4D6JA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 2 blood group a-tetrasaccharide (e558a x01 mutant)
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
586
structure length
586
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTASYWIWANDIENKAADYLKVSAKNGGYFIWAEQNVGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords GLYCOSIDE HYDROLASE
total genus 215
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6jA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6jA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6jA02
3L4ZA 4D6HA 4PMQA 1W9UA 3WD4A 2D0FA 2XFFA 2DQXA 4E8DA 3T09A 2CIPA 3WNPA 2TAAA 3ARQA 1GQLA 2ZX8A 7TAAA 5ECUA 1DWIM 1V02A 3ECQA 2W5FA 4V2XA 2ZUNA 2J74A 1ZL1A 1ZBVA 5BRPA 1E3ZA 3A47A 4JFSA 2J47A 5E6YA 3SCSA 4XB3A 3B9DA 5DEZA 2JFEX 3K1DA 4J28A 1V3MA 3L4XA 2X03A 1X1JA 1HIZA 4UTFA 3AQUA 2YL8A 4WKFA 4LYRA 4CU6A 3GH7A 3VD5A 5BXSA 1W1YA 3PZQA 2GJRA 2BFGA 1UD4A 3MO4A 3CZGA 4UR9A 2BVYA 2F2HA 2IXUA 3AIEA 5I79A 1DWAM 4H8VA 1ISZA 3ARXA 3QHMA 3O2LA 4PTMA 1FP8A 5AC5A 2VZSA 3G6MA 1TA3A 3DYOA 3DECA 2OSWA 3RMEA 2CKSA 1VJZA 5HOSA 1TVPA 3VX0A 2J4GA 4MDOA 3TOPA 4PMXA 1CNVA 3CLWA 1DWFM 2W61A 4QLLA 3CUHA 4GI8A 1JGIA 3DHPA 2BHZA 5FCZA 2E9MA 3ALGA 2J79A 4L4OA 4UQDA 3SCTA 1PPIA 1KXTA 2UY5A 3PZIA 4HPGA 4WK9A 3WFLA 4C7FA 1MW2A 3VD7A 1GW1A 1XH2A 2CESA 3TP4A 1LXKA 8A3HA 3WDQA 1W9BM 1JFXA 3N17A 2J7CA 3ZM8A 1ZU8A 4HMEA 1QI4A 2WWDA 4P7LA 3JUGA 2XFRA 3FHAA 4OBRA 3T0DA 4JFWA 3VVGA 2WM0A 2WCSA 4KRUA 6A3HA 2XSAA 1E6PA 2ZWZA 2CXGA 2WMGA 1EOMA 1JNEA 1GQIA 2PWDA 4PUDA 2GSJA 4IISA 1TCMA 3OLIA 3I3EA 3ZJ7A 1BYBA 3FAXA 1AQHA 4X0VA 2BRVX 2XVNA 5IXEA 1B31A 3BCFA 1ISYA 2J62A 2PI6A 1G1YA 3GH4A 4BQ5A 1GOIA 3L2LA 3WMCA 5GQBA 2VX6A 1XSIA 1HMUA 1CGYA 2XG9A 2YBUA 4H04A 2BXYA 4ATWA 1UQYA 1HJUA 1QOXA 3AZRA 4E4PA 4CD8A 1V02E 4UQEA 3SCPA 3BCDA 3WQ5A 3WMSA 4PEEA 1IT0A 4AXNA 2YBTA 4P8VA 2D0HA 1QNPA 2ZX5A 1FOBA 1XC6A 3WH6A 3MMUA 4WJXA 1KWGA 3VGEA 4M81A 2GFTA 1K9FA 1X6NA 3WDRA 4B3KA 2OYLA 3OBAA 3WF1A 3CZEA 4X9YA 1KQZA 3LMYA 3T0AA 3OLEA 4KH2A 3LPFA 2VJXA 2O9OA 2WDAA 3CUGA 2BY3A 1UWUA 3VO0A 3WDIA 3S6TA 4TVUA 1V0LA 2XM2A 1CXKA 4LYPA 5D9PA 4DWSD 3ZSSA 2EPOA 3MV11 4PMYA 3MU7A 1E4MM 2W67A 1J0ZA 3RM9A 1E6SM 1PZ2A 1WO2A 4U31A 4JIEA 4ZFMA 2OWWA 5GNZA 1A3HA 3WF3A 1AMYA 5DMYA 3RO8A 3AHXA 4D6DA 2VRJA 3VNZA 1QNQA 5FKYA 2G8ZA 2GJPA 1Z32X 2D3LA 1V03A 2WMJA 2V3FA 2YIHA 1KXVA 5IFPA 5C70A 4M24A 1F9GA 4FMVA 1LL6A 1UKTA 1RPKA 3WH5A 3CUFA 5JUVA 4AMCA 4CVWA 3LPGA 3WH8A 2NT1A 3GM8A 2IXVA 4UFJA 3N04A 4Z2KA 1WZLA 1H0GA 4ZENA 1EQPA 1H41A 5E09A 1B90A 3ARZA 2W91A 4AZ5A 2VZVA 3RIKA 3W81A 1DP0A 5A8QA 3AHZA 5F7UA 2W92A 1B30A 1DHKA 3KL0A 4W8AA 3W82A 3BLPX 3HMCA 1JNDA 2A3EA 5CGMA 5BROA 3CPUA 1ZJAA 5CQ1A 1N7QA 3NDYA 4UQ9A 3BAYA 5C71A 1EGUA 3W27A 4J3UA 5LA1A 3M46A 3PZGA 1LL4A 1J9YA 4LPCA 2VCAA 1B1YA 2DGAA 2G3IA 4XV0A 4NF7A 1IV8A 3ARRA 1PIFA 3ZJ8A 5KZ6A 7A3HA 1F4AA 5A8NA 4OOZA 4CD6A 4PTVA 5I24A 4M80A 2WC3A 3AMGA 3AI0A 1UD5A 4KWUA 2DT0A 2V5CA 1M01A 1L0PA 3RDKA 2EPLX 2VZOA 1YHTA 1R85A 4W84A 1ZBWA 1CGXA 3WDHA 4UOQA 4W89A 3GXMA 2VOTA 1N7RA 5A8PA 4V28A 1VB9A 1H4PA 4BF7A 2VVNA 3EYPA 1XSJA 2DIJA 3LPPA 1OJPA 4JCLA 2PWEA 3VILA 4PMVA 2WHMA 1OJMA 1P6WA 1X1IA 1PEZA 5DT5A 3ARWA 3QHOA 1EH9A 5A6BA 3WDPP 1KGWA 4NSBA 3RJYA 4JL1A 4UFKA 2WVVB 1JFHA 2FHBA 3BAIA 4EKJA 2X2YA 2WMHA 4ZEPA 3CMJA 4JHZA 1H09A 4P8WA 2PB1A 3K8LA 1OJOA 3WQVA 1FH9A 2J8GA 1SMDA 1BAGA 1UYQA 4MNJA 4K68A 4W5ZA 3BLKA 3W4RA 2XJ7A 4M56A 4JCMA 5EFDA 4MNKA 1LWHA 2BVDA 2UWFA 3ZOAA 3WNMA 3WNLA 3OA5A 4OKDA 3ARUA 1WDPA 1C90A 3NSXA 2DH2A 4AZCB 1M04A 2DIEA 2PBOA 2VQUA 1BVNP 1DEDA 4RL3A 1VEPA 1GONA 2CBUA 4HTYA 3VGHA 2WHKA 1LJYA 4D6FA 2QLYA 3BGAA 1B9ZA 1C7TA 2VR5A 1E40A 1TUXA 1EDTA 2XSBA 2E9BA 1BGAA 3WQ8A 3AIVA 3VIMA 3VKKA 3M6DA 4PTWA 1C93A 3AS0A 2VX7A 2DSUA 1CXFA 1UKSA 5EMYA 1ZBCA 1E6NA 1JD7A 1OIMA 4KGJA 1QI3A 1KQYA 1Y7VA 2JF6A 3GNPA 3PN8A 1V6VA 1UH2A 4GPNA 3TTOA 4W7WA 2Y2WA 2V3GA 2GK1A 4GKLA 4S3JA 1WDSA 4DWSA 1NP0A 5E0FA 2WC7A 1I1XA 1PX3A 1HKKA 4WKAA 3F5LA 2J7HA 3T2PA 2WVUA 2XIIA 4J3TA 2ZUUA 1G94A 2YKKA 1E4LA 1V0NA 2QV4A 1JD9A 2D20A 3BH4A 2VCBA 2EQDA 1UR4A 1EGZA 4GXPA 4HU8A 3W26A 3WEOA 1C8QA 3G6LA 1W9XA 3WEMA 2WXDM 1W91A 1LG1A 3VIGA 2O9PA 3EMCA 4U5IA 3PZNA 3MS8A 1E73M 5I6SA 1D2KA 3IJ8A 2XGBA 2WZEA 4M8UA 3NDZA 1JYWA 1ESWA 3WD2A 4AD4A 2WMIA 1CYGA 2CITA 4E2OA 2WBGA 2WCGA 4D6IA 4BQ4A 3CHEA 3L4UA 3WF2A 3MSGA 1CGWA 1BFNA 1W3HA 3QGVA 1PIGA 1CZ1A 3IJ7A 2DPEA 3WUEA 1MYRA 4C7GA 4AIOA 4DM2A 2UY2A 1HVQA 1S46A 1TA3B 2PWFA 1I8QA 1FP9A 2J7BA 1XSKA 2Z1SA 3AMLA 1VEMA 4CCDA 1DWJM 1HJQA 1WDQA 2YOCA 3SCQA 1CEOA 1PAMA 2JIEA 2XGIA 3BAXA 4GO9A 4KMQA 1C8YA 2GVYA 2X8RA 3ZR6A 1ISVA 4RE4A 1JAKA 4QP0A 3POHA 3VD3A 2G3NA 5FIPA 5D8WA 1GHSA 1TZ7A 2YLLA 2ZX7A 4HP5A 1EHNA 5FD0A 4UQAA 5I77A 5M03A 1ODZA 1XYFA 3WMBA 3UEQA 1XGZA 1KFWA 2ZXAA 4AISA 1CXIA 1XH1A 1CXLA 5BXPA 5HDRA 1G0CA 1QNOA 4RE2A 2E8ZA 3EDJA 5I3DA 2ZIDA 5AY7A 1J10A 3NUKA 2CPUA 1UWSA 3THDA 3WN6A 2WPGA 5A95A 2ZUWA 2E9LA 3PZVA 3CH9A 3N9KA 1RH9A 2W62A 4GO8A 1NP2A 1ITXA 4E8CA 1TG7A 3N18A 4Z2HA 5HXMA 3MMWA 4BS0A 3AXHA 1ZS2A 4D71A 1I1WA 1KWKA 4GIAA 3OIHA 2ZUSA 2BRWA 1JXKA 2OLHA 3M07A 1MQQA 1VFMA 4EK7A 1D3CA 1WKYA 5ABFB 2J75A 4MADA 1XH0A 3AMKA 1H0IA 1L8NA 4ML4A 1QHOA 4U2ZA 5A6BD 2FHCA 3K4DA 3VIOA 1HN1A 1WZKA 4WF7A 5A8OA 2ZOXA 3WEZA 2WANA 1KR1A 1GQKA 5LYRA 2WVTA 2A3AA 3VMNA 1E70M 2Z1KA 3U57A 4D6CA 2AMGA 2YL9A 4QCEA 3II1A 3WH7A 4TUFA 4CCCA 1UWTA 1CECA 2JIWA 1JDCA 2EPKX 5CPQA 5BYWA 4TVCA 4HMCA 2VO5A 3I3DA 4HA3A 2OWCA 3W24A 3WUGA 2QMJA 2QMKA 3OGVA 3AIRA 3L4TA 5HPOA 3ZMRA 4P7OA 5FL0A 3GXDA 2VC9A 4KRTA 3ZIZA 5A2BA 1OGSA 3K8MA 4U2YA 3RJXA 4UCFA 2OSXA 3O6AA 4L4PA 1UUQA 2BY1A 4WIWA 3HN3A 4HOXA 2C0HA 3S2CA 2WW5A 1JZ7A 2E22A 1H11A 5KEZA 4PMNA 1X1NA 3WSUA 4LYQA 1JZ5A 4YPJA 1UZ4A 5I23A 1HXJA 4CN1A 1JDDA 2XTKA 3EDEA 4QFUA 3WH9A 3NIYA 3WQWA 4B16A 1Q4NX 4JKMA 4HA4A 1PBGA 2XHYA 4Z2GA 2E24A 1ZBKA 2AOSA 2WZIA 2F8QA 3A4AA 3ZR5A 5A2AA 2CCRA 4CN4A 4BA0A 1KXHA 2XVGA 4W85A 5I5RA 2WNWA 2EPNA 2ZX9A 4AEFA 3KL5A 3NCOA 4MAVA 2J7EA 1VAHA 4GI6A 3W37A 4PMZA 1KBKA 4B3LA 4UFMA 5I0DA 2ZUTA 2X05A 2D24A 5A6JA 1NOUA 1V3LA 4CGTA 5BXTA 2XPKA 1N7OA 5GNYA 4YHGA 1SYTA 2DT1A 3AIQA 1R7AA 2WB5A 2J7GA 1QHZA 1UA3A 4CD4A 1CXHA 2WCAA 1XV8A 4H7VA 1MW0A 3PZUA 3CZKA 2A3CA 3WL1A 3GXIA 5ABFA 2YDQA 4Z2LA 9CGTA 3CBWA 4Z2JA 1G5AA 1W3YA 1E6XM 1DTUA 2VURA 3OZPA 2BHYA 2X1IA 1F1SA 4V27A 4D6JA 1E3XA 3UR7A 3WUBA 2Y8VA 3VDCA 3EDKA 1RP8A 4NZCA 3W53A 3DC0A 5TD4A 4MJ2A 1AQMA 3WNKA 5JIPA 3E1F1 1RWCA 1R7OA 1E72M 5BXRA 1ECEA 4P7QA 2BY0A 1VRXA 4FLSA 2Y5EA 1LL7A 3ZT7A 3AHVA 3O9NA 4QLKA 4OZOA 4F8XA 4DUWA 3SUVA 1BG9A 1GPFA 3EDDA 2VX4A 3AIBA 1NWUA 2PWHA 3WF0A 1SFSA 2QHAA 4AIEA 1C7SA 3ARPA 3CHFA 3VM7A 3A6OA 1AVAA 5HPCA 3WDJA 3MKKA 2DH3A 3VDBA 4W86A 3F4VA 1CIUA 2X0HA 5JBEA 1KR0A 1GOMA 1QBAA 2CETA 3A4WA 4AZ7A 5CZKA 3ZJ6A 1E6QM 2ZUVA 2WKLA 1CXEA 3KEHA 5A69A 4ACYA 1UH3A 2WC4A 1BYCA 1CBGA 1H2JA 1GVIA 1OBAA 1E1EA 2BY2A 3PTKA 4CKQA 1TMQA 2DDXA 4CU8A 3N11A 1VFOA 1QVBA 1MW1A 2PWGA 3IAQA 4ATLA 4BQ3A 4Q7NA 1U33A 2CERA 3VMOA 3UG3A 4TX8A 1UQZA 1RP9A 4MB1A 1W3JA 4BZYA 2F61A 5AYIA 3MUAA 3VIHA 2WMKA 3A3HA 4MTVA 2BNJA 2YA1A 1H1NA 1V0KA 3CUIA 1GOWA 3IAPA 1KGUA 1D7FA 1E55A 1WCGA 2EXOA 2VMFA 1C82A 1ISWA 1IZJA 1JI2A 1ZJBA 3AHTA 4J3VA 1O7AA 1UOKA 5CPSA 1NWTA 3MUIA 4CD5A 2HISA 1N82A 3GNRA 5E0CA 1B2YA 4HOWA 4HZ6A 2YL5A 3AIWA 1V08A 2AAAA 4PRWA 2E40A 1GOKA 1JYNA 1HX0A 1PZ3A 4ZE4A 2D3NA 4AZCA 1OINA 2YA0A 3AYSA 5ABGA 3CZLA 4XZWA 4D72A 3SCNA 3T2QA 1W2PA 4JFVA 4ZE5A 4ACZA 1OM0A 2VQTA 4GQQA 1XYZA 4F9DA 4PMUA 3VDAA 4FK9A 1CGTA 2XVLA 4PYSA 3OB8A 1V3JA 2VZTA 1OGGA 1R86A 3QHNA 3WIJA 2GJXB 3PZOA 4LQ1A 1HJWA 1J18A 1UWQA 3FY1A 1CLVA 1XD1A 2WWCA 4OBSA 3WQ6A 3BSGA 3SCVA 1HM3A 2CBJA 3K4AA 2QPSA 2WYSA 3N12A 1E9LA 1B3ZA 2JEQA 1W32A 3WNOA 2J7DA 3KZSA 4W88A 4MNLA 2GUYA 4A4AA 4UOZA 3APGA 3AS3A 1B3XA 3UETA 4MAZA 1MWOA 1UD3A 1VENA 2WKGA 1RWHA 3ARSA 6TAAA 4J3WA 1BG4A 1JXJA 4AZHA 3N15A 2ZXQA 4FLQA 4AD3A 2G4FA 1QBBA 1UKOA 3SCOA 3F5JA 3VGDA 1JI1A 1BHGA 1OSEA 1KGXA 2YDSA 1W3LA 4XZBA 1VIWA 1W1TA 4J7RA 2FGZA 5I78A 1W3KA 1JG9A 1R8LA 3VX1A 1WDRA 1J0NA 3PZMA 5CXPA 2D22A 1J0KA 1US3A 3VMPA 4AY1A 1RWFA 4MDPA 4GQRA 1BGGA 4W8BA 1NOWA 2WLYA 5CJ5A 1GJUA 1B3WA 2YJQA 4PCTA 2Q8XA 1B0IA 5D4YA 2ZICA 3CGTA 2CBIA 1E56A 5M3WA 3NSMA 3SURA 4AZIA 5A3HA 5A6LA 4GI9A 5A6SA 4AEEA 1US2A 1JAEA 4KGLA 1W1PA 2PF0A 2VZUA 1QW9A 2V3EA 1KB3A 1JZ3A 3L4VA 1RD6A 3MUZ1 3EMZA 3QR3A 4ZXLA 1BSIA 1JDAA 2NW0A 1PX8A 2E3ZA 3FW6A 3W25A 3D3AA 1GOQA 1QNRA 5AC4A 1Q6EA 5A2CA 1ISXA 3EMQA 1QI2A 1KCLA 1J0MA 1QI5A 1WZMA 3DHUA 2DSWA 1WB0A 3GBDA 3GZAA 4JAWA 3D5HA 4NI3A 1V6UA 4LXFA 3W6MA 2VTFA 5A6MA 1UD6A 1VEOA 4AWEA 1UA7A 1CGVA 1QHPA 4YHEA 1BVZA 1NOFA 1GVYA 1J0YA 2YL6A 4DWSC 2VT0A 4GINA 3GH5A 3I3BA 2DSVA 3WD1A 3GYCA 3T2OA 2OSYA 4TOQA 3WBAA 1QW8A 5A1AA 1RWGA 1E4IA 5CPTA 3AIUA 1H49A 4UQCA 1UWRA 4M1RA 2CYGA 2EO7A 4D1JA 1FH7A 2OYMA 3UG4A 4CCEA 4EE9A 1CENA 1MXGA 3EBVA 2WHJA 3SEPA 4N0RA 3VNYA 4HPHA 1UR2A 1WNOA 3FNDA 2ESCA 3MSDA 1CB8A 1ODUA 1GHRA 2XIBA 4W5UA 3CZ8A 3LPOA 3W29A 4Y7EA 1OT2A 3OGRA 5JIWA 2PBGA 3CHDA 4MB3A 4CN6A 2WK2A 4M29A 1V6YA 2WHLA 2BS9A 4WSKA 5D9MA 1HKJA 4HZ8A 2W63A 1JF6A 4DUXA 1C91A 4X0NA 1HM2A 3UESA 1LWJA 4QDMA 2B31A 1FFQA 4W7VA 2RGLA 4AIUA 1K6AA 1KCKA 1BPLB 4NRSA 3WL0A 1CLXA 3OLDA 3AZSA 3TONA 5FL1A 2EEXA 1GORA 4BQ2A 2WCOA 3KE0A 5GNXA 4HOZA 3MV01 2OWXA 5A8MA 3B8SA 2ZXBA 5EFFA 3UG5A 2Y4SA 1BYDA 1HT6A 2BV9A 1SMAA 4S3KA 4AW7A 1TFVA 3WKZA 3BSHA 3BAKA 3AYRA 1H3GA 1MQPA 3VGFA 3RCNA 4D1IA 2IUZA 1BQCA 1MVYA 2QF8A 5DFAA 1BF2A 2E4TA 3TTYA 1V0MA 3WY1A 5FOOA 4UFIA 1GJWA 1V3IA 1EIBA 3AFBA 2W66A 1U30A 1BLIA 4P7NA 3WD0A 4AD5A 4P8XA 3CMGA 2J77A 3ARYA 2G41A 8CGTA 1B3VA 1TE1A 3WENA 3AHYA 1M53A 1IZKA 4JHOA 1GUVA 4D6GA 4JFTA 4FLRA 5A94A 1HP5A 1C92A 4GZJA 1JZ8A 4PUEA 4IUGA 3PTMA 5DO8A 4IPNB 4WLCA 3W28A 4MNMA 1NQ6A 1V6WA 2HVMA 1W9DM 1VFUA 2XVKA 2ZE0A 1E5JA 2CNCA 4CUCA 5IHSA 4OIFA 2XWDA 2WVSA 5LA0A 1W1VA 2J78A 2NSXA 4TTUA 2XM1A 1TVNA 4UZSA 3MMDA 5D9OA 4P8UA 4HU0A 1JIBA 4F79A 1RWAA 1VFFA 2VNCA 5BWFA 1UZ1A 4OUEA 1E1FA 3ZT6A 1JZ2A 1UG6A 4UNIA 1MQRA 1G01A 3BXWA 1UR1A 3TTQA 1XD0A 4JKKA 3MANA 2XVPA 1WZAA 2J25A 1HJXA 1UHVA 4TVDA 3VGGA 2FDMA 5JBFA 4DUVA 4FLOA 1Q6DA 1FA2A 1MFUA 5BCAA 4D6EA 2VI0A 3POCA 1X6LA 1UD8A 1WAWA 1K9TA 1E5NA 1VBUA 4PMDA 3TTSA 4B9YA 2CHNA 1EOKA 2A3HA 3BMWA 4MB4A 2VRQA 2ZX6A 3CZJA 3FXYA 3BAWA 3UERA 5CGTA 4OJYA 3VIJA 3VU2A 4AC1X 5LA2A 3CUJA 3DYPA 1CPUA 3M7SA 3PHAA 4JL2A 4IPLA 3CIVA 4P7RA 2XWEA 1HJSA 2C7FA 1LQ0A 2D2OA 1FH8A 3GXFA 3AMDA 2D23A 3AS1A 3RM8A 4U5KA 4WKHA 2ZWYA 2DSZA 4PSPA 4W8LA 2Y8KA 1HVXA 4UFLA 1CTNA 3WQ4A 1V3KA 4JZ5A 1GCYA 3AXIA 1HKMA 4W93A 1K9EA 1J11A 3SCUA 4MPKA 3KL3A 3B9AA 3SUTA 3AROA 3SCRA 4QCFA 3VD9A 3AMCA 2EBNA 3N1AA 3GBEA 3NSNA 4DWSB 4EANA 4PSRA 4UOJA 4R27A 5E6ZA 5BRQA 3OG2A 1ZB5A 2PC8A 3N13A 2MANA 2O9RA 5E70A 4C7DA 1B3YA 2EPMX 3VM5A 5HBFA 3SUSA 1LF1A 1XRVA 2VL4A 3VIFA 1G9HA 3NYDA 4FF5A 4PMOA 1MFVA 4N42A 5A6KA 3PZ9A 4MB5A 3ZT5A 3AOFA 2VR4A 5CLTA 5EBAA 1DWHM 3OLGA 3WUFA 1XCXA 1H5VA 1UWIA 2Y24A 3U7BA 3OZOA 4H8UA 5DF0A 5C8BB 3FHQA 4PCSA 2ZXDA 1HL9A 5A6AA 2V3DA 1HP4A 2JE8A 5EB8A 2NT0A 4HZ7A 1J01A 5I2UA 4H8HA 1OGBA 2XFYA 1OCQA 3L2MA 3ZJKA 1RW9A 1EDQA 2GDVA 2E0PA 4W87A 2WZHA 2A3BA 4Q22A 3AISA 2DT2A 1V6XA 4J3XA 3ZSTA 3B9EA 1E71M 3CHCA 2CBVA 1W2VA 4CVUA 1W9PA 2WMFA 3WNNA 2J7FA 4B9ZA 3WBEA 2GDUA 1W9VA 2CEQA 1E4NA 4U3CA 4AD1A 2BRPA 4BCEA 3VTRA 2UY4A 4AYSA 4UQBA 1UD2A 1FFRA 3ZQ9A 1NWRA 2FGLA 1C3FA 4ACZB 3VDHA 5CG0A 3U5UA 3T08A 3IJ9A 1J0HA 1E6RA 3HU7A 2O9TA 1O6IA 5D9NA 3VIKA 3AICA 1N7PA 1JZ6A 2RGMA 3IANA 4UZUA 1HJVA 2YDRA 3UR8A 4AD0A 2VX5A 1V3HA 4AZGA 1NWSA 1Q6CA 2GK1B 3VIPA 3L4YA 3BMVA 2ZUMA 1U2YA 3W0KA 1X1HA 2CKRA 1F4HA 3BC9A 1EQCA 2O92A 3FN9A 4EAMA 1A47A 1HNYA 3BAJA 1PJ9A 3GTNA 1GNXA 4PBGA 3GDBA 3KWXA 4XUYA 4OOUA 3U7VA 3SIMA 5CSUA 1MXDA 4AD2A 3SCWA 4TTGA 3HJEA 2YLAA 1UR0A 1J0JA 3TA9A 1PX4A 1EXPA 4NRRA 1QPKA 3U5YA 4A3YA 4AZBA 4DM1A 2WSKA 3K46A 4H41A 4QAWA 3AXXA 1WE5A 1OD8A 1LXMA 4JKLA 4LX4A 4TXEA 5E9AA 2WLZA 4R5EA 3GNOA 3PBGA 1EO7A 1SR0A 4AZ6A 4WSJA 1C8XA 1NARA 5AYBA 5GPRA 1GZJA 4JFUA 2OYKA 5ABHA 2G3JA 4LGXA 2FH8A 5M17A 2D1ZA 1E43A 2WAGA 1GOOA 2D0GA 4HA1A 1JYXA 4UFHA 1OB0A 4HMDA 2VRKA 3AZTA 3L4WA 1KXQA 3F5KA 1E6ZA 2J8FA 1HMWA 4YN5A 2UY3A 1VF8A 5DT7A 1UH4A 3K8KA 4ATDA 4PMRA 1E0XA 3W38A 5HNNA 4CD7A 3WELA 3VD4A 1UR9A 3VPLA 5D8ZA 3THCA 2VVSA 1OJNA 1CDGA 1QI0A 4Z2IA 5M5DA 2JEPA 3NJ3A 1OD0A 2BHUA 2X0YA 2EJ1A 3OGSA 1HL8A 3VINA 7CGTA 1JYVA 4A3HA 1CWYA 1OT1A 2VUYA 3CO4A 5IDIA 4PTXA 1E0VA 4GZEA 4ZXOA 1EDGA 1VBRA 2C8NA 2FH6A 1N7NA 4PN2A 2WVVA 4MJ4A 3T0BA 1CGUA 2YA2A 3AJ7A 3IK2A 3WF4A 3SUWA 3DYMA 1J12A 1K9DA 1KBBA 2V5DA 1Q6GA 4B15A 1XHGA 3VGBA 3SUUA 3QOMA 2XUCA 3FAWA 1Q6FA 3EDFA 1FHLA 5JBDA 4F9JA 4J27A 2WBKA 3VUPA 6CGTA 2XYLA 3WD3A 1NM9A 3AS2A 3UCQA 2WMIB 1XCWA 2VCCA 1VJSA 4U3AA 1LG2A 1FHDA 4QLJA 3ALFA 1UKQA 1OIFA 1UKPA 2FHFA 2BVTA 4W7UA 1M03A 1UR8A 1HN0A 1MW3A 3ARVA 5ABEA 4TX6A 1M7XA 2WSPA 3PTQA 4U33A 3RILA 1J0IA 1BYAA 1YQ2A 2DEPA 2BXZA 1ITCA 1LOHA 3RPMA 3PZTA 1R87A 3RM4A 2DT3A 4H2CA 2W4XA 4IM4A 4XX6A 2GJXA 5CLWA 3ARTA 1TR1A 3QOKA 1E0WA 4J3SA 4CU7A 1I75A 2E8YA 3J7HA 3WFZA 1JF5A 2X09A 4M82A 1WPCA 1GQJA 1HKIA 3A4XA 1QNSA 5CSYA 3VIIA 4URIA 3CTTA 1JZ4A 4RE3A 3W6LA 1EHAA 2QPUA 2JALA 1OWQA 2CHOA 1WP6A 2JF7A 3VOCA 5IFTA 1HF6A 1E15A 1DWGM 2G3MA 1JL8A 1EO5A 1EA9C 1BTCA 4GZIA 4F66A 1NH6A 2V38A 3MUY1 1LLOA 5IHRA 3ZO9A 2DSKA 2Q1FA 1AQ0A
chains in the Genus database with same CATH superfamily
3TCEA 4PMQA 1W9UA 1EF2A 4DZHA 1W8GA 4O18A 4PCNA 1CB2A 1QUMA 3WNPA 2TAAA 2Y5SA 2ZX8A 4DBDA 3CPRA 4L1XA 7TAAA 1PVNA 1XRTA 1X97A 1Q6LA 2DZAA 4H6RA 3GK0A 4BFAA 1TWDA 2ZUNA 2PC4A 1K8CA 1ZBVA 3VC6A 5FF4A 3EWZA 1UCWA 2J47A 3VABA 1WKEA 2JFEX 1KW1A 4X2RA 1HIZA 3W85A 2RUSA 3AQUA 1FWWA 4IFKB 3E49A 3EEZA 4LYRA 3GKAA 4IQEA 1XIBA 3MO4A 3SN0A 2ZFAA 3RRXA 3A22A 2WJFA 5TAOA 3V16A 4B2DA 1ISZA 1XLHA 3O2LA 4PTMA 4Z42C 2QJIA 2VDHA 3G6MA 1RA5A 3LNPA 1VJZA 5HOSA 1TVPA 3VX0A 2J4GA 3SN1A 4XD4A 3TOPA 2H8ZA 5HA7A 3SY8A 1BVWA 2P53A 4ZZ9A 2HE5A 3MDWA 2BHZA 4XZNX 5FCZA 1PXGA 5JXQA 3R4IA 1KC7A 4L4OA 1POJA 4I7WA 1HFBA 5DN1A 1PPIA 4Q4QA 4HPGA 3RXZA 4C7FA 4LC6A 2VGGA 1H1YA 3PY2A 1QATA 4LOCA 1H51A 4WDWA 3ZM8A 4RNHA 2XN1A 2BOFX 1B54A 2VEFA 1M41A 4A8NA 1JVNA 1SVDA 3WLTA 4JTIA 4R53A 1LOSA 4ILSA 4L1WA 1XL9A 2BWGA 5KTLA 1JPIA 1AJ2A 2VD9A 3QSTA 5C2GA 3DENA 3M6YA 2PWDA 4V33A 3TU9A 2REQA 3ZJ7A 1BYBA 4IPJA 4X60A 4ZQNA 1RAKA 2F6KA 3W1QA 1IEQA 3G1YA 2R6OA 2J62A 2CHRA 5EYWA 4BQ5A 4CQ8A 4UMCA 3WMCA 3EKZA 4NILA 1RK6A 3W7RA 4GQGA 3KRZA 2PCEA 4LAOA 1CGYA 1TJ2A 1TTPA 2XG9A 4H04A 1XLDA 2V67A 1OK6A 5EMJA 4ATWA 1VYPX 5HNUA 3W22A 3LGEA 2QUTA 4GYFA 1TWWA 3PM6A 1ZCCA 4CD8A 2G3FA 5I3JA 2YBTA 4P8VA 1SGJA 3EWDA 2PDQA 2D0HA 2Z26A 4FEZA 2NXHA 1QNPA 3LRKA 3KBMA 5DCBA 4S2CA 3WH6A 3MMUA 1KWGA 5G2HA 1EEXA 4JTFA 4I5XA 3CJPA 4M81A 3GXPA 1AD1A 5G5IA 3WDRA 4LCRA 1KQZA 3LMYA 5HWNA 3N3MA 3A9BA 4GUIA 4I6KA 1T7LA 3VO0A 1X8FA 3WDIA 3M7WA 4TVUA 5D30A 3MCMA 3BV7A 1DOSA 2Y70A 4XAGA 5FJPA 2EPOA 3MV11 1E4MM 2O7SA 1J0ZA 5AZ0A 3N9SA 3G8EA 3R8RA 4OV9A 3CNYA 3WF3A 3AU6A 3N2MA 3U0HA 5DMYA 1W0MA 4LBSA 1P7TB 2ONEA 1VRDA 1U5VA 5CZSA 3K1GA 4D6DA 5FKYA 1V03A 1D9EA 4UTHA 3UD1A 2YIHA 5IFPA 4O12A 2OOFA 5C70A 1F9GA 4IFKA 4FMVA 3VKJA 1LL6A 1RPKA 4ZVJA 3BTNA 3ZR4A 2A85A 4CVWA 1DBTA 1LTDA 3VKBA 3BZJA 2NT1A 3GM8A 5C55A 3N04A 1WZLA 4ZOEA 2DZWA 4UC5A 3W7OA 3KXQA 2W91A 1B4EA 4L9XA 2ZCGA 3W81A 3AHZA 5F7UA 3E5PA 2HSAA 5CPOA 3STFA 2D2HA 3MSRA 3W7KA 2R1LA 1V51A 3HMCA 3BW2A 3USZA 3URNA 4IIEA 4Z1DA 3GHSA 1N7QA 3PUGA 1NQKA 3UXLA 5LA1A 3M46A 4QEHA 2A7NA 5IBXC 4LUTB 3PZGA 3PB0A 5C2CA 4LPCA 4B5WA 4RNFA 1JPHA 1OF8A 4L9YA 1VCGA 3CL8A 3CYVA 2W0UA 2I5GA 5B7YA 7A3HA 5A8NA 2ICSA 7XIMA 4CQAA 3VKCA 1LZOA 4QNEA 4L4LA 1GKRA 2WC3A 3AI0A 4GVFA 2DT0A 2WOQA 1M01A 4DB7A 3LV5A 2X1RA 3UZXA 1HKWA 3B05A 3LZ3A 1CGXA 4M0XA 4S38A 1H4PA 3LI1A 1P0KA 3BJFA 4BF7A 3VK5A 2BOEX 1FUYA 2GLKA 3LPPA 1KKRA 3TYZA 5ABTA 2PWEA 3M16A 3N29A 4PMVA 1EB3A 2WHMA 1AH4A 2FB3A 5C0QA 3UJEA 4L5ZA 3RJYA 3I65A 4E8GA 3WLSA 1YE6A 3GAKA 2WNZA 3BAIA 4EPBC 2X2YA 4LAKA 5HWJA 2QJMA 2ISDA 1EJUC 3TAKA 3WQVA 1OJOA 1FH9A 2GPTA 3UPWA 3SSJA 1A0EA 3DOPA 2XJ7A 3VUSA 3Q45A 4JCMA 2GUBA 3S1WA 3C61A 2BVDA 2PGEA 3GHUA 1XIGA 3CQIA 3KS5A 3LCWA 4US5A 3TMLA 4AZCB 4S1FA 1KNWA 5HANA 3B8TA 4H8NA 2X7WA 4NJHA 1DQXA 4RL3A 4AQLA 1R3QA 3PG8A 1LJYA 5HMFA 4D6FA 3RG6A 3REQB 4ZR8A 1B9ZA 1E40A 4WY0B 1XYCA 2XSBA 3C4UA 3KVMA 3LLDA 5LIKX 2I17A 4PTDA 2B81A 3VIMA 2A1YA 4PTWA 1C93A 3AYTA 1UKSA 4Q4RA 1EJTC 1ZBCA 3SB0A 1OIMA 4DBEA 3TUUA 1ADOA 1I2PA 1ZFJA 2E5DA 7ODCA 4GPNA 2X0SA 4W7WA 3LQLA 2Y2WA 1Y0EA 3NEHA 3O8AA 3WCZA 4CNUA 4DWSA 5D09A 2WC7A 2G4JA 3G8RA 3TXVA 3OPSA 2PAJA 3UP8A 2RDUA 2O4QA 1V0NA 3QMTA 3HPXA 3KOYA 3TEVA 3S9ZA 5J8LA 1LLQA 5CSRA 1UR4A 1EGZA 4LFYA 3CT7A 2VR2A 5TQLA 2P76A 2E09A 2WXDM 2YXXA 3EPOA 1L6YA 2NXGA 1XI3A 3VIGA 5HUPA 1O1ZA 1W1ZA 5I6SA 2HZGA 4K8HA 2OO6A 1XBXA 3IJ8A 2PUZA 1ESWA 3B03A 4AD4A 2WMIA 4GD0A 5DRCA 1YE4A 3DG7A 1H62A 3PAJA 2WCGA 4D6IA 4BQ4A 2PDGA 3E5BA 3CHEA 3CM4A 3B9NA 1NY1A 2YBVA 3WF2A 2TSYA 1BFNA 4O1BA 3RHGA 1CZ1A 1U22A 1AODA 3P0WA 3MDUA 3N2CA 1HVQA 2XGZA 3WQCA 5LNWA 3N4EA 2J7BA 2Z1SA 3AMLA 1PTDA 1HJQA 3DAQA 3ZFHA 1IIHA 3SCQA 1AL7A 5HNRA 5B7ZA 4XVDA 2I9UA 3H4XA 3H2NA 1ISVA 4QP0A 3QQ0A 2NQ9A 1GHSA 5I3FA 1ODZA 3WMBA 1XGZA 3CB3A 1NTHA 4B5UA 1TWIA 4XK2A 4Q4OA 4RE2A 2E8ZA 2BSLA 4NAEA 4DPQA 2CPUA 1UWSA 1LUCA 1F07A 4RV3A 3WN6A 3VCCA 2VFIA 3GQYA 2E9LA 2E67A 4LVBA 3N73A 7PTDA 5E93A 3N9KA 3QBUA 2BP1A 4E8CA 3HQNA 3BLDA 4Z2HA 2ACUA 3L9CA 5HXMA 3AXHA 4D71A 3GU1A 1NU5A 2OZTA 4UTJA 4KQNA 3LSCA 3SN4A 2ZUSA 3RFAA 3E2SA 1QFEA 1MQQA 1L2QA 1D3CA 2EPHA 3W7LA 4N9BA 4Q8OA 1QHOA 3U2CA 4HPJA 1R3TA 5A8OA 2QCGA 1KRBC 1DIDA 2WANA 2B7NA 1GQKA 1W5MA 2ZC8A 3W1LA 4C6OA 1OZQA 3URBA 2A3AA 5CPMA 4UTWC 1MO0A 2AMGA 4C6LA 3WH7A 4Z1CA 4CCCA 2JIWA 3OQEA 1JDCA 2VO5A 3SJ3A 3S2JA 4F0LA 2QMJA 3GB6A 1DKWA 3NPUA 4AAJA 1LORA 4G8TA 3FDKA 3PNUA 4P7OA 2KAUC 3K8MA 4C91A 5AHLA 4L4PA 1UUQA 4DAFA 3NGFA 4WX2A 2VD8A 4WIWA 3HN3A 4O1FA 2WW5A 3M47A 1IGSA 1EC8A 2QUMA 1KFKA 3WSUA 3V0SA 5FJJA 4CN1A 3KTXA 1T96A 4QFUA 3WH9A 3S9YA 3IJLA 1SR9A 4KESA 1V8EA 1TUFA 2H6RA 2XHYA 3LGGA 2E24A 1ZBKA 4AVOA 7REQA 3VKDA 1UP0A 1OFEA 4BF9A 3PQIA 3FDGA 5A2AA 4CN4A 4BA0A 1KM6A 2YFNA 4W85A 2OX1A 3FK4A 5I5RA 2WNWA 3ES8A 3IT6B 1ZJIA 4IQJA 5C5YA 4AEFA 3FEMA 4H9VA 4C6CA 4MAVA 4LCSA 1EPVA 4GI6A 3W37A 1UPPA 2A0NA 1POKA 1UR3M 3A13A 3UJ2A 1TQXA 2HROA 3MVTA 1OCNA 2X05A 4NI8A 2P1FA 3LERA 3EWXA 4CGTA 1H7XA 4A3QA 3G1RA 1TELA 4CNPA 3KZPA 1VLWA 2WB5A 4S3EA 2J7GA 2XZ9A 4CD4A 2ZDRA 5CPNA 4B5SA 1S1RA 1D8CA 3PZUA 2A3CA 1XLKA 3WL1A 5ABFA 2HVOA 4AYGA 3OVGA 4MOZA 4I6VA 1E6XM 2VURA 1IZCA 3PUOA 5CH9A 2X1IA 3IRDA 1DJGA 5AYZA 3CAVA 4I3GA 2GJLA 3VDCA 3EDKA 4C6KA 1OF6A 1SJDA 3O05A 4NZCA 1VBHA 1KA9F 3W53A 4IWWA 2Z25A 3E1F1 2REQB 3UYCA 2VGBA 4E3TA 1ECEA 1L6GA 8XIAA 3E0IA 1EL3A 3QY6A 4IIGA 3ZT7A 4QLKA 4YYCA 4H9YA 4OZOA 2C16A 3SUVA 4Q8QA 4DIAA 3QV8A 3S9IA 1NWUA 1R0MA 2DZXA 4A05A 1C7SA 3NNTA 4HVXA 3CHFA 3A6OA 3QZAA 2DH3A 4W86A 1CIUA 2X0HA 4IZGA 5LGZA 2VXNA 2FZ8A 1W8SA 3A4WA 5HQMA 1O5QA 1E6QM 3PC0A 1ZNNA 1A4LA 3NZPA 1GVIA 2DFAA 1OBAA 3PTKA 4LBUA 1TMQA 1XUZA 2ISFA 3W1MA 3IAQA 4ATLA 3W1XA 2QUNA 2A2IA 1UQZA 3B0XA 1KM1A 3G1HA 2B7PA 4IIHA 3N3TA 2QXWA 3A3HA 1XIEA 1H1NA 1JCJA 1P0EA 2B7QA 3CUIA 1WCGA 3IAPA 1C82A 1ISWA 2C1HA 3T42A 3HV9A 1ZJBA 2C6QA 3AHTA 1TV5A 1KM3A 1IE7C 3ERPA 3MUIA 4CD5A 1QDSA 2OOGA 3W07A 2E40A 4ZOBA 5FESA 3BE7A 1GOKA 1JYNA 2D3NA 1OINA 4BWLA 1GYLA 3CZLA 3K13A 2P0IA 1TPB1 2PP0A 1N55A 2R1PA 4PYSA 5FJUA 3OB8A 2PDWA 2CLFA 2CZ5A 1V3JA 2VZTA 4LSBA 1WBHA 4C6DA 4LQ1A 4A2RA 4GJIA 4WOQA 2R1MA 2WWCA 4OBSA 3WLIA 1UPMB 3SCVA 3M0IA 1R9XA 6XIMA 5LGXA 1LUCB 3WNOA 1RY0A 2VENA 2J7DA 3S5ZA 2DU2A 5IDZA 4MNLA 4QHRA 3T0CA 3TFXA 4UOZA 5K2ZA 1B3XA 4UNLA 5G1TA 3IIPA 4MFDA 3PFRA 1UJPA 2BMBA 3TW7A 3QW4B 1TTJA 1KTBA 1ALDA 4RNJA 1BG4A 1I6NA 4FI4A 4V1YA 4AD3A 3S0CA 3GWQA 1W5PA 3HPAA 3P5ZA 1UKOA 4QIUA 3VGDA 1YDNA 2QDHA 3EX1A 2YDSA 1W3LA 1KO0A 5D02A 5I78A 4MWAA 1J0NA 3PZMA 3R79A 1T0OA 2ISSA 3GXNA 3VMPA 1RWFA 3TQVA 5CAHA 2KXSA 2J8TA 1YNQA 1OG0A 4HHPA 5CJ5A 1GJUA 1DJXA 1EC9A 2XIOA 3ZLGA 3TYBA 1E56A 3UGVA 1EX1A 4G7FA 2FMNA 2O0TA 3B0PA 4QX4A 3L67A 4O15A 1TRIA 3GY1A 1JZ3A 1KB3A 4PULA 3EXSA 5DY3A 3EMZA 3H2OA 1UIOA 4WR3A 2PF8A 2NW0A 2E3ZA 3KOZA 3W25A 1I2NA 1GOQA 3O1NA 3BQ5A 4ICCX 2VWTA 3UJSA 1RQBA 1Q6EA 4WY0F 5BOEA 2Z2AA 1ISXA 2EHHA 7REQB 3W2LA 1QI5A 4IMCA 2BGNE 2FPTA 2PGRA 3WBWA 2ZADA 3RR1A 1S2UA 2V63A 1CX9A 1UA7A 4XKMA 4YHEA 1J0YA 2YL6A 2Y0FA 3MTWA 4FNSA 4JIHA 5HMDA 3LRLA 4A8RA 2G96A 3GH5A 2DSVA 1TX0A 2NWRA 2FVMA 3LZ5A 4CQ9A 4XZIA 2EO7A 2TODA 2GSEA 4D1JA 1FH7A 3GDLA 2NX3A 2C79A 4HD5A 2IPGA 3LCFA 3M4HA 4LS2A 2WHJA 5MF5A 5REQA 4N0RA 4H19A 1UR2A 1BSLA 2NQZA 3TMQA 2XIBA 1MZRA 3WLLA 3MYPA 4Y7EA 1MUMA 3G3DA 2PBGA 3CHDA 3L5AA 3CAWA 1PS9A 5D9MA 1JF6A 2G97A 1TWZA 1ELSA 4GMEA 3KCLA 3W1PA 2TRSA 2CLOA 2BB0A 1T99A 3S3GA 5BMXA 1TRDA 1BPLB 4MUZA 4A3RA 4D8ZA 1CLXA 3QH2A 1A4MA 4HYVA 4XVEA 4EX4A 4UIOA 2EEXA 3EGJA 5LIYX 4BQ2A 4JTLA 2WCOA 3KE0A 3G1XA 4F0RA 1TPC1 1K7EA 4HOZA 3MV01 4A8LA 5A8MA 2OGYA 2ZXBA 5EFFA 3UG5A 2WQDA 1YTDA 1XIHA 2BV9A 4S3KA 1TFVA 1RVKA 3TCSA 4Z1BA 1MQPA 1VCVA 1XUUA 3VGFA 4D1IA 3RCNA 2P8BA 5DFAA 2E4TA 3TTYA 3UA3A 5FOOA 2QKFA 5HJLA 2W66A 2C13A 1BLIA 5C9RA 4JD4A 4RR4A 4O50A 4P8XA 4RDZA 3GVRA 4KEVA 1IZKA 4JHOA 2Y61A 2WJDA 3LXCA 1EP2A 4YNGA 4FLRA 3VYLA 4IG2A 4C6IA 1C92A 4UR8A 3W1RA 4BI6A 4WLCA 4MNMA 4GNJA 1NQ6A 3M5YA 1VPYA 1JUBA 2HVMA 2XVKA 3FJ4A 2CNCA 1EZWA 2FVLA 1VPXA 1B57A 1Z6KA 1XQKA 4M1BA 5LA0A 2J78A 2Y89A 4GX9A 5DRIA 4LB3A 4TTUA 3TROA 5D9OA 3F2BA 5EL1A 1RA0A 3NAVA 1OX5A 1EJWC 5HINA 4C6NA 3LGDA 5FJIA 1JZ2A 1UG6A 1MQRA 2OTDA 2CZDA 1SPQA 1CT5A 1EJRC 3BXWA 1OYCA 1A5OC 3TQKA 1XD0A 4JKKA 4C60A 3PBMA 2XVPA 4JIPA 1A5CA 2J25A 4UTLA 4ZB0A 3CAKA 3O0KA 4HK5A 4D6EA 3POCA 3W72A 1X6LA 1UD8A 1WAWA 4YTQA 3TTSA 3WG6A 3T44A 5HQEA 3NFUA 3K30A 3B0VC 3CZJA 2Z7KA 3I7SA 2W6RA 3PWAA 3CUJA 1CPUA 3OP2A 4D8LA 1XRSA 4AX6A 1TJPA 3GXFA 3T8QA 2D23A 1PSCA 5E5CA 4U5KA 4BKNA 3TOYA 4W8LA 3B97A 2Y8KA 4UFLA 1CTNA 4ECLA 2HBXA 1GCYA 1K9EA 2ZE3A 3ZXWA 4TMCA 4F0HA 4BEQA 4MPKA 1QJWA 3KL3A 4JTRA 5D2XA 3AROA 3N1AA 3BL3A 4LRTA 3GBEA 3CLMA 3NSNA 4DWSB 4EANA 4R27A 1GZGA 2CW6A 3ME3A 3NTYA 2PC8A 2MANA 2O9RA 4QBXA 3FA3A 9XIAA 1QO2A 2OT0A 4GXMA 1XRVA 3UA4A 4IPPA 1I4NA 5ENLA 4J2PA 3NYDA 2ASHA 4HNNA 1NJJA 1G4TA 4MB5A 4JYDA 2FPVA 4F40A 5CLTA 3OLGA 1KTCA 2Y24A 1RXOB 3URQA 1SO3A 3MO7A 1HL9A 3LI0A 1HP4A 3CV2A 3BLEA 3OHIA 5EB8A 1UWAA 2QQ6A 1J01A 5I2UA 2INZA 1W5NA 1OGBA 1OCQA 4PUKA 3JU2A 2WZHA 3AISA 2E77A 1NVMA 1M3UA 4J3XA 4GUFA 5LNUA 2ACRA 2O7QA 3CHCA 4QS5A 4E3VA 1SUXA 1W2VA 2WMFA 3XINA 4B9ZA 4HNLA 3G1VA 4FALA 1E4NA 3F4WA 4BCEA 1PWLA 5M1TA 3SFWA 4N9EA 2ZDSA 2P3ZA 2VC7A 2Z1WA 1FFRA 3W88A 3ZQ9A 1NWRA 3EB3A 4ACZB 3VDHA 1W3NA 3LENA 1J0HA 4AWUA 5D9NA 1Q45A 3NZ1A 3P60A 3IANA 4HCHA 1TV3A 1LM1A 2VX5A 1V3HA 4O1EA 3HZ3A 4NJKA 3GW3A 4KWOA 4X22A 2Y7FA 1SZEA 3W0KA 2H8XA 2CKRA 2PLJA 2ZZ5A 1EQCA 3I6TA 4Q4PA 4LV4A 4YTUA 4EAMA 1PJ9A 2A21A 4ZTYA 5HJXA 4OOUA 3AALA 2GL5A 2Z1VA 5CSUA 2GJNA 1MXDA 1KM2A 3GG1A 1IXPA 4ROQA 1PX4A 4NRRA 4XKYB 3R2GA 2WSKA 4Z08A 4K1WA 3SY1A 1IR1A 3SR7A 4FXRA 1P43A 4I8YA 4EP8C 4TXEA 5E9AA 4LTSA 1OX4B 3LCHA 1VFLA 3GNOA 2I5IA 4LS0A 1FDJA 2A7PA 4O14A 2B0MA 4PFMA 3QQWA 4WSJA 3UWYA 4UR7A 4GUJA 4QM1A 5GPRA 1X7IA 4QGCA 5EMUA 5ABHA 4WCJA 2ACQA 2VFDA 5M17A 2D1ZA 2NV2A 1E43A 1GOOA 1BRLA 1I2RA 1JYXA 1OB0A 5I07A 3L4WA 1AW5A 2J6XA 3GDKA 1E6ZA 2J8FA 1DTNA 2UY3A 3ELFA 3K8KA 3QMSA 4PMRA 1IIGA 3NURA 1I0DA 5CAKA 3VPLA 3MWCA 1I0BA 1DIOA 2JEPA 1O5RA 1HL8A 1X96A 2OVLA 3QTGA 1JYVA 3H54A 4IXHA 1SW3A 3O6CA 4JNYA 5D32A 3CO4A 2O56A 1OFRA 1E0VA 3TR9A 4LAUA 1VBRA 3BOLA 2FH6A 3E38A 1L9WA 4O8AA 4GKTA 3ABSA 4ICNA 1RV8A 3B04A 3RN6A 1GG0A 1K9DA 2ZVRA 2QVNA 4B15A 2PPGA 1XHGA 3SUUA 4RW3A 3SO7A 1EZ2A 3W2UA 1X98A 3PPHA 5JBDA 1AH0A 1KCXA 1UZHA 4J27A 1G7UA 3V1HA 5FJOA 1OCJA 3WD3A 2VEMA 2E1DA 3N2BA 2XZ7A 1XCWA 5LHEA 1VJSA 4Y9MA 1FHDA 1FWCC 1OIFA 1U1HA 4HB7A 2INEA 1ADSA 1MW3A 1V5XA 1LBLA 2WSPA 3PTQA 4U33A 2ZZ3A 3MYOA 3NL3A 1BYAA 2DEPA 2BXZA 1ITCA 2RKXA 1XR2A 3ATYA 4A8IA 4PL1A 1XQLA 1XPGA 4NXSA 2E6FA 3PZTA 1B9BA 3OEXA 4EXQA 3FA5A 4H2CA 3PSVA 2W4XA 4XX6A 4ORMA 5E1QA 5I03A 1ADDA 1E0WA 4J40A 5D2YA 3FSUA 3ABRA 5KSWA 4LS1A 4M82A 4JTTA 1QPNA 1WPCA 1HKIA 3PPGA 3A4XA 1OY0A 2PRMA 4NJJA 1K8YA 2ZA3A 2ZRVA 1F3EA 3VIIA 3P8JA 4MKSA 4GI4A 3EWCA 1Z44A 3DDMA 1HF6A 1NIUA 4OHQA 3VOFA 1E0UA 1JL8A 4QROA 1EO5A 2B4GA 1BTCA 3E96A 3NQBA 1LLOA 3BUVA 3ZO9A 2Q1FA 4CU6A 4U10A 1AQ0A 5HMSA 5U7SA 3T6CA 3O6YX 3QY8A 3WD4A 4GFSA 4ROPA 4E8DA 3T09A 2CIPA 3BWWA 4DXVA 3UT0A 4H3DA 4H6KA 1V02A 1FWHC 4INFA 5BRPA 5HWMA 5DBTA 1E3ZA 3UVIA 3A47A 4JFSA 2NX9A 4LUSB 5E6YA 3B9DA 4JYEA 1PDZA 3L4XA 4UBPC 4CCZA 4UTFA 3URAA 2YL8A 3G77A 3GH7A 5BXSA 1NFPA 1AG1O 1W1YA 3V75A 1UD4A 3TSBA 4IJCA 3STPA 4ZO7A 3SRFA 3CZGA 4UR9A 2HXTA 2BVYA 1EIXA 1F8IA 3QLDA 3WLOA 5EKYA 4H8VA 1Y65A 4WUIA 4LEQA 2PTXA 3QHMA 4LW7A 2E6DA 1FP8A 2QCCA 3NQDA 4H00A 1G4SA 2CKSA 3MCOA 1QASA 1FCVA 4PMXA 1UIPA 4OFCA 2W61A 3EOEA 4QLLA 2GGHA 1JGIA 3LG3A 4NUWA 3DFPA 3N34A 1FXQA 4DX3A 3TR2A 1CI1A 1JGMA 3CASA 4GNKB 1F61A 2J79A 4K36A 1ZENA 4UQDA 3TYCA 3YPIA 4AHPA 1U83A 3NPVA 1F2JA 1RZMA 3DG3A 1XH2A 4S3DA 2A79A 2CESA 4K1GA 1NF0A 1W5QA 1JFXA 3WBXA 2J7CA 4UMAA 5BW6A 5G1MA 1ZU8A 3BGJA 1TV8A 1Z8AA 3DU0A 1VHNA 3H12A 1QI4A 2XFRA 5F1UA 4OBRA 1XLEA 2SFPA 2WM0A 2WCSA 1OG6A 4IQDA 6A3HA 3P62A 2XSAA 1E6PA 2ZWZA 2CXGA 5AYYA 3L0GA 5IOBA 2CZFA 2WMGA 1GQIA 3Q67A 4GUGA 4JY9A 4IISA 1N2VA 4DYKA 3OLIA 3GVGA 4RZ6A 2YCLA 4U28A 2C15A 3FAXA 3AJXA 3T4WA 4C1KA 1V93A 2XVNA 1R38A 5C7VA 3UPBA 2HRWA 1HUVA 3QLLA 1G1YA 5J04A 2IKHA 3L2LA 3QTPA 4LAZA 4Q6JA 2NX1A 1YMYA 5GQBA 2OKTA 1GVEA 4C6JA 1XKYA 3L23A 1XICA 2RDXA 2Z1XA 2YBUA 1W54A 3EOOA 3WQOA 1HJUA 1ONEA 4E4PA 1V02E 1YRRA 1XBZA 4UQEA 3WQ5A 3WMSA 5HAOA 3VC5A 5CKSA 1MI3A 2ZRXA 1Y5WA 3R1ZA 4KEZA 2C19A 1QRQA 1X6NA 3UWWA 2H3DA 4WXYA 3CZEA 3E9AA 3UG8A 3OLEA 2VJXA 3WLMA 3AC0A 2BY3A 1NELA 1V0LA 2RDWA 3KLLA 4Q4KA 4RV8A 2HS8A 4DWSD 3AWNA 4S3CA 4PMYA 3W01A 1YKWA 1LROA 2OEKA 4LB4A 1E6SM 1WO2A 1IF2A 3HGOA 1KRAC 2BOGX 3P67A 6TIMA 3AHXA 2P88A 3LCLA 1TQJA 1MEWA 4F0KA 1EC7A 1HO4A 1ICQA 3VNZA 1QNQA 2GJPA 5A8GA 1R6WA 4DJDA 2WMJA 3H2MA 3HG4A 4GG9A 1KXVA 1F3XA 4XQ6A 3F4DA 4XZ9A 3UWQA 3ENLA 1WKFA 1UJQA 4H9ZA 1VHCA 1XISA 3LPGA 3WH8A 4YVVA 5AFDA 1H0GA 4EPDC 4AFYA 5E09A 5FSEC 3ID7A 4HSOA 4AZ5A 1QNVA 1UW9A 1GK8A 3L0NA 1BWKA 4O28A 2ZRYA 2W92A 2Q8LA 4KWVA 2Z29A 2Y63A 2A3EA 4X3ZA 3IIZA 5CGMA 3KDOA 2IKJA 4RPPA 3TK7A 4C90A 3CPUA 1ZJAA 1OZMA 3NDYA 5FEZA 5A6TC 5C71A 1EGUA 2PP3A 3DFOA 3VZXA 3KRBA 1LL4A 3HV8A 2VCAA 1B1YA 2DGAA 4XV0A 3TVAA 3GX9A 1M7JA 3BCJA 3FFSA 1GG1A 3M0KA 3RAOA 4UB9A 3LM7A 1YYAA 4J5NA 5I24A 3AMGA 4KWUA 1PUDA 3PP7A 3UZJA 4HNVA 2V5CA 4IFRA 4AXKA 3RDKA 1VGAA 1KKOA 3CU2A 2VZOA 4DO6A 1R85A 3S5NA 3RX2A 1ZBWA 3GE7A 3M0XA 3WDHA 4LF1A 1N7RA 1VB9A 3KP0A 1R9YA 4K2SA 2V5KA 5XINA 3QN3A 3EYPA 3PR2A 2YCLB 4PC8A 4ERAA 3HQ1A 4WQ6A 4QG6A 3VILA 1S5VA 3D3FA 1GPWA 1EH9A 4JX4A 2PRHA 4JL1A 4HHMA 1KFCA 3R13A 3UU0A 2WVVB 1OEPA 2CWXA 4ZEPA 3V7PA 2PE4A 3AWOA 4M6QA 3VNKA 1H09A 3MP3A 3VFLA 4Q8TA 1OX6A 1SMDA 4K68A 4Z1YA 4W5ZA 3W4RA 4XWUA 4M56A 5EFDA 3GUGA 2XINA 1AMKA 1LWHA 2QR6A 4TMBA 2UWFA 3CV6A 4JPGA 3OA5A 4OKDA 3EZ4A 3ARUA 3WJXA 2DH2A 2NZLA 2PD9A 3U48A 1M04A 2DIEA 2VQUA 3MP4A 4O1AA 1VEPA 1X39A 2WHKA 4Y9NA 4LYKA 3LX9A 5BOFA 2OELA 1FDYA 2VR5A 3CEUA 2RJHA 1BGAA 3VKKA 4C5ZA 2VX7A 3JS3A 1W1IE 5EMYA 4IT1A 2PURA 3M41A 4H4IA 1QI3A 4JS3A 1KQYA 3C3NA 1J4EA 4A3UA 1V6VA 4MIMA 1ZTVA 2RHGA 1IWBA 4IIBA 2PTWA 4HK7A 3BV4A 2V3GA 1SSDA 3E02A 1SO4A 4S3JA 1WDSA 3LCIA 3A3WA 2DJXA 4M6PA 1A0CA 5FF7A 1DQUA 2HXUA 2J7HA 1FWDC 2OG9A 4JIIX 4LT9A 2ZUUA 1GTHA 2YKKA 2QV4A 3BVJA 3MMTA 2Y7GA 2YZ5A 1L8PA 2HK1A 2R9RA 4GXPA 3WEOA 3G6LA 4QITA 3IJDA 1DV7A 2DZVA 4MVAA 3H4WA 1W91A 1FKWA 1LG1A 3R10A 4U5IA 4JTGA 5FI8A 4MLRA 1D2KA 2ZTJA 3ITGA 2XGBA 2WZEA 4JNMA 4M8UA 3NDZA 4F2TA 2DZBA 1A5LC 4MKNA 1CYGA 4QJ4B 4NZ1A 5CBIA 5DY2A 3GTIA 4ZTXA 3L4UA 1QO5A 1CGWA 1W3HA 4S3AA 1PIGA 3EKGA 4WDTA 1A53A 3HM7A 1ME9A 3QEZA 4JXCA 2DPEA 2ZBTA 1W5OA 2QUUA 4KPLA 1DJQA 1SW7A 4LAMA 4DM2A 2VGFA 1S46A 1K4HA 4CCDA 1KFJA 1WDQA 1H50A 3MT1A 1BD0A 3ZWSA 2JIEA 3BAXA 1FHVA 4UTWA 2OCZA 2XFWA 1QXLA 3SY5A 3POHA 3DFYA 2G3NA 2ZX7A 3KVLA 1EHNA 4UQAA 5I77A 5M03A 1YW1A 1AW1A 3W83A 3UEQA 3DI0A 3PVFA 2ZXAA 4N9CA 3M0HA 4IMAA 1E1CB 3TC6A 1CXLA 5BXPA 1GQNA 2Q6ZA 1J6OA 1G0CA 2WQPA 3NXFA 3WQFA 5I3DA 3VOGA 1J10A 1EP3A 1S5WA 2P8CA 4AMAA 3TWBA 2YCKX 3THDA 3W7EA 3O07A 4MJMA 2YR1A 2WPGA 3D46A 3EPMA 5A95A 5BNKA 4NZFA 3PZVA 1F73A 1RBOB 4GO8A 1NP2A 5BOOA 4PGLA 3WK0A 3MMWA 3IUHA 3GAYA 1Z7AA 4S3FA 1K77A 3APTA 1KWKA 5HNTA 2PLKA 2BRWA 4O57A 4NQ1A 1VFMA 1WKYA 4MADA 1XH0A 3AMKA 2Y5JA 4ML4A 1L8NA 4NZ3A 3RO6A 2GQ9A 2FHCA 3IACA 4WDXA 2YCEA 3NR0A 4WF7A 1N8FA 1O68A 4L56A 3L68A 4GGBA 2CWNA 3GYEA 3WEZA 3B8VA 2QIWA 5LYRA 4LCQA 3LBOA 4F0SA 2Z1KA 4D6CA 2YL9A 3CYJA 3II1A 4TUFA 3Q2DA 4EXBA 3HGRA 2EPKX 1GOXA 3MSYA 5BYWA 3W24A 2NVCA 1A5NC 2F6UA 1YNPA 2QMKA 3LHWA 3AIRA 2OZ0A 3GIPA 3L4TA 3M0JA 3ZMRA 3TV8A 5FL0A 1VYSX 4QDPA 5A2BA 4IIFA 4UCFA 2OSXA 1EA0A 1A49A 4GC3A 3SJNA 2OXNA 3W02A 3LHYA 5DCEA 4A22A 4AEOA 3IT4B 4ML9A 2C0HA 4MY8A 5K9CA 1MMFA 1WAUA 1JZ5A 4YPJA 1UZ4A 3NG3A 4KFOA 5I23A 3KAOA 1JDDA 3C2FA 2H90A 4XAZA 1TE6A 3WQWA 4B16A 1Q4NX 1NDYA 4HA4A 4Q8UA 2AOSA 4AX7A 2F8QA 1NF7A 4XZLX 2NLIA 4TO8A 1N8IA 5T8GA 2HVNA 2ZX9A 3KL5A 3NCOA 3SQMA 2OMAA 3UD2A 4FNTA 4PMZA 4MWAC 1KBKA 2BBFA 2DZPA 4ZQCA 4B3LA 5K9XA 2Q3RA 3TE9A 3CMFA 2QPXA 3HF3A 5A6JA 3Q94A 1NOUA 1V3LA 1MRAA 3AO0A 2XPKA 4JY8A 5GNYA 4DJEA 1MNSA 2PWVA 4LC8A 1QHZA 1UA3A 3KP1A 4YTRA 4YXGA 2NVAA 1WXJA 3CZKA 1RQHA 1VC4A 2YCJA 1KBIA 5XIAA 4Z2LA 2X30A 1D7KA 4YVPA 3CBWA 1W3YA 1JR1A 3M43A 2DZUA 1H7WA 5KZMA 3R5EA 1PDYA 4HCDA 4AB4A 4QJ3B 2R8WA 4V27A 4FOKA 1E3XA 3UR7A 1ICSA 3C8FA 3COTA 2PDFA 5HATA 4HKPA 4UTUA 1Z9AA 3MBDA 3AUOA 3ITOA 1MUCA 3SIZA 4FLSA 1ZAIA 1YDYA 3UGRA 2Y5EA 2VC5A 3O9NA 4F8XA 4DUWA 4ZO6A 2NUWA 2DVXA 3EDDA 2GWNA 4IF2A 2PWHA 3GLCA 3WF0A 4AIEA 1JJKA 3VM7A 1AVAA 1XLFA 1OC6A 1RCXB 5JBEA 1QBAA 4ICMA 5AHMA 5CZKA 2B7OA 3S1UA 3A5FA 1DVJA 3G1AA 1UH3A 4WEVX 1VP5A 1BYCA 4I90A 1H7PA 4E2BA 2BY2A 2QEZA 2DDXA 3LNMA 1B3OA 3N11A 1VFOA 4BQ3A 4Q7NA 2CERA 3VMOA 4NYUA 3R6IA 1W3JA 4HYWA 1FWIC 2F61A 5AYIA 1SZGA 2WMKA 1RK5A 3ES7A 4MTVA 1J8VA 2BNJA 2YA1A 4J2MA 3UZ5A 4QJ1A 1GOWA 1D7FA 2AQWA 2EXOA 2VMFA 4H9TA 3ITVA 4NYYA 1JI2A 4FOUA 2G37A 1QK2A 2QZRA 1PCKA 5BZAA 4GBUA 1UOKA 5DCDA 1FWFC 4F2UA 3I68A 5I3IA 3O0FA 5AOUA 1HW6A 1B2YA 7ENLA 3H6OA 1JRCA 2OQYA 1TPFA 2AAAA 2ALRA 4JDBA 4MZ8A 6PTDA 1TV4A 4KCUA 4AZCA 3AYSA 4JIRA 5ABGA 3CWOX 3F2CA 3ZYZA 3T2QA 1OFBA 1W2PA 4JFVA 4ZE5A 4NG3A 1XLCA 2OJPA 1XYZA 3AYVA 3IJQA 1CGTA 1YXYA 2FYMA 2TMDA 2BXVA 2VFGA 4V1XA 3NPWA 2Q02A 2GJXB 3PZOA 1RVGA 4MWAD 1HJWA 4YCOA 4I5UA 1CLVA 3R94A 2YGYA 2BODX 3WQ6A 3TW9A 1HM3A 2WYSA 1PE1A 1W32A 1A50A 2ZYFA 2EF9A 3LHUA 4W88A 2GSHA 4LVAA 4A4AA 3N25A 3H23A 3EWYA 1VENA 3WFAA 1RWHA 3XIMA 1VD6A 6TAAA 4J3WA 1JXJA 2A7RA 3G2GA 1S2CA 4FOJA 3SCOA 3BG3A 1GWJA 4LUTA 4ZCWA 1JI1A 1BHGA 1MXSA 1VIWA 1W1TA 1W3KA 1P48A 2W27A 4CNSA 4DYJA 4XTIA 2J88A 4YYFA 1MSSA 1NOWA 1EF3A 3A5VA 1B3WA 2Q8XA 3P74A 5M3WA 2VDGA 4YLWA 2Y62A 2WPBA 5A6LA 2CLPA 3H26A 4GI9A 1US2A 1W1PA 2PF0A 2VZUA 2OT1A 3DZ1A 3LOTA 1OYAA 4KEUA 1RCOB 3T55A 2VEKA 2E6AA 1BSIA 2V82A 2QAPA 5AHNA 1THFD 4QG8A 3SECA 3FW6A 3LCGA 4FB7A 1TWSA 3G1SA 1QNRA 5AC4A 5A2CA 4WGHA 1QI2A 1KCLA 1DYSA 1WZMA 1PKLA 2DSWA 3GBDA 3W7IA 4FR1A 3D5HA 4NI3A 2NQHA 1FWSA 4JIQA 1TMHA 1VEOA 1QHPA 4RX0A 3IEBA 1BVZA 1NOFA 1GVYA 2V0TA 3HGJA 1HO1A 2HS6A 3WD1A 4B3ZA 4TOQA 3LU2A 3WBAA 3UXIA 5A1AA 4PE8A 3KOWA 3AIUA 1UWRA 1REQA 2VHLA 4M1RA 2CYGA 3DERA 4S23A 1JDEA 5AN7A 4EE9A 4IJRA 4JTJA 4JX5A 1D3GA 4N7QA 4GNVA 2IW0A 2IQTA 4FX8A 4HPHA 3FNDA 1WNOA 2ESCA 4GBDA 3H7VA 4WY0A 2Y8UA 1EWDA 3LPOA 3ANUA 3W29A 3E3HA 1O1HA 1OT2A 3ABQA 5JIWA 2WK2A 4M29A 1I60A 3TKFA 5KMYA 2PD5A 1DIKA 4L6OA 1PCWA 4DUXA 3SI9A 4JR5A 2V69A 4X0NA 3UESA 1Q13A 3R0UA 1LWJA 5KITA 2B31A 3HMJG 4X63A 4AIUA 4HHLA 3KBJA 1D3HA 1UBPC 3P5YA 2QJGA 2FZMA 1XXXA 3S6DA 4OE7A 4HHHA 3OLDA 3PSWA 4AVFA 3AZSA 4NT0A 3VKAA 1TX2A 2PDCA 3DGBA 1Z48A 3EA3A 2OWXA 4OGZA 4Q4SA 3M1ZA 1KBJA 2Y4SA 1HT6A 3G0UA 1SMAA 3FJ6A 1XPYA 2CLEA 3V36A 3AYRA 1H3GA 3GZ3A 2JKPA 3N6HA 4GY1A 3W9ZA 2Z2BA 2PDKA 1EEPA 1MVYA 1V0MA 1GJWA 4C6QA 1B4KA 2JBMA 4NL1A 4HNCA 3AU2A 2HEJA 5G4WA 2ZZ2A 2FKPA 4P7NA 4AD5A 4XSLA 3CMGA 2J77A 1OCBA 3W87A 8CGTA 1WDDA 4Q7IA 4L64A 3NL6A 5F4SA 1KV5A 1T8QA 1M53A 4D6GA 3B8WA 1KFBA 1HP5A 1JZ8A 4PUEA 4IUGA 3PTMA 4JTDA 3C0JA 2Y7DA 5CG7A 3W28A 2DP3A 1BWLA 4JTCA 4FNPA 1C29A 2PDBA 5IHSA 1KBLA 3RX4A 2WVSA 2R14A 2XM1A 1T5AA 3SBFA 2OQLA 4K37A 4HU0A 2OZ3A 3UD6A 1RWAA 2VNCA 2NQ5A 4XTDA 3MW7A 3ZT6A 4HBKA 4FZIA 3GTFA 4YJ5A 2IKGA 1G01A 1KCZA 1M9HA 1UUOA 2DORA 3MANA 4QSFA 1WZAA 1HJXA 2Y1HA 4QRNA 5SWUA 3UW6A 5CSSA 1UHVA 4IGHA 2JQXA 2POZA 4AU0A 1U1JA 2FDMA 5JBFA 3QM3A 4R88A 2GVJA 1Y5VA 4PUUA 3CQHA 2VI0A 4CLMA 3OA3A 1VBUA 1F3WA 1EOKA 3GO2A 2A3HA 3BMWA 1LLZA 4ZB5A 3R58A 3T7VA 3THQA 5CGTA 4DN1A 4O11A 5LA2A 4NKCA 3PHAA 3B8IA 4IPLA 3CIVA 4B5XA 3NQ6A 4P7RA 1O95A 5DXYA 5H8UA 2C7FA 3TSMA 1OFOA 4ZB2A 3QV9A 3SM0A 3PWIA 4UTMA 3KCOA 3RM8A 1DJWA 4PSPA 5JQ9A 4ASTA 3E6EA 2DZSA 3WQ4A 1X8CA 2WZTA 1QMLA 4MF4A 1HKMA 1E0TA 4W93A 3PAOA 3C5QA 3SCUA 1LP6A 3G0XA 3SUTA 3CK5A 2QCNA 4KIRA 3VD9A 3AMCA 3QV7A 4GVIA 2I56A 2PDMA 1BXCA 4F2BA 1YNYA 2RDTA 3QPYA 4ZO8A 4UUIA 2EPMX 1LF1A 2BDQA 3QW3A 3VIFA 2F6XA 1M65A 4FXSA 3CUZA 3GVWA 4GH1A 2D73A 4AY8A 3GU9A 3WJWA 1GTEA 3WJYA 3ZT5A 3S8HA 2WV8A 5EBAA 1ECQA 1DWHM 1XCXA 4GHRA 3W1AA 3U7BA 4H8UA 5DF0A 1GVFA 3FHQA 4PCSA 4PR4A 1GW9A 2ZXDA 3S83A 2V3DA 3EWWA 4TR9A 3ONCA 4HZ7A 3LLFA 1REQB 4R85A 3NM1A 2QCHA 3L2MA 1RW9A 2IPFA 3SGZA 4GIRA 2E0PA 4W87A 1AZ2A 3FKRA 1V6XA 2FPYA 4ZQPA 4IP7A 2PDNA 3WLRA 1EJVC 2CBVA 3L5LA 4ZQOA 2Z6IA 1RSCA 1W9VA 5DMLA 2CEQA 2J27A 3KM8A 4LWWA 4IGMA 4H01A 3MBFA 3D0CA 3CIWA 2X2GA 4AYSA 1SO6A 2BLEA 4KFNA 1EPXA 5DMMA 2FGLA 4LBRA 1C3FA 3C0QA 1LWIA 3U5UA 3T08A 4PRRA 4TU1A 2DIKA 2O9TA 3ANVA 3KX6A 4UTIA 2RGMA 4HTBA 1LYXA 1NWSA 3VIPA 3ITYA 1QTWA 2ZUMA 3B8DA 1QW7A 3BC9A 4AWSA 3KBVA 1RLDA 1YXDA 2G5WA 5I7GA 1A47A 1W3IA 3BAJA 3P93A 5BU6A 3C2RA 3JZUA 1XYAA 3W7PA 5KINA 2Z24A 3NGJA 5DMNA 3HJEA 2AKMA 3TYDA 4I9TA 3TA9A 1H7NA 4B4FA 1QPKA 1DHPA 5C2XA 3U5YA 4GH3A 4QAWA 2PDPA 4H41A 3EOSA 4LX4A 1SZNA 4R5EA 1K8XA 3B06A 3W7QA 3PBGA 4AZ6A 1NARA 3W74A 2PDYA 1EWEA 2OYKA 2G3JA 4LGXA 4XBSA 1J93A 2VOMA 3M5VA 4HMDA 3AZTA 1XYBA 3F5KA 2O55A 4YN5A 3P84A 1VLIA 1UH4A 1Q85A 2ZZ6A 1E0XA 3W38A 5HNNA 4CD7A 3GR8A 5CPLA 5EMLA 1RBAA 1PHWA 5D8ZA 1EFZA 2GYIA 3CAQA 1CDGA 3TC3A 3JRKA 6REQA 3NJ3A 3GVQA 3M9YA 2X0YA 3RRAA 7CGTA 4GZ7A 1BXNA 1S1PA 3C2OA 2FTWA 4DVOA 1DQWA 2MUCA 4FXFA 3KDNA 2PODA 5M2FX 4ZXOA 4ZOCA 1Q3NA 3QFWA 2OEJA 3T4CA 1O12A 4MJ4A 1LBMA 2YA2A 3UZWA 2GDQA 1J12A 1X6UA 3ZS4A 1Q6GA 4GYPC 1OFAA 3TYUA 3FAWA 2QCDB 3EDFA 3M44A 1L6FA 3KBTC 2DW6A 2WBKA 3LYEA 5EPDA 2VKZG 3VUPA 3F4CA 1PKYA 3E2RA 2WMIB 2J9XA 2VCCA 1D8WA 5AC6A 1UKPA 4W7UA 1UR8A 4I7UA 1QPRA 4Z17A 4TQTA 1G6CA 4PB4A 3ABXA 3N14A 3ITLA 1F76A 3RILA 2GVEA 4MY1A 3REQA 5HQLA 3BZGA 1KD0A 1J0IA 3JW7A 1VBGA 2ZA1A 5H8MA 3UY8A 3EB4A 1I2OA 1W6TA 1MUWA 5LXEA 3W86A 3IIOA 1LOQA 3WBYA 5K7JA 4HQVA 2GJXA 4F0MA 1TR1A 4REQA 1JQVA 1I75A 2HTMA 5C6MA 4DLMA 1TJRA 2VEGA 8TIMA 4AC7C 3RPDA 4MMWA 3SADA 3HB9A 1GQJA 4ZQRA 3HIJA 2OODA 2EGZA 3CTTA 3LDVA 3WX7A 3U9IA 2RFGA 2JF7A 1UMLA 2V2DA 1DWGM 2VZKB 2G3MA 1JCXA 4IL0A 4F66A 4D8OA 4KFPA 5IHRA 1YBQA 3L4ZA 4DJDD 5FAJA 2XFFA 2DQXA 2YW3A 3DKJA 4PUJA 3OBKA 3VNLA 3ARQA 1GQLA 3V1PA 3MWAA 4MKVA 5ECUA 1DWIM 3ECQA 4V2XA 1YPIA 2J74A 3H2FA 2PGFA 2QT3A 3PUDA 3GDMA 1OFPA 4J28A 1V3MA 2X03A 1X1JA 3CPGA 1IXOA 1IEXA 1M7PA 3ITXA 4WKFA 1ME8A 3VD5A 1RBLA 4G56A 3PZQA 5JH2A 2BFGA 2FFIA 2GZXA 1EX5A 2IXUA 1YX1A 3AIEA 5I79A 1DWAM 1RPXA 4R34A 3MP5A 1BEUA 2PFHA 4M5PA 3JZEA 3U2EA 8XIMA 5AC5A 3EKLA 5DQPA 4OBTA 3DYOA 2OSWA 3RMEA 3DUGA 3SRKA 4PUWA 1DWFM 3C2YA 2CC0A 3WLKX 3CUHA 4GI8A 2XISA 5LIUX 3AXKA 3MVIA 2YDAA 2E9MA 3ALGA 3VCNA 1R3SA 3WYZA 2QUVA 3CL7A 1KXTA 2UY5A 3W7DA 1MW2A 3VD7A 2BTMA 4NNCA 4NZ5A 1IYXA 3TP4A 4AVNA 3WDQA 3P7YA 1QAPA 5AECA 1XCFA 3TWAA 4HMEA 4FO4A 2JK2A 2WWDA 3JR2A 3JUGA 1E9YB 3FVMA 3FHAA 4GYJA 3TA6A 4KF1A 4JFWA 3U8GA 3MZNA 2XDFA 1FQ0A 4DUOA 3RR4A 3LLXA 4DI8A 1EOMA 1JNEA 4LALA 4PUDA 4KCTA 1TCMA 4DWDA 1KFLA 2NV1A 4GJ1A 1XBYA 1AQHA 2BRVX 2WM1A 3EXTA 4C1NB 5IXEA 1ZY9A 4HJWA 1L6WA 2CXEA 5TIMA 3R8HA 3VNDA 3UWZA 3W3OA 1GOIA 1ZP3A 2GVGA 3PBYA 2V68A 2VX6A 2QS8A 4HJFA 4CNNA 3WQPA 4EWND 1GYNA 2D69A 1UQYA 1V6TA 3P14A 1QOXA 2YZRA 4ZGYA 3VOJA 1GT8A 3TJ4A 3KBWA 1PKMA 4ZO9A 4A2SA 5CC6A 3BQ6A 2W9MA 2TYSA 4PEEA 3NVDA 1IT0A 4AXNA 3LQGA 1US0A 3S1GA 2J24A 2ZX5A 1XC6A 1FCUA 4O53A 4QQ3A 4PZVA 3E2VA 3VGEA 2GFTA 2PDLA 2E7FA 3MC5A 2Q01A 1UROA 2PTZA 3T9PA 3WF1A 1QOPA 3T0AA 4KH2A 4IOTA 1TIMA 1UB3A 2O9OA 3CUGA 1KLZA 1UWUA 3S6TA 2XM2A 1CXKA 3FEQA 4LYPA 1A5SA 5F2IA 3IV3A 3QC0A 2XSXA 2W67A 3GTXA 4NAFB 1PZ2A 4HYRA 4MZYA 4DO7A 4WSHA 2PDHA 4OU1A 2C18A 2G8ZA 1Z32X 1BKHA 1OJXA 1XG3A 2V3FA 3OVPA 3C0LA 1IXQA 4Q7BA 1FVPA 3HPFA 3ORWA 1UKTA 2CLHA 3RK8A 3WH5A 5I3GA 4LY4A 3GXTA 4AMCA 2VDIA 1R9ZA 3P61A 4P61A 3STCA 3G1FA 3BJSA 4UFJA 1JPDX 4Z2KA 4F4RA 2UBPC 4ZENA 1EQPA 2A4AA 1H41A 3KCJA 3ARZA 2WO5A 5F1VA 3SAZA 2VZVA 4EXAA 3OO2A 1DP0A 4QS6A 1W31A 1B30A 3KL0A 4S2BA 3CQKA 3SQLA 3BLPX 2AQOA 4R33A 4REQB 2FVKA 3FOKA 5BROA 3TAOA 3PJUA 4O4VA 1LT8A 5CQ1A 1A5UA 4IMDA 3PBUA 3LB0A 5LNRA 4PTNA 2X1UA 3W27A 1OYBA 4BR1A 2DZTA 3O7UA 4AHQA 2GGJA 2DY3A 1J9YA 3KOXA 4L4MA 1H61A 4NF7A 3HOJA 1GEHA 3W7NA 1PIFA 3ZJ8A 1SO5A 2AL2B 4OOZA 2WSYA 1Q6QA 2IQ0A 4M80A 1UD5A 3BOXA 3MQTA 3KBUC 4QJ5B 3NA8A 4FF7A 1YHTA 2R1NA 3WLNA 2QCFA 4Q6XA 4UOQA 4W89A 5IM51 3GXMA 2VOTA 3NYZA 4V28A 5MHBA 1KM4A 1JRBA 4QE4A 4FIQA 2V5BA 2VVNA 2ZVIA 4Q8MA 2DIJA 4H9XA 2VP8A 1OJPA 3TN6A 1EGMA 3MCNA 3R12A 1XLJA 1OJMA 1P6WA 5DT5A 3RCYA 2Q71A 3ARWA 3FKKA 3QHOA 2E6YA 3QYQA 2Y6ZA 4NSBA 1Q7MA 3LRMA 4UFKA 3PS7A 4G9PA 3FJLA 4EKJA 5CC7A 4JHZA 3EOUA 4L7ZA 4Y2WA 5GJPA 2ATMA 2PB1A 1BRLB 2QV5A 3K8LA 4MG4A 3F59A 3DESA 1UYQA 4YVXA 1RALA 5I02A 1UMYA 3BLKA 1P7TA 3VA8A 2RJGA 2PDUA 3WNMA 1TPUA 1FX6A 3NSXA 1U1UA 4JTEA 4O0ZA 2AKZA 4BI7A 1WKDA 1BVNP 3UCCA 3W1NA 4ONVA 4H9UA 1GONA 2CBUA 4HTYA 4C6PA 2NWSA 4XAYA 3VGHA 4I9JA 1A5KC 1RQEA 1S5MA 2FQIA 1TUXA 1EDTA 4XD5A 2E9BA 3WQ8A 2VFHA 5D37A 4K7YA 5FEXA 1CXFA 4DJDC 1E6NA 1QWKA 2ZZ7A 1RCQA 1G67A 3AXMA 1PWMA 2JF6A 3BGGA 3CQJA 4PL2A 3U2OA 3PN8A 1XLMA 4WGXA 4YTTA 3MZ2A 1R2SA 3TTOA 4HN8A 4GKLA 3ATZA 5AZ1A 1NP0A 2G50A 1PX3A 1HKKA 3TXZA 4GVGA 2DVUA 2XIIA 3CV7A 4J3TA 2V6AA 1G94A 1E4LA 4ZOAA 4MLJA 5FJRA 2D20A 4CNTA 3BH4A 2VCBA 4LUIA 1TJ1A 2EQDA 1CLKA 4HU8A 3W26A 1SW0A 1C8QA 3TX9A 1W9XA 4EOUA 3KOFA 4MSSA 2O9PA 1SZRA 3PZNA 4FP1A 2PS2A 3VOHA 4GX8A 1EJSC 1JYWA 1XLAA 1XF0A 3WD2A 4L1GA 3WK1A 2CITA 4E2OA 2WBGA 4HNOA 4DBUA 1PL9A 4E2DA 3ITCA 3QPZA 3QGVA 1FWGC 3GNXA 3WUEA 3VZYA 3CV1A 1DJNA 4MZ1A 4C5YA 2PWFA 2NUYA 1IGWA 1XSKA 3E2QA 3V35A 4NNAA 1VEMA 5F2MA 1DWJM 5J5DA 2YW4A 2YOCA 3M0ZA 4NP7A 1CEOA 3A23A 4DF1A 2XGIA 4GO9A 1C9WA 2X8RA 5FF0A 5FIPA 1IHIA 2YLLA 4PFHA 5FD0A 2NUXA 1XYFA 2P5NA 2ABBA 1F3TA 5IBXA 4NY2A 1XH1A 3HG2A 5HDRA 1QNOA 5DXXA 4IX0A 3EDJA 2ZIDA 2ODOA 4DZIA 2QCDA 2KXRA 3F7JA 4HN4A 5CC5A 3UQNA 1RJPA 3CHVA 4JICA 5HUOA 2ZUWA 3EWBX 5MKGA 4HZMA 5BWAA 2YB1A 3UBPC 2INFA 4MUPA 4RZ4A 3NQCA 4KERA 3PBWA 2CZEA 1H63A 3TQ0A 3TYEA 1S2AA 4BS0A 1RLCL 3T81A 3NO3A 5C9XA 2HMCA 1S2VA 1JXKA 2PDIA 4BHYA 5AB3A 1P0BA 2DJLA 2FJKA 2OLHA 4EK7A 4Z1AA 3OZYA 3A3XA 2J75A 5TNVA 3MA8A 1YADA 2F9RA 1H0IA 1XFBA 4U2ZA 5A6BD 1DPMA 1HN1A 1FY6A 4O13A 1VBJA 4EACA 1S5TA 3QGAC 5HR6A 3L7RA 3HBLA 3KW3A 4GQBA 2A5HA 2BGSA 5F2GA 4ZODA 4CQBA 3NO5A 4G1KA 1OC7A 1E70M 2OFJA 4ZSTA 3H4GA 1CW2A 3HURA 2C14A 3I3DA 4HA3A 4EF9A 1EYWA 1A5AA 1ZAHA 4O52A 5HPOA 3GXDA 1VFTA 2POTA 1OGSA 1S3HA 3O6AA 5L6UA 4M6UA 2BY1A 2EG6A 3ONBA 1F74A 4G5DA 1JEZA 1AFSA 1H11A 3UR2A 5KEZA 1X1NA 4LYQA 3QZ6A 2IKIA 4LVGA 1HXJA 3UWUA 2GQ3A 1A5BA 2C1GA 4N9DA 1YLVA 2Z1BA 3VE9A 4DO5A 3L0KA 4DF2A 3A4AA 3QJAA 2CCRA 1M68A 2PEVA 3BLLA 5FEPA 1W1A1 5F4XA 4XAPA 2EPNA 1TTIA 2FZNA 3MI2A 4LEFA 2J7EA 1JCNA 1VAHA 1AD4A 4IGSA 3USBA 3LXAA 2BASA 2YYTA 1AUSL 2HWGA 3S5YA 5GVJA 3EX6A 1Q8AA 4UFMA 1UC4A 5I0DA 1OK4A 4HGXA 2PGWA 3BPWA 4B2DD 4XAFA 4YHGA 5E9XA 1SYTA 1QT1A 1SFTA 3AIQA 1R7AA 4DJED 1CXHA 3C86A 2WCAA 5AC8A 4H7VA 1TR9A 3HPSA 1PKNA 3GXIA 2YDQA 5AHIA 2OB3A 9CGTA 3TC7A 3V4BA 4IP4A 4ZQMA 5JU6A 5GJMA 4JTHA 1DTUA 3GDTA 4O0KA 3OZPA 1QU4A 1F1SA 4D6JA 4B91A 3DGRA 3G24A 1HGYA 3NQAA 3DC0A 4GQ0A 1PV8A 4MJ2A 1AQMA 3WZ0E 5JIPA 1RWCA 2WSQA 1R7OA 1E72M 4DNMA 5BXRA 2BY0A 1VRXA 2HPMA 1LL7A 1OX4A 4JTUA 3N2OA 1JUKA 1XIJA 2BVWA 4OQVA 2D2GA 1BG9A 2JKEA 3G22A 1VPQA 2XH7A 1GPFA 4JBRA 3B9OA 3LY0A 1EJ7L 3ARPA 4DF0A