIA 3UCDA 2FTWA 4RE4A 3TW7A 4GH3A 1AH0A 2Z2UA 5HJYA 3AFBA 5EY5A 3KRUA 3UG5A 2JIEA 4DNMA 4NAFB 3GAYA 1UR4A 2WKGA 3VGDA 4AZIA 1GVYA 2R1LA 3DFYA 3QXBA 4YLWA 3TJ4A 3EPMA 3EWXA 2UY5A 2DT3A 3QTPA 5G4EA 1RP8A 1W1ZA 3OIXA 1Q7QA 2PDPA 4DF1A 1NWRA 1ONEA 1FCUA 2XVLA 3PM6A 2XDFA 1JCJA 2PD5A 4EVZA 4H8VA 5HQLA 5CBBA 4LOCA 4JEQA 5GPRA 2CWNA 4XZBA 1FWRA 1E4LA 1K7EA 5CXPA 1RBOB 1UIOA 5CPQA 2AL2B 4H7CA 2GK1A 1C9WA 1ISWA 2VC7A 3FHAA 5HUPA 4A8IA 1YXCA 1UBSA 3UEQA 1NQ6A 3WQEA 2XVNA 4J9JA 2WZHA 2EXOA 1PVNA 3G1VA 1S5WA 1CBGA 1JI1A 3STPA 5CPTA 4X9YA 3WO8A 2P5NA 1L6YA 2R82A 1RJRA 5M17A 4YVVA 1SW7A 2G8ZA 4PEEA 3DBPA 3BLDA 4Q8OA 3M0MA 2HDJA 4FXFA 3W27A 3LX9A 2P0OA 2VEIA 2VZVA 1XLHA 1FXPA 1K8YA 4V15A 3VOJA 1QNVA 3F03K 1B90A 4KBXA 3NA8A 3U4FA 4E4UA 2W92A 2VRQA 3S2MA 2IXVA 4F0MA 2EJ1A 4Z0SA 3EWZA 3IJQA 2ICSA 5CJNA 2DSWA 4OZOA 1IT7A 3VNJA 5FACA 2D24A 4Y96A 2ZE3A 3CZJA 4RXFA 5C9UA 1RAKA 4GRSA 3GFXA 2XU2A 4DJEA 1G5AA 1SFTA 3P84A 3BOFA 3KLLA 1EOMA 1K8CA 4LTSA 4Z1YA 3O6YX 4I9AA 4HCHA 2Z00A 1ISYA 4I90A 5E09A 4JTAA 1EQPA 1XG4A 4MLRA 4R88A 3UR5A 4X60A 1MMFA 4Y7EA 1K9DA 4U4MA 1YDNA 4DELA 1YQ2A 2CLOA 1N8FA 4LVAA 1T41A 3ITVA 4Q33A 2PU0A 1F7BA 3TONA 3QR0A 3HG4A 1YTKA 4NNBA 1M04A 3LHVA 3ELFA 5ABTA 1BGAA 1F3WA 2DORA 1HF6A 3VNMA 3HF3A 2FIQA 2WO5A 2G0WA 4MB1A 5ABEA 3PZMA 2FFCA 1H7RA 2C0AA 2WV8A 4MHBA 2CHNA 3R5EA 5ABFB 1IXPA 4F0SA 2G4FA 5FEXA 4FNUA 3W7QA 1DWFM 1KR1A 1UMYA 1N8WA 1W9BM 3GLCA 4B92A 3HGRA 2OX1A 3QV8A 1ITUA 4L6OA 4DO7A 4RE3A 1TTJA 3VDCA 4HB7A 2BOEX 1AMYA 1J8VA 1CYGA 2QUVA 1Q66A 4O14A 3B06A 3EB2A 1UYQA 1V0MA 3UJEA 3ZO9A 1LOLA 1KXTA 1YHTA 4ZODA 3U6WA 1S5MA 1ECQA 1EX1A 4ML4A 3MZNA 1UKTA 4HYRA 2PUZA 3VINA 3CIXA 3PBYA 3VIOA 2PDUA 4PZVA 3WJYA 1OC6A 3MT1A 1JR1A 5FOOA 3NPVA 3W1AA 3N9KA 2Z2BA 1J79A 2CXGA 1LG1A 4W88A 3GFZA 3OOQA 1PS9A 1E6XM 4Z42C 4GUFA 1EP1A 2ZTKA 3W75A 3EEGA 1JPIA 2W79A 4AIUA 4HZ6A 3WDHA 2IW0A 3KP1A 5CGTA 5FF7A 3UGVA 4DBUA 2I9EA 2GLKA 4NQ1A 3NZPA 3CTTA 1WKFA 2CPUA 1UZ1A 3IVUA 3ZVHB 4MLJA 1MO0A 2WXDM 3KVMA 4XZLX 4OECA 5CAKA 2WB5A 1V3HA 4LC8A 4GC3A 3OP2A 3MB9A 3WJZA 2NWRA 1R7OA 1V6VA 3L4VA 4HJWA 4Q8WA 4AVFA 2CKSA 3A4WA 1Z8AA 3MJMA 1E71M 1SPQA 1XRVA 4RCXA 2C19A 1GG0A 4XAGA 4ZE4A 3W7MA 3BMVA 5JMUA 4JNYA 2AAMA 3MV01 3NURA 4HBKA 1VFOA 1OIFA 4KWOA 1U5VA 4INFA 2VX7A 3T7VA 3O8AA 2FGZA 1EOKA 3SBFA 1XYFA 1ENUA 3WD4A 3P67A 4E8CA 3TSDA 4FLOA 1E72M 2FTPA 3GBDA 4XB3A 1EPVA 2F6KA 2XGIA 4ZOBA 3C86A 3V16A 3CYVA 1ZBWA 2BS9A 6TIMA 4IIFA 1K1DA 3KL5A 3EX1A 3MKCA 5A8OA 4BCEA 5TNVA 2HVMA 2SFPA 3UESA 3OA3A 3TZFA 4F9JA 4E6MA 4JTLA 1VFFA 4NJHA 3OZPA 2X30A 3AS2A 4UTTC 1W5QA 2JBMA 5EB8A 1WQ5A 2GQ8A 4L1WA 4ROQA 2WJZA 3WIJA 5HOSA 3EKLA 1UUQA 5I02A 1QASA 1B5TA 1EGVA 1JZ6A 3L4TA 4O53A 5AHIA 5C71A 1ZP4A 1KTBA 3AS0A 3NL2A 4NRRA 1ONRA 1QTWA 1E4MM 2CFFA 3WUGA 3AMGA 3MP4A 1VIZA 1G4EA 1XLEA 4GACA 3PZTA 4LQ1A 1RA0A 1T8QA 3EX6A 3GM8A 3N4AA 3TTSA 2HNEA 3GIQA 4HPHA 3DFPA 3PZNA 2Z1WA 3OVPA 2OG9A 2KZHA 5XIAA 2QS8A 5EFFA 1WKDA 3ZJ7A 4A3QA 2ISVA 4UFKA 2V3FA 3BLEA 3EOOA 5LZLA 1OWQA 4IPLA 1Z6KA 4XZ9A 3G18A 4DZ5A 2RDTA 3AU2A 3WBEA 1TV2A 4GKTA 2YLAA 3MDWA 1ODUA 4E2DA 3TTEA 1B57A 1VCVA 2O7QA 1XW8A 1JD9A 4QS5A 3SUWA 5ABGA 4DY1A 3OGSA 3QY6A 3RR1A 1G6CA 1IEXA 1GHSA 1FH7A 5JXQA 2NX3A 1IXNA 5E6ZA 2HISA 1OJMA 3MTWA 1FWTA 4Z1CA 1HVXA 5CEWA 3TYDA 3ZR6A 1IF2A 2UY3A 5G2IA 4Z2KA 1O5RA 4PTVA 1NFGA 3W7EA 5E0FA 1OCJA 3FX4A 3UWQA 3QJAA 3NDZA 1XR2A 2GVYA 3TMQA 1DJXA 4GE8A 4S39A 3ZLGA 2PWGA 3DFSA 2TPSA 3H55A 1Q63A 4R85A 3DXIA 1JI2A 5FSEC 1AW2A 3WH5A 4UTTA 1I2PA 4M7TA 1TE1A 3IS4A 1J6OA 3KVJA 4IQDA 4WSKA 3F5JA 2YL8A 3IGHX 7A3HA 2V5LA 3FNDA 4UTKA 4FOKA 3OG2A 4HA1A 3PHAA 4R5EA 4YVPA 2P3ZA 3C0SA 2WVTA 5JH2A 1P0EA 3ZWTA 3DC8A 4ORIA 2JEPA 3E0IA 1H0IA 2QQ6A 3S1VA 4BJHA 1L2UA 2X0SA 3E6EA 2DVTA 2Y0FA 5G1YA 4CU8A 1TV7A 4K68A 4J27A 2QNEA 4ATWA 4DBWA 2OWWA 1QDSA 1X6LA 2BVDA 4ZOCA 2E9MA 1BQCA 3Q58A 1EB3A 3WF2A 2DZTA 1G7UA 3AS1A 3ZXWA 3NSMA 4CNPA 4OQVA 1W37A 3P5ZA 3RGTA 1JYWA 1LDCA 4JOMA 4PMUA 5LA1A 3HPXA 1TCMA 4TVDA 1Q6OA 2VZSA 1BWLA 3HN3A 5A8GA 1Q6GA 4QAWA 2PGRA 3N2TA 1K7XA 2EPLX 1YBQA 1FX6A 1J0MA 5ENLA 3DFHA 3HZ3A 4PUKA 4W7UA 3DU0A 1WA3A 1J0YA 4WKAA 3RX4A 2D23A 5CBJA 2W6RA 5I23A 3P60A 2V63A 5CPLA 2Y1HA 4G5DA 3U3HA 1S3TC 1DTNA 2PRHA 2DZBA 4UTMA 3PUGA 4CNSA 1GT8A 3CWOX 4J40A 1H7NA 4UTFA 1UKOA 3ARWA 4L1XA 1W6TA 4PBEA 4JGDA 5A2CA 5I7GA 2Y62A 3TTQA 1HFBA 3ARRA 4ZQPA 1R3QA 4WX2A 2Q09A 2QCMA 2RDXA 4W7VA 2D2JA 3HG2A 3IAQA 2ZWYA 1JXKA 3N2BA 3SQSA 4O15A 3MYOA 3B0VC 1F6KA 3R8RA 2P8BA 2ZDSA 4KGLA 4LEQA 3ITYA 4PYSA 4L56A 3FGCA 3MV11 4R34A 2WHLA 3W2UA 2YGYA 3WDIA 3EDEA 3G8EA 3PPFA 4IXXA 3AHTA 3OBAA 4GQBA 1C93A 3PJUA 3R89A 1PX3A 1V79A 1EJRC 3WNKA 4LYRA 3I3EA 4DLMA 3G6MA 4J1OA 3P82A 3VKCA 4H9TA 4D72A 2CCRA 1XGZA 3FDGA 2HJPA 3B0PA 2UBPC 3IVSA 4HNNA 3ZJ6A 3BMWA 4Z17A 3DBNA 3MZ2A 2PA6A 3R58A 5TBOA 2J6XA 3KL3A 5D9OA 1QXLA 1X7IA 4HOZA 4F2BA 1WUEA 2WBKA 2CBJA 1VJSA 1CDGA 1XS2A 3U2OA 1B2YA 1E5JA 3FJ6A 3XINA 3ARUA 3PULA 5D9PA 4UUIA 5EMJA 4D1JA 1MXSA 1TFVA 3L5LA 3GUWA 3VI2A 3KCOA 3KW3A 4H8HA 1WZAA 4S3KA 2GJXA 3M7SA 3QQ0A 3P8IA 4UNKA 4LRSA 3AZTA 3WDQA 1GKRA 1JQVA 3QYQA 3MWAA 3NVTA 4ORMA 3KAOA 1N2VA 3IPWA 2QDHA 5I09A 1ZTVA 2ZXAA 1G94A 4K3ZA 1OHLA 1ZLPA 3U2ZA 1PTGA 3UZWA 3Q65A 3H70A 1QHZA 2VC5A 2YZ5A 1IIGA 3GTFA 4ZOAA 4FNSA 4JYFA 1ZHAA 2PURA 4S23A 3TLLA 2NUXA 4XKYB 1TJ2A 4US6A 1UKPA 1JZ2A 3UZXA 3O7UA 1LUCB 1R47A 2PF8A 4JICA 2PP1A 2GSJA 3N29A 4M29A 4AZBA 1N8IA 2WHMA 1RJPA 2FZ9A 5DMYA 1CPUA 1UUOA 3KBJA 2XFFA 3MBDA 1XD0A 5GVJA 2O7SA 3VIJA 2AGTA 3RG6A 1TA3B 1XSIA 2E6DA 4JFWA 1KXVA 1DIOA 1N7QA 3KDNA 5D30A 2YDQA 1PCWA 2YA1A 3PP7A 7ODCA 1BRLB 3UY7A 4B15A 3GIPA 1XI3A 3NQBA 1E0TA 4QG6A 2YCLB 1YPXA 4M19A 3DYPA 4ZQRA 3NJ3A 4XUGA 3KBVA 1GWJA 3ZOAA 4EOUA 2X40A 3R2GA 3GU9A 4H8UA 2XGBA 3PBMA 1VJZA 1HZYA 4KESA 3E74A 1DBTA 2BWGA 3PBVA 2J7GA 1XGDA 4PMQA 2XIJA 4QGCA 4OBTA 3RMEA 1LYXA 1JPKA 3IARA 4RZBA 1BPLB 1DJZA 2WAGA 1D3HA 3R1ZA 4QM1A 4QR6A 4CLMA 3HPAA 2CLHA 3WQ5A 1EA9C 5U4NA 1EGZA 3CPUA 3HQPA 1E5NA 2OEMA 3LGDA 3OHMB 5HUOA 2A3EA 1XP3A 2OYLA 4GCXA 3WF3A 1Z41A 4JX5A 2OKTA 3M0YA 3KZSA 3RPDA 3WQDA 2WYSA 5E1QA 1QI3A 1G69A 4M51A 4RXGA 1WAUA 4KEZA 3O9NA 3PSWA 3LHYA 3GDBA 3MI2A 2GJPA 1T5AA 3VIFA 4NAFA 1HO1A 3W1MA 1A4MA 1BTMA 3B05A 3LPPA 1K9EA 5T8GA 5D2VA 1Q3NA 3S2JA 3BE7A 1EC8A 1W1PA 3MW7A 5H91A 3C2RA 3CJPA 1G1YA 5IBXA 1B54A 2O55A 1FWWA 1JCMP 2QUUA 3PB0A 4HCLA 4DJFD 3GH4A 3FAWA 1OABA 3CB3A 4PRRA 1QW8A 3KCLA 1Y5VA 4PB3A 4LCSA 1OJPA 3LTSA 4JTIA 1G4SA 4FS9A 1JQXA 3WH6A 1AODA 3FJNA 4B2DD 2AL2A 1JCLA 1CX9A 1IZJA 2NX9A 3SDOA 3P2VA 3KBUC 1MW3A 1IXQA 1IE7C 1VYRA 4AIEA 3H8AA 3KXQA 2EPHA 2Y70A 1QI4A 3BCDA 4QE4A 8XIMA 1IWPA 1HJSA 1POJA 3E9AA 3EOSA 2WCGA 3VNLA 2PDBA 4ACZB 2VEKA 1VEPA 1WZMA 1M7OA 1ZL1A 3LRLA 2Q71A 2BY1A 3M6YA 5TIMA 4TTGA 2O9PA 3M5VA 1VGAA 4B9YA 1QNSA 4AVNA 2CZDA 4Q6JA 2ZIDA 2E5BA 2G50A 4DUVA 3RHGA 1A5NC 3BC9A 3WD1A 1CT5A 3CH9A 3VO0A 1YW1A 4F2UA 4L4OA 2XFRA 3EDFA 3SM0A 4QNWA 3VGFA 1VS1A 3IANA 3LCFA 4PUDA 1KWKA 3Q45A 2H9AB 1VHNA 1ICQA 4PUWA 3UXLA 4RW3A 2TYSA 4FP1A 1IT8A 2PB1A 3TXVA 4V1XA 1A5LC 1ONWA 3VDHA 5LHEA 4I9TA 1ICSA 3WSUA 3VILA 5TD4A 2OLHA 1I45A 2XVGA 1QR7A 3UPWA 4YYCA 2WBGA 4CVWA 3N6HA 1V3IA 2BGSA 4WXZA 4HU8A 1JEZA 4JTKA 4LT9A 3T05A 3QH2A 3LHWA 1VBUA 4XO6A 2QT3A 1QPQA 4M24A 5HK4A 5DELA 1IGWA 4PB5A 4CGTA 4MAVA 3WJSA 2DVUA 2IKJA 5MKGB 2OU4A 1OIMA 2F8QA 5HR7A 1UC4A 3R94A 2GJLA 4ZB5A 3UJ2A 4MFDA 3MA8A 4ZO9A 3O6CA 4AZ5A 4CNUA 1VYPX 1UZHA 2VR4A 4DF0A 2YL6A 1U33A 2V4IB 3SCUA 4HTYA 3T4WA 3TJXA 3VK5A 3SFKA 3EWUA 3MCMA 1XBXA 2Q3OA 1UD4A 3TA6A 4NNCA 3HPSA 3MUZ1 2D2GA 1NDYA 3RN6A 3R11A 3DCPA 4GYFA 4R7OA 1HJQA 1E70M 3BICA 2Y85A 3REQB 3TC7A 3M5YA 3S1GA 4RKAA 5A6LA 1RJQA 2OWXA 3CMFA 4UFMA 4NJKA 4UTLA 2X2YA 3VIKA 3CUGA 1YADA 3TCSA 4AHOA 1SZNA 1ZUAX 4TR9A 4GIYA 1FVPA 4ZVJA 4FNTA 3H2OA 3IRDA 3H2NA 4H9MA 1REQA 4M6QA 1S1RA 3B9EA 5KITA 2CW6A 2EBNA 2HE5A 1PX8A 1SUXA 3OLIA 4XSMA 3TUUA 1SJDA 4LAKA 3WLTA 3NQGA 2DZAA 4WCJA 4U33A 3S1UA 3SUVA 1EDGA 3L66A 2OT1A 1XC4A 1VBHA 1J0NA 1KFLA 1KM5A 3MHFA 1F4HA 1YNQA 1QO5A 1ZRQA 3A21A 4CN4A 4FX6M 1EDQA 1EJVC 1XYAA 3P0WA 3M16A 2CZ5A 1XIHA 5RUBA 4A3YA 2ZX8A 2WWCA 2W5FA 3LMZA 2E77A 4H6KA 3UXIA 3L0GA 3C0JA 4B91A 1CTNA 3W84A 3BW4A 5I79A 1JDEA 1R3WA 3LI0A 4ZCWA 4TV5A 4QRNA 5FJTA 3S6DA 3AYVA 3GXPA 2WMGA 1QNQA 4JFVA 1TWSA 1UA3A 2ZUUA 2VGFA 1GG1A 1EUNA 2VQUA 4D8ZA 5DQPA 4AMCA 4GMEA 2R6OA 3QM3A 3W7NA 1BVWA 1SMDA 1FH9A 3BMXA 5FJIA 3C0LA 1E4IA 4Z2JA 4IPPA 1SO5A 4XQ6A 1EHNA 4Z1BA 5FESA 4UCFA 4C60A 4PR4A 4NZJA 3CASA 1ZJIA 4XKMA 2PP0A 5A6MA 1EUAA 2YB4A 1RA5A 5AKQA 4M5PA 5LA2A 1EGUA 3CB8A 3GNXA 1HM2A 3RITA 3SI9A 1ZAIA 4MTVA 5JUVA 3NWRA 3WBAA 3TYCA 6A3HA 4FB7A 3HQ1A 2OQHA 3HOJA 3MUY1 2X1UA 4TIMA 4AZHA 4Q4RA 4JTSA 3PY2A 2GGHA 4ZMGA 3DOPA 3IV8A 4KIEA 4ZXOA 4PGLA 3B0YA 4N02A 1Q13A 2OMAA 2X03A 1L6FA 1FQ0A 2C3ZA 3T2QA 2HSAA 4G2DA 4YTSA 2ABBA 4RZ6A 2VEPA 3AXXA 1TPWA 4Q8PA 4KQNA 4GY1A 3D3FA 5HR6A 2BLEA 3O0FA 2NV2A 1XH2A 2NVCA 1JNEA 4LV4A 1TO3A 4MB3A 1N55A 2XPKA 3OODA 1D9EA 4UR8A 1HJUA 3S42A 1SQ7A 4KT2A 3TOPA 2QAFA 3WNPA 5AYZA 1X1JA 3H26A 1X6NA 4MAZA 1Z32X 3SCSA 3CIWA 3FA4A 1PZ0A 5D04C 4LEFA 3U57A 2QV4A 3K46A 1I60A 4WKHA 1LLOA 1W3YA 3V4BA 4LX4A 3CQIA 1NJJA 2OLAA 1KM4A 1Y5WA 2WCOA 1Y0EA 2AOSA 4KCTA 4AIBA 3WH9A 3QV6A 3HG3A 4NRSA 4BK9A 2X0HA 2FMOA 2KX9A 1CXKA 3G24A 1SR0A 3ITGA 2CU0A 4YN5A 1H1ZA 4JPGA 4LBUA 2ZVIA 1P1MA 3W7DA 4IPIA 4CCZA 3GXDA 1UQZA 5LNVA 1AL8A 3NYDA 3KLKA 5CSUA 5AHMA 2J8FA 1AUSL 4H2HA 1LWJA 1I2QA 5DBTA 4J7RA 2ZC1A 4PFMA 2GGJA 5KZDA 3W23A 2OT0A 4PRTA 4XTIA 4CD7A 1V6WA 3L4YA 1RXOB 1K6WA 2BRWA 4K38A 2D0HA 2HWGA 3LRMA 2OYKA 1FWDC 3A4JA 3FEQA 4CD5A 1NQKA 3ECQA 5HBFA 4GWEA 4O57A 1HP5A 2VTFA 4JIHA 3RLUA 3O07A 4CQ9A 3B9NA 1XM3A 1UWRA 2X09A 3KOZA 2BY0A 2CLEA 2VWTA 1TWDA 1NEYA 3AXKA 2D3NA 4UTIA 2LLEA 3PK7A 3QMTA 4HYWA 5I77A 1RVGA 3NOYA 1XGEA 1GYLA 4GI8A 2X1RA 3NZGA 2VRJA 2ANUA 2WW5A 4JYEA 4UMBA 4CCCA 1VLIA 2VFHA 4A3UA 3F2BA 4XVEA 1CB8A 5A8QA 2EQDA 5H8UA 5A3HA 4UQCA 1RHCA 3CEUA 3SGZA 2O9RA 4K2SA 2G3IA 1HGWA 4GIRA 3GW3A 2IPGA 3WENA 1QRQA 2XN0A 3SB0A 4DHGA 3TTOA 1WB0A 1AQMA 3VX0A 1OG6A 2QR6A 3QR1A 1TR9A 3NZQA 5I3FA 3G22A 3ZJ8A 1NF7A 4I7WA 1Q6LA 2XWEA 4C6IA 2ZRUA 1M65A 5K4XA 2JGQA 1JPDX 1HJXA 1A5CA 3G0UA 1TPDA 2BNJA 1ZPTA 4AXNA 3DFTA 5A8PA 4DZHA 5DN1A 3DERA 2G3JA 4AVOA 2PDYA 1NFPA 5CG0A 1TCDA 4HMNA 3IJ6A 1UR0A 3ORWA 3AMCA 4AISA 4HPXA 1EGMA 1KR0A 1BG4A 5B80A 1R9ZA 2QJHA 2XN2A 4NYYA 2REQB 4O10A 3ERPA 4IFKB 4Q7NA 2DW6A 2A3AA 1GYMA 1XHGA 5IXEA 2XG9A 3EB3A 2VD9A 1XF0A 4RV8A 2NQHA 1TIMA 3SCNA 4O16A 3GNOA 1TG7A 4DLQA 1LORA 1B9BA 4B4FA 3B9AA 1B4KA 1JULA 4V2XA 3I3DA 3VC5A 2VOTA 3WEMA 4ATDA 3PBWA 1Q8JA 2ACUA 2J47A 2GQAA 1B9ZA 4H01A 2QXWA 4QDPA 2GVGA 2R24A 4MMWA 1XH0A 5KSWA 3NVDA 5AOUA 3T9PA 3U5UA 1YE4A 2NUYA 4AD1A 1GJPA 1JZ8A 4MF4A 1MXGA 2A7PA 3MJYA 1V6YA 1G9HA 1PTAA 3H2AA 3SRDA 2PDIA 3B8SA 3CAWA 3LCWA 4A3HA 3WLOA 4D6EA 3KOFA 4PMYA 4L7ZA 3OPSA 3KL0A 4JNMA 1CCWB 2WJDA 3PG8A 2PGWA 2RJHA 2OEKA 1EXBA 2E28A 4O4VA 1KFCA 3CNYA 4EWND 1UB3A 4NZ5A 2VOMA 3ZT7A 2IS7A 1LM1A 3BZJA 4TVUA 1A49A 4WD0A 4LC6A 2GQ3A 4R9XA 5BRQA 1W1IE 3EKGA 1PYMA 2OVLA 4JYDA 4C6NA 3CPRA 4UFLA 3P7YA 3UWUA 2XUCA 3EWDA 4JNZA 4MIMA 5F2LA 3R25A 5FJOA 1P48A 1NP2A 1MI3A 2PTYA 1MZHA 4DI9A 3PB2A 1VIWA 3G1DA 1L6GA 3VGEA 3W1NA 5CPMA 3ARTA 5D2XA 1Z48A 3VFLA 2WLYA 4DJDC 4RPQA 1TPB1 1UCWA 3CH0A 2YIHA 5FEZA 3SIZA 4LF2A 1RCQA 3THQA 3A22A 4NZ3A 1U1UA 3UWWA 1TVPA 3W82A 4QNEA 4DEFA 3W71A 3BSGA 4G8TA 2XTKA 1GTHA 1PWLA 2JKAA 2EJAA 2YBUA 1X38A 5DY3A 5CCZA 4XKYA 1E1CB 9RUBA 1OK6A 3TJIA 5AECA 1GVSA 5MF5A 1F6PA 4TVCA 4DLFA 3L4UA 3GO2A 5H2ZA 1LUCA 2PZNA 3JZEA 3LQLA 4QSFA 4WY0A 4KIRA 1SR9A 5IDIA 2VD8A 4X2RA 3ZSTA 1UR2A 3AIUA 4KKXA 1WDSA 2QLYA 2VEMA 1TPFA 4F48A 7REQA 1RUSA 3UQNA 1W8GA 1L6WA 3VIIA 2L5HA 4R3UA 2E5DA 3PBGA 1NDWA 1TIWA 5DANA 2DUZA 2QCGA 2DJXA 4NZ4A 5CC7A 5KINA 1AH3A 4B90A 4H6EA 1HN1A 3IGUA 5BZAA 1WYIA 4LYPA 2BRPA 4PTXA 3WCZA 3TYBA 1QPOA 3M0VA 3LMYA 3P8JA 2YCLA 4C6CA 3TR9A 1CGXA 3KHJA 1KGXA 4GQ0A 4DYJA 3W7JA 3EEZA 3NZ1A 3CUZA 4GQQA 2VZOA 3N2XA 5EYWA 3DDMA 1OGSA 2I5IA 2Z28A 2H6RA 5JIWA 1X1NA 2J75A 2C18A 5C9RA 3GDKA 2QMKA 3IACA 4OTKA 3GG8A 3PJWA 3AMLA 5BU9A 4K1WA 3NEHA 4HD5A 2C7FA 2FH6A 7XIMA 4KEMA 1OFAA 3ZLHA 4DJDA 1VC4A 1RW9A 3ZYZA 3DESA 4EXBA 2J62A 1TTQA 3HU7A 2HBXA 4FR1A 2IKGA 4O13A 1LT8A 3VD3A 3PFRA 1KFWA 4ICMA 4B5NA 3I3BA 3BG9A 1TPUA 2E8YA 2D2OA 3R6IA 1P0BA 1SSGA 1FWBC 3DECA 4XO7A 5EMKA 1W31A 1KRAC 3VDBA 3MVTA 3A3HA 3ITCA 2VM8A 2WVUA 3NQ7A 4HCDA 4QAIA 4AD0A 4K1GA 4N9BA 1LL7A 4V1YA 1GZGA 4BWLA 1TE6A 2PE4A 3CZEA 3P93A 1EJWC 1UWIA 2JGYA 1VCFA 3E49A 3T81A 2D20A 3BV7A 2PLKA 4JQ3A 3OA5A 3UJRA 1DWAM 3RRXA 2PWHA 3GDMA 5AZ1A 2D69A 2NWSA 4FXRA 3F4WA 4IG2B 4QCEA 3T07A 4UOQA 5FF4A 4CN6A 3MO7A 3AYTA 4MVAA 1XLDA 1XL9A 3W6MA 1TSIA 2FLIA 1GONA 1PIFA 5EMMA 1JVNA 1BYAA 1K4GA 1BXBA 2BGQA 1V6TA