4D6JA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 2 blood group a-tetrasaccharide (e558a x01 mutant)
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
586
structure length
586
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTASYWIWANDIENKAADYLKVSAKNGGYFIWAEQNVGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 215
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6jA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6jA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6jA02
4J3SA 2YA1A 5LA1A 2X03A 3TTSA 1US2A 1V3HA 1M01A 4QCEA 2XTKA 3BSGA 5D4YA 1H0GA 2WSKA 2WMIB 4LYPA 4U5IA 2GJXB 3BCFA 2D3LA 1XC6A 2WK2A 5JBDA 2YL9A 1EQCA 2J8GA 3O6AA 5JBFA 1ITCA 4JKLA 5E09A 4NI3A 3VM7A 3WF1A 5ABHA 3SCWA 1E6SM 4QDMA 2QV4A 1Q6CA 4TVCA 4RE4A 1EH9A 3MKKA 4XZBA 3WFLA 2JF7A 1ITXA 4CN4A 3VMOA 1H5VA 1V03A 3OGRA 3PZNA 5ABFA 4AD4A 1W3LA 3PN8A 4JCMA 2X05A 3WDPP 1GQIA 2WCOA 5BRPA 3MSDA 1KGXA 2WWDA 2JIWA 2ZOXA 2NT1A 2VZUA 1DWFM 3NDZA 3WD1A 1LG1A 3QOMA 3DYOA 5A6BD 1JZ7A 1F9GA 1FP8A 1HP5A 4PN2A 2VUYA 3BH4A 3AZTA 1UG6A 3IJ7A 3WEZA 1DWAM 3N12A 3WUFA 1UQZA 3PHAA 2C7FA 2GDVA 4JFSA 2VO5A 3T0DA 2ZXBA 1XYFA 3ZJ6A 2AMGA 2D0HA 3VINA 1GOQA 1OSEA 1JNDA 3OG2A 2AAAA 5IHRA 2ZUNA 4PTXA 1UR9A 3GBEA 1AQHA 1LXMA 1UWSA 4GI9A 1U30A 4KRTA 1X6LA 5D9MA 4CU6A 1FA2A 2J75A 4GKLA 1KQZA 5DT7A 1N7QA 5M5DA 3KEHA 4H7VA 1N7NA 3BMWA 4TXEA 4TVDA 3SEPA 4MPKA 1CLVA 2ZUWA 4B15A 3UCQA 1OJMA 1BYAA 3VIOA 3WDIA 1J11A 3RDKA 1KGWA 2J7HA 1G5AA 5HPOA 3AXXA 4OIFA 4W8LA 3WN6A 1PX3A 3MMWA 4AEEA 4U5KA 1CGWA 3WF3A 2E24A 4GZIA 4D6EA 1B9ZA 4P8WA 3T0BA 4FF5A 1NWUA 1XCWA 3CMGA 3AMLA 5FD0A 4MB4A 3VIPA 3B9AA 1BVNP 3GDBA 3VGDA 4D6GA 2V3DA 2HVMA 3WNOA 2VR5A 3W6MA 2V5DA 1LG2A 2XUCA 5A8OA 1LL6A 1QNQA 4B9ZA 4CCEA 3ZJKA 4AEFA 4AMCA 4ATLA 4WLCA 4EK7A 1X1IA 3U5YA 3ARXA 3PZQA 5A95A 2XWEA 3L2MA 3SCOA 4ZENA 4DWSC 1V3KA 1VJZA 2DSKA 1UD8A 3ZJ7A 4CU7A 1R87A 4MNMA 3EDFA 1JL8A 2FH6A 4W7UA 4AC1X 4TTGA 4UNIA 3GBDA 3ARQA 2ZUUA 4MNKA 4AZCB 1TVNA 3WENA 1QI5A 1TCMA 1NP2A 3T09A 4ZE4A 3PZGA 3L4WA 1WKYA 3KL0A 5AYIA 3ARVA 5EFFA 5IDIA 4R5EA 3VIKA 1NARA 2CBUA 1E5JA 3LMYA 1JI2A 2GJXA 4JCLA 1MXGA 3AIUA 1C92A 5HOSA 1KXHA 4PTMA 2BRVX 1LF1A 4MADA 4AZ6A 4P7RA 1O7AA 4CKQA 1JFHA 5AC4A 4AIEA 2WZHA 1UD5A 4W5UA 3KL5A 3AMCA 3SCRA 3UG5A 1E6NA 2FDMA 4TOQA 1E0XA 5D8WA 3QGVA 1E6XM 1F4HA 1WZAA 2FHCA 2IXVA 1BPLB 1OT2A 2DIEA 2WC3A 5A3HA 7TAAA 1UKPA 1V02A 5HXMA 1JYWA 1G9HA 3CO4A 3AROA 1QNRA 2WXDM 1W91A 2YBTA 4UTFA 1JYXA 3GH4A 2E9MA 1W3HA 3N9KA 4GZEA 1TR1A 3VDAA 4U31A 3II1A 1G1YA 1OGGA 2XVKA 3SUVA 3WKZA 1GQKA 4IM4A 3ZJ8A 3AI0A 3PZUA 2V3GA 2EPKX 4UFIA 2VVSA 5FKYA 3AMKA 5CSYA 2NT0A 1Q6FA 3AZSA 4HA3A 3W29A 3RILA 3S2CA 4B9YA 1W9DM 4OZOA 5GNXA 2W61A 3K1DA 5FL1A 4TVUA 3T2PA 3OGVA 1EDGA 1RWAA 7A3HA 3E1F1 4ZXOA 3TTYA 3T2QA 2J7CA 3THDA 1MYRA 4N0RA 1MW2A 3WD2A 1UWQA 1B3YA 1JDCA 1OIMA 3WQVA 1WDRA 3CZKA 2J7BA 4GO8A 1IV8A 1ISXA 3WEOA 2BVTA 3DHUA 3BCDA 5LA0A 4UFKA 2GJRA 5E0FA 1CZ1A 2BVYA 3FAWA 1LL7A 1JZ3A 3AJ7A 4UR9A 3EMQA 3WF0A 1XD1A 3A47A 2CESA 4AY1A 4ACZB 3WQ6A 4PMNA 2PWDA 3WEMA 1XCXA 3T0AA 2VCCA 4GZJA 2DEPA 2QLYA 3RJYA 2QF8A 3PTQA 4AD5A 1OT1A 2J74A 1VBRA 4TUFA 4L4OA 2WLYA 1R86A 4MNJA 4WK9A 4QP0A 1KBKA 3AMDA 1JYNA 4BZYA 4P7LA 1NH6A 1J01A 2WDAA 4BQ3A 1MFVA 3N15A 4MNLA 1I1XA 1B3ZA 1A3HA 4B3LA 2V3EA 4GPNA 1GQJA 1WPCA 2BHYA 1QI0A 4AD2A 3F5LA 2RGLA 3KE0A 1RWHA 1J0MA 2WVUA 3DYPA 1H2JA 2XSBA 4U3AA 5LA2A 2VT0A 5HPCA 3NUKA 1V08A 3QHNA 1VIWA 4U2ZA 3WBEA 5A6BA 4MB3A 1UOKA 3BSHA 3ARTA 3VUPA 2Q8XA 5BXTA 1MQRA 5GNYA 4FLQA 4PBGA 1HX0A 4AW7A 4KGJA 1V0LA 1O6IA 4UCFA 1HVXA 2XJ7A 3UESA 4GI8A 2GVYA 5EMYA 1OD8A 2G4FA 1UQYA 3NDYA 3K46A 1QW8A 3VIFA 1FP9A 3DC0A 1D7FA 3ZOAA 4JIEA 2WVSA 3AHYA 1LWJA 3NCOA 1GVYA 4F9DA 1KFWA 2VURA 3U7BA 1JD9A 1WZLA 1VB9A 2C0HA 1H11A 1F4AA 4QLKA 4AZ5A 2W92A 3WF2A 2XIIA 4XZWA 1JZ5A 3W25A 1PZ2A 4PMQA 2JFEX 4W87A 2A3HA 1LOHA 1KBBA 1ZU8A 2A3BA 1Y7VA 5D9OA 1W32A 1WAWA 2G3MA 3WH8A 3ARRA 4JFUA 4J3VA 1K9TA 1LLOA 4CD5A 3VD5A 3SUSA 3BMVA 1EA9C 1XH0A 4JKKA 1C7TA 4QCFA 5I3DA 3MU7A 4LPCA 4AZGA 1C91A 1Q6DA 1TUXA 1VFFA 4AZIA 5CQ1A 4D1JA 3WQ4A 1E3XA 3QHOA 5AY7A 2WPGA 3BAJA 5BWFA 4TTUA 5GPRA 1VFUA 1HM3A 2ZX5A 4ML4A 4PTVA 5A6AA 5CJ5A 2Q1FA 1HL9A 3TTQA 1MVYA 1JDDA 2E9BA 4JAWA 1BQCA 4UFHA 2D0FA 1XHGA 1V3IA 2F8QA 1HJSA 5LYRA 3CZEA 2EPLX 3W26A 1UR2A 2V3FA 5A2BA 2V5CA 3JUGA 2EPNA 2FGZA 3THCA 3APGA 3UERA 2WMHA 1CXLA 1GHRA 4Z2IA 3L4TA 2YLAA 2CBIA 1XYZA 3W28A 5JBEA 1ZS2A 2JF6A 3RM9A 4H2CA 4NRSA 1OM0A 1I75A 2BRWA 1GJUA 1JG9A 1UH2A 4F9JA 1TVPA 4M80A 1TMQA 1V0KA 1GQLA 1E56A 3VDHA 4GQRA 1XRVA 4ACZA 5IHSA 3VU2A 1KXVA 2EJ1A 2YDSA 3W6LA 1WP6A 1KQYA 4W8AA 5HBFA 4PMDA 1GZJA 4UQBA 4HOWA 4PMXA 3ZIZA 2W66A 2VX4A 1V6XA 4D1IA 3FN9A 1XH1A 3OLDA 2ZX7A 1M53A 5BXPA 3CZGA 4UFLA 3HN3A 5EBAA 1Q4NX 3PZTA 4FK9A 4HPHA 2BY1A 3B9DA 4DM2A 1CXIA 1R7AA 6A3HA 2WCGA 1TZ7A 3LPOA 2D24A 3LPFA 2WWCA 1UD4A 1V02E 3UR8A 4C7GA 4PEEA 1B2YA 2BV9A 4WSKA 5F7UA 3VTRA 1E4IA 5CPQA 3AHZA 4LYQA 4UQAA 1GNXA 1W3KA 4PUDA 2BVDA 1A47A 4OJYA 1UR0A 1JI1A 3VPLA 3PTMA 3J7HA 2F61A 3L4UA 4D6DA 1NWRA 2VCBA 2YA2A 4PSRA 1TFVA 5JUVA 1GUVA 1WE5A 1EGZA 2DSVA 2WAGA 4YN5A 3SIMA 2WANA 4D71A 1X6NA 4WKHA 1DWIM 5TD4A 5KEZA 3WF4A 1WDPA 1N7OA 1C8YA 1FH8A 2EPMX 4AZHA 5CG0A 3SCUA 4PYSA 4P7QA 8CGTA 4CN1A 5DFAA 2J47A 4W86A 2DSZA 2J7FA 4RE3A 2W63A 2ZIDA 3K8LA 2PC8A 3VGEA 2Y8VA 1E55A 1HJQA 2WYSA 4GIAA 4W5ZA 2VTFA 4D6JA 1B0IA 4M1RA 4ATWA 1GONA 1QHPA 3GH5A 1UH4A 5BXRA 2WHMA 3ARUA 1EHNA 3M7SA 2VQTA 2YA0A 4BQ2A 1J0JA 1ZBCA 4P8XA 1JGIA 3DECA 1ZBVA 4H41A 4AISA 3ZR6A 1GOWA 3OZOA 2YL8A 2CCRA 1KB3A 1PEZA 4J28A 4Z2JA 4URIA 1MW1A 3F4VA 1HT6A 1OINA 1HJVA 4C7FA 1LWHA 3VIHA 1E6ZA 2Y8KA 4PRWA 3AIWA 5A8QA 1CDGA 1OJPA 4W88A 3CUIA 4P8VA 1UR1A 3POCA 2J8FA 4D6CA 1FOBA 2D23A 2A3CA 3RJXA 4CD8A 3L4ZA 1LL4A 2YLLA 1B3WA 4MTVA 5JIPA 4E8CA 1OJNA 1J18A 4K68A 1G94A 2WKLA 4NRRA 5EB8A 2VZOA 3OGSA 2WNWA 3VDBA 1FHDA 4UZUA 1PPIA 3LPPA 4EANA 2O9RA 2ZXAA 3BAKA 5ECUA 1DWHM 2EQDA 1ZB5A 4IPNB 4JZ5A 4W8BA 4HZ8A 5A69A 2WCAA 4M81A 1C82A 1GJWA 1V3MA 1CIUA 3VIJA 1C90A 1QNSA 2VRKA 1U2YA 3POHA 1GCYA 2XWDA 1UR8A 4P8UA 2QMJA 1EOMA 4CU8A 3CPUA 3AS0A 3WQWA 1AQ0A 1FH9A 4WJXA 1WNOA 3AIEA 4GXPA 2CBJA 3WMBA 4Y7EA 1QI3A 2WVVB 2CHNA 4P7OA 5AYBA 3RM4A 3BLPX 4CGTA 4M8UA 4P7NA 2XHYA 3LPGA 1J12A 1W3YA 3GYCA 4JKMA 3VD3A 2YIHA 1OD0A 3AICA 2EBNA 1XSKA 1JXKA 2VI0A 3WUEA 3AXHA 4AWEA 3VO0A 4AIOA 2WM0A 1CXFA 3NYDA 3CUFA 1WCGA 3WD0A 1NQ6A 5FIPA 4PCTA 4WSJA 3CHFA 3VNYA 1P6WA 3PZMA 1RP8A 1W1VA 2XFFA 3SCPA 3W82A 1E5NA 1J0KA 3CLWA 1RD6A 1M7XA 5E6YA 2GSJA 1BF2A 2BS9A 3AOFA 3FNDA 1QPKA 1W1TA 3CZJA 3FAXA 3NSNA 4WIWA 3AISA 5A6LA 2CPUA 2J7EA 8A3HA 2FH8A 3UG4A 5A6SA 3G6MA 1UA3A 1K9FA 2GJPA 1L0PA 3BAXA 3TTOA 1TG7A 3W27A 1GPFA 3UETA 4U33A 2CITA 4L4PA 2NSXA 4X9YA 1VEOA 3GNPA 3SCQA 3VOCA 3B9EA 2YL5A 3CUJA 4UQCA 1QHZA 1RP9A 1QVBA 1N7RA 1B3XA 2WMFA 1J9YA 2JIEA 2QHAA 1VEPA 3AHTA 5I79A 3VIIA 1US3A 2DQXA 1E1EA 1V0MA 4AZ7A 2F2HA 1BFNA 4JFVA 4J7RA 1M03A 1NWSA 1E0WA 2XVGA 2ZUVA 5IFPA 1F1SA 3L4VA 1HJXA 2WC4A 1UWUA 3VX0A 2DT1A 4E4PA 4AZBA 4JHZA 2ZWZA 1C93A 4A3HA 3WDRA 3WNNA 3CUHA 1JZ6A 4E2OA 3TA9A 5CLWA 4X0VA 1PX8A 3CHCA 3D5HA 3K8KA 5A8NA 1HXJA 2ZICA 2BHUA 2PF0A 4M56A 2OWWA 4M24A 2D2OA 1J0ZA 1BG4A 1CENA 4WKAA 4W89A 1OBAA 1DWJM 1W1PA 1DP0A 4PCSA 4W7WA 1W2PA 2DPEA 1EO7A 2ZX6A 3A4WA 1PJ9A 2XGBA 4JFTA 3W81A 3ZSTA 3O2LA 1UKTA 1NOUA 1JZ4A 4MB1A 1BLIA 2ZX8A 4LGXA 1SR0A 3T08A 4XV0A 1E15A 3WFZA 2D1ZA 2XGIA 4ZE5A 3PZ9A 4ZFMA 3WD3A 3F5JA 3K8MA 2WZEA 3FY1A 1WZMA 3BAIA 2WC7A 4UOQA 1OGBA 1JAEA 2X1IA 5I24A 1QOXA 3RCNA 4Z2LA 2IXUA 4W85A 1CYGA 1KCLA 2BY3A 2ZXDA 1WB0A 4W93A 3U57A 4OOZA 4Z2HA 3VGBA 2EEXA 3GZAA 4QAWA 5EFDA 3WD4A 1GVIA 3OBAA 5C71A 1EQPA 2WVVA 1ISVA 2E9LA 1VRXA 4JL1A 2WSPA 2E3ZA 4S3JA 2WB5A 4RE2A 4W84A 5CPSA 4BCEA 3IAPA 3ZR5A 5CSUA 4HMEA 4MJ4A 1ISZA 1AQMA 1XSJA 2QPUA 2X8RA 5I5RA 4MB5A 1SYTA 4EKJA 1MW0A 4DWSD 3W4RA 1K9DA 1JFXA 3DHPA 2HISA 1E72M 3TOPA 4ACYA 3MMDA 4JL2A 4UOJA 3AYRA 3KWXA 3SUUA 1W1YA 3IANA 1WDSA 3CTTA 1JD7A 4V2XA 4HMCA 2OLHA 3SUTA 4CD6A 1H3GA 1H09A 1WDQA 3NSXA 1YHTA 3WH5A 4D6FA 1W9PA 2VR4A 4DUWA 3ECQA 2VNCA 3HJEA 1Z32X 1HKKA 1K9EA 1NOWA 3DYMA 2OYLA 3WH7A 2FGLA 4HA4A 3IAQA 3MUY1 1GOOA 1HF6A 1HNYA 1MFUA 2OYMA 1VFOA 2CERA 3WBAA 1TA3A 1UZ4A 3U7VA 2FHBA 2BHZA 3MUAA 4A3YA 3VKKA 2WHLA 1ISWA 1VEMA 4AIUA 5DEZA 3K4AA 2WHKA 2UY2A 4UFJA 5DO8A 4H8VA 4PMVA 1E0VA 2XFRA 1CECA 1WO2A 2ZUSA 2YKKA 3S6TA 3F5KA 5ABEA 3CHEA 4HPGA 2CIPA 3NSMA 5C70A 3ARZA 2DGAA 2VZTA 3WL1A 3WIJA 1QW9A 6TAAA 1KXTA 3O9NA 4HOZA 1UH3A 1B90A 1XGZA 1HKJA 5I23A 3N18A 2E0PA 4Z2GA 1UUQA 3WL0A 1BTCA 4PMUA 1CGXA 2BXYA 1HM2A 1D3CA 2O92A 4JFWA 4J3UA 1IZKA 1E40A 1CGVA 4DUVA 3AS3A 1EOKA 4YHGA 4Z2KA 2AOSA 5ABGA 3UEQA 4LYRA 3VVGA 3OZPA 3A6OA 1JZ8A 3VD7A 1PZ3A 5D9NA 3MUZ1 2ZE0A 1B30A 3WUBA 3G6LA 3FHQA 3AS2A 3N04A 4M29A 2OSWA 1HMWA 2UWFA 2CBVA 1ECEA 1ZJAA 3WQ5A 4CUCA 2VZVA 1ZBKA 3IJ8A 2CKSA 2VC9A 2WBGA 3HU7A 5FL0A 3N13A 2BY0A 1CBGA 3FW6A 5D8ZA 4GINA 4HP5A 3CMJA 4UZSA 2VRQA 5E70A 1BSIA 2IUZA 4E8DA 1MQQA 3NJ3A 4J3WA 1H41A 1W2VA 2DT2A 2GUYA 3HMCA 2O9OA 4IPLA 4V28A 1OCQA 3W24A 4EE9A 1BGAA 1H0IA 3I3EA 1CTNA 1NP0A 2J78A 4CCCA 4OOUA 1MXDA 4DUXA 3KL3A 1HN1A 1NWTA 1E73M 5BRQA 2ZXQA 3FHAA 4GO9A 3K4DA 2WMGA 1J0NA 1W9XA 5A2CA 1JF6A 1BVZA 1K6AA 1QBAA 2Z1KA 2BY2A 1OB0A 2VX7A 4HU8A 3ZT6A 3CZLA 4BQ5A 1I1WA 2BNJA 1UHVA 1GORA 3OA5A 4QFUA 1TE1A 2NW0A 1HL8A 1LJYA 1M04A 1UWIA 2PWHA 2DDXA 3WMCA 2GDUA 2GK1B 2VL4A 5BROA 3AIVA 4YHEA 3WY1A 4FMVA 1E6PA 3PZOA 2WCSA 3WNPA 4IUGA 2YBUA 2V38A 3MS8A 4KRUA 2E8YA 1LQ0A 3CH9A 3WH9A 1HJUA 3WNLA 2VVNA 3N1AA 5A1AA 1GOKA 3SCNA 1Q6GA 3AZRA 1SMDA 1EHAA 1GHSA 5DMYA 3GNRA 1EGUA 1DWGM 4TX8A 5CLTA 3RIKA 1HJWA 2O9TA 1D2KA 4HZ7A 3SURA 2OSYA 4AD0A 4JHOA 4AD1A 5I6SA 2WZIA 2PWGA 5BYWA 1UD6A 4QLLA 2XM1A 2W4XA 2WBKA 1J10A 1BYDA 1UWRA 1EO5A 1JXJA 1ODZA 1VFMA 3ARPA 2XM2A 2J77A 1V3JA 3AIRA 1JDAA 4J3TA 4LX4A 3CUGA 1H49A 1RH9A 3VGGA 3WELA 2Z1SA 4FLSA 2OSXA 2A3EA 3MMUA 5A8PA 2VX5A 4ZXLA 3RM8A 2EO7A 1KXQA 4PMOA 3AMGA 3VIMA 4PUEA 4OUEA 1NM9A 1V6YA 2CKRA 3MO4A 5E9AA 1C8QA 2A3AA 3ZT5A 5IFTA 3OLEA 1C8XA 3WMSA 3WDHA 1XSIA 1BHGA 5FOOA 1CGTA 3OLGA 4A4AA 3EDEA 5HDRA 4BA0A 1CXEA 4MJ2A 1CXHA 3BAWA 4NSBA 2VMFA 1RW9A 3VM5A 3WQ8A 3BXWA 3PBGA 4KH2A 2XSAA 1PBGA 3QHMA 5GNZA 4RL3A 1BAGA 1E71M 1BGGA 1UYQA 2O9PA 2EPOA 3ZMRA 1UKQA 2OYKA 5I0DA 1E4MM 1FFRA 3GXIA 2E8ZA 3EBVA 3VX1A 1V6VA 5IXEA 1KR0A 2X0HA 1V3LA 6CGTA 1E9LA 1OWQA 4NZCA 1ZL1A 2D22A 4DWSA 1V6UA 4UQ9A 2X0YA 3U5UA 3AXIA 1GW1A 2TAAA 2ESCA 4W7VA 2JEQA 4KGLA 7CGTA 2ZWYA 3GNOA 2G3JA 5KZ6A 1CGUA 4FLRA 5CXPA 3VGHA 2J79A 4CD4A 1AMYA 5CGTA 5D9PA 3OIHA 3WSUA 3ARSA 3TONA 3AHXA 1E70M 2G8ZA 4XB3A 1ZBWA 2WVTA 1FHLA 4J3XA 1JIBA 4M82A 3IJ9A 3NIYA 1R8LA 1JNEA 3ZQ9A 1SFSA 4D6HA 4GQQA 5HNNA 4XUYA 1C7SA 1CXKA 4F8XA 2D3NA 2WMIA 1E3ZA 2DSUA 3EYPA 4UQDA 1EDTA 4AXNA 3PZIA 2J4GA 3CZ8A 2YDQA 2DH2A 1W3JA 3PTKA 2XVNA 1DHKA 4ATDA 4UFMA 1GOMA 1JF5A 1NOFA 2VX6A 1KR1A 1HN0A 3ZO9A 2Y24A 1CGYA 4HA1A 1H4PA 2C8NA 2GK1A 1MQPA 2EXOA 3OB8A 4CCDA 3QR3A 2VJXA 1WZKA 3AFBA 1PIGA 2XVLA 5A8MA 3VIGA 1TA3B 1OJOA 4BQ4A 4WF7A 3MV11 3MSGA 4OBRA 2XG9A 5GQBA 4CVUA 2MANA 3M46A 2W62A 1B3VA 4PTWA 1N82A 4D6IA 1AVAA 1HKIA 1QNPA 5CGMA 4UQEA 1EXPA 2CETA 3VMNA 2X2YA 3GH7A 2OWXA 4S3KA 3CBWA 3BC9A 1UKSA 4XX6A 4NF7A 2YOCA 4PMRA 5A2AA 4IISA 1IZJA 3VD9A 2QPSA 1X1NA 5DT5A 2YJQA 2G3NA 1J0IA 2UY5A 3W38A 1BG9A 3WDJA 1E4LA 3KZSA 5AC5A 4CVWA 2VQUA 4OKDA 3W53A 4H8HA 2Y2WA 3CGTA 3SCSA 5I2UA 1GOIA 3VILA 5CZKA 1B31A 2XYLA 3I3DA 1SMAA 1LXKA 3M07A 1E43A 2VZSA 4MDOA 3GM8A 4Q7NA 4DM1A 1BYBA 2YDRA 1QI4A 3AHVA 1CEOA 1VAHA 1B1YA 1FFQA 3SCTA 4F79A 2XPKA 4H8UA 2G41A 2VCAA 1HP4A 1HKMA 1V6WA 1V0NA 5BXSA 5M3WA 1G0CA 1MWOA 2YL6A 2E40A 2XFYA 2ZX9A 2WMKA 1UD2A 2WHJA 1CPUA 2JEPA 1JAKA 4H04A 1PX4A 4B16A 1QBBA 1ODUA 1RPKA 2WW5A 2XVPA 4AD3A 1YQ2A 3CIVA 3VDCA 1VBUA 1FH7A 2UY3A 3RPMA 1KCKA 1KWGA 2W67A 1EIBA 4X0NA 1RWCA 2CNCA 1X1HA 1R85A 2WMJA 5M03A 5JIWA 1E6RA 4HMDA 5BCAA 3TP4A 3A3HA 2VOTA 3MV01 3N11A 2CHOA 1R7OA 1N7PA 2W5FA 4HTYA 3A4XA 3RO8A 1UWTA 1OIFA 1BYCA 2PI6A 9CGTA 1DEDA 1IT0A 1HIZA 1U33A 1UA7A 1OGSA 2CXGA 2QMKA 2ZUMA 3EDJA 4U3CA 2B31A 3VNZA 3WUGA 1CLXA 3AS1A 3M6DA 5I78A 3GXMA 1ISYA 1JZ2A 1CB8A 5A6KA 4R27A 3EDKA 4LQ1A 3VD4A 4CN6A 1E1FA 1QNOA 3BGAA 5A6MA 3B8SA 4B3KA 4FLOA 1UKOA 4F66A 2FHFA 3MANA 3VGFA 1UZ1A 5FCZA 5ABFB 2XIBA 4AZCA 1DTUA 3EMCA 1J0YA 1S46A 4HZ6A 2D0GA 3AQUA 1Q6EA 2D20A 1PAMA 3AYSA 1HVQA 2PWEA 3WH6A 1E6QM 2DT3A 4J27A 1KGUA 4PMZA 2GFTA 4QLJA 4GI6A 3ALGA 4UOZA 4HOXA 2E4TA 4WKFA 3T2OA 1VJSA 2BRPA 2CEQA 3MUIA 4AYSA 1KWKA 4BS0A 3A4AA 4MAZA 2VRJA 1QI2A 4YPJA 2BFGA 2PWFA 1RWGA 5C8BB 1VENA 2J7DA 2BXZA 1XD0A 2JE8A 2ZUTA 2DT0A 4EAMA 3BAYA 3W37A 5E0CA 2PBOA 4D72A 3UR7A 4PMYA 2WKGA 5M17A 3GXDA 1EDQA 1JYVA 2PB1A 4U2YA 3ZM8A 2X09A 2PBGA 2J7GA 4Q22A 3EDDA 3OLIA 3N17A 3PZVA 2W91A 3ZSSA 5CPTA 3FXYA 5I77A 2J25A 2DH3A 1PIFA 4LXFA 1HMUA 1ZJBA 4PSPA 2RGMA 2Y5EA 3WDQA 2Y4SA 3UG3A 1VF8A 1W9VA 1XH2A 1UD3A 2JALA 3SCVA 1W9UA 4ZEPA 3ARYA 3RMEA 3GTNA 1I8QA 2CYGA 1H1NA 3VMPA 1RWFA 1CNVA 3SUWA 3D3AA 3L4XA 5E6ZA 4V27A 2DIJA 3AIQA 3EMZA 5DF0A 4BF7A 2DSWA 3L2LA 1E4NA 3I3BA 4DWSB 3WNMA 3ZT7A 3WNKA 4CD7A 3ARWA 1XV8A 4OBSA 2OWCA 1QHOA 3AIBA 1C3FA 1X1JA 4TX6A 4MDPA 1MW3A 2G3IA 3CHDA 5A94A 5A6JA 3L4YA 1J0HA 4N42A 4HU0A 4MAVA 3W0KA 2E22A 1G01A 3QOKA 1CWYA 3GXFA 1ESWA 1UR4A 3ALFA 2UY4A 3IK2A 1W9BM 4KMQA 4KWUA 2J62A 4C7DA 2WLZA 3BLKA 1L8NA
chains in the Genus database with same CATH superfamily
3H4GA 3QKEA 1L6FA 2PP1A 3ZYZA 1US2A 1V3HA 3C0QA 3ERPA 2QCLA 1H0GA 2WSKA 1M7OA 4U5IA 4Y8EA 3P62A 2NX3A 4B5TA 2YL9A 1EQCA 3H4XA 2J8GA 3H2OA 3QPYA 2ANUA 5JBFA 5E09A 4JNZA 3SJ3A 4F0MA 3SCWA 4LSBA 2BMBA 3URAA 1EH9A 4WY0F 4FXFA 3DFQA 3NPWA 2FJUB 2ZZ6A 1JPIA 4XD6A 4PTDA 1Z69A 4LBRA 1HGYA 4LY8A 3VK5A 5J04A 1TPB1 4YL2A 3SN4A 2HS6A 4NAFB 4AD4A 2OEKA 3QPEA 4QIUA 4HN8A 4C6CA 1ZHAA 2QGYA 4HYWA 4JQ1A 3UVIA 4X2PA 1VR6A 3QOMA 3H22A 4LTSA 1GZ1A 3PAJA 2CZVA 3QW3A 1JZ7A 1HP5A 3A9IA 4PN2A 1K6WA 3BH4A 3M43A 4WXZA 5EKYA 3PHAA 1FKWA 4Q8TA 1XYFA 2AL2A 2AMGA 4F2TA 4GFSA 3GFXA 5AZ0A 3OG2A 1F8MA 4XO7A 4JEJA 4ZO9A 4PTXA 5I3JA 1UR9A 2CC0A 3GBEA 4DWDA 4GI9A 5JVLA 3EZ4A 3O15A 1J5TA 2J75A 2QCFA 4GKLA 4G8TA 5CC6A 3SFKA 4TVDA 3SEPA 3A3WA 2P0IA 2ZUWA 1FY6A 1FWAC 4IGSA 3BLEA 1H61A 3THAA 4C6EA 1XM3A 2YXOA 3WDIA 2CZEA 3V7PA 2C13A 1KGWA 3MWAA 3P82A 4OIFA 3EEGA 4QJ4B 4NZ5A 4GZIA 2TMDA 4D6EA 2IKJA 3LLFA 1S2CA 3T0BA 4FF5A 1XCWA 3CMGA 3UWYA 3BCJA 5L9FA 2Z4GA 3WNOA 1WUFA 4R85A 4IQJA 4H9VA 4CQBA 1P1XA 1LG2A 1MNZA 5I09A 1UJPA 1EPXA 4B9ZA 4PCPA 4UB9A 3ZJKA 1NVMA 1XI3A 4MY9A 5DQPA 3IACA 1JCYA 1R6WA 4WLCA 1BTMA 3U5YA 3ARXA 3TK7A 3L5LA 3SIZA 2R94A 4HJWA 2XWEA 4DBDA 4U4MA 5AYXA 1IXPA 2H3BA 4JTIA 1V3KA 1F6KA 2X30A 2DW6A 4JBRA 3T4WA 4WZHA 1UD8A 1R87A 1LT8A 2Q3OA 2FH6A 1FWDC 4AC1X 1GTEA 4NZ1A 2OPJA 3NZGA 3QV6A 3AALA 1KRCC 4JXCA 3T1GA 4ZE4A 3LHTA 4O4WA 2C19A 1P0EA 3WLLA 1KCXA 2A4AA 1K8ZA 3VIKA 2PDCA 2CBUA 3LMYA 2GJXA 1OX4B 3AIUA 4OU1A 1JPHA 1TIWA 1KXHA 4O0KA 2FZMA 2PDFA 3DGBA 2WZHA 3SY8A 4MWAA 2HDJA 3HURA 4W5UA 2DJXA 3SCRA 2R1NA 4B4FA 3LHWA 3UG5A 1PDYA 1E6XM 2FHCA 5D09A 2YYTA 2F2KA 1OT2A 1BPLB 2WC3A 5A3HA 2VGFA 1JYWA 4WGHA 1LM1A 3C8FA 3CO4A 1LP6A 1QNRA 3P8JA 4AU0A 3SR7A 1SO5A 4NASA 4JDYA 3I7RA 4JHMA 4FNRA 3W7JA 8XIMA 4PRTA 3N9KA 3QPZA 4AB4A 1TR1A 3IRSA 3WKZA 4UMCA 5FSEC 3LX9A 1J79A 4NL1A 2RAGA 4MKNA 3M5VA 3R6IA 2EPKX 4Q3MA 5CSYA 3RILA 3S2CA 4B9YA 2QJMA 1W9DM 4OZOA 5FL1A 4K8EA 2WJEA 1UUMA 3SSZA 2VFEA 3E1F1 3T55A 1XX1A 2V5KA 3WG6A 3T2QA 1Y0EA 1MYRA 4N0RA 1B3YA 4YTRA 2OVLA 3TSMA 2HE5A 1W8SA 1WDRA 4NJHA 3KCLA 4PUKA 2BVTA 2BTMA 3HB9A 4RJEA 2VUNA 1U5JA 5PTDA 1PKMA 4IIDA 2QNEA 4UFKA 3EWUA 5AYYA 5E0FA 2BVYA 3FAWA 4UR9A 2FVKA 1CX9A 2DUZA 3WF0A 3TYDA 3A47A 3COTA 1YBQA 4AY1A 3GRIA 4PB5A 1WDWA 2PWDA 2VCCA 2PLKA 2L5HA 3RJYA 2IQDA 4ICNA 3V18A 3BV4A 3C5QA 1BF6A 3PTQA 2W9MA 4AD5A 5DCDA 1R86A 2DZBA 1IF2A 4BI5A 1A4MA 1A49A 4PB3A 4HYRA 1I1XA 1B3ZA 2V3EA 4O15A 4GZ7A 1TJ0A 1A5KC 4C6FA 3MCOA 3UWZA 1RWHA 1IEXA 4XAFA 1W1B1 5HPCA 4OV4A 1VIWA 1X96A 1ZPTA 4JGDA 4LUTB 4XSLA 1G7UA 5A6BA 4MB3A 1UOKA 4FP1A 2Q8XA 5BXTA 3ZWSA 5TIMA 4J9JA 1UMYA 1TV2A 2ISWA 3H70A 4UCFA 4H7CA 2P3ZA 1AL7A 1EKOA 2ZDRA 2G4FA 3UJEA 3OIXA 2WVSA 1RK6A 1TREA 1I45A 3G0UA 2SFPA 2JK2A 3NVTA 4J2MA 1WOBA 5EY5A 3KZPA 3WLKX 5AC6A 3Q58A 3PUEA 3CQ0A 3KBJA 3S5ZA 1JR1A 1KBBA 3BANA 5BNKA 2G3MA 3WH8A 1P7TA 2QCDB 3VD5A 2VFDA 3SUSA 4UNLA 4O57A 1C7TA 4QCFA 5I3DA 3PPHA 4N2YA 1GG0A 1Q6DA 1LUCA 1PKNA 1DPMA 3QHOA 2PDBA 3ISIX 1VFUA 3M0XA 5D2VA 2VWTA 4G7EB 3ITXA 3B0VC 3O0KA 1WDDA 1MVYA 1JDDA 2B4GA 3NPVA 1NSJA 4UFHA 4KCTA 1XHGA 1V3IA 1OJXA 3W26A 2FTWA 1UR2A 2V3FA 3JUGA 3B40A 2EPNA 9XIAA 2QVHA 4H1ZA 2PLCA 1RPXA 4K1WA 3UGRA 1EF3A 5FJPA 2CBIA 3EWBX 5JBEA 1ZRQA 4Z1CA 2FMOA 3M64A 5HQEA 2IMRA 2HNEA 1I75A 2HVNA 4M80A 1V0KA 2XH7A 4KKXA 3FEMA 5IHSA 1A5NC 3VNMA 4WY0B 3CV2A 1OC5A 4D9PA 5DXYA 3HPSA 3ME3A 3IEBA 1Z42A 5F1VA 3FXGA 2YDSA 3NTYA 2F7FA 5FF2A 1G4PA 1KQYA 3P93A 4W8AA 3G24A 4HB7A 4UQBA 5C9XA 3LEPA 2OJPA 4K3ZA 3ZIZA 1IWBA 2W66A 2VX4A 1V6XA 4D1IA 3ZXWA 2VEMA 2ZX7A 4MWAE 1U5HA 4UFLA 3IGSA 1Q4NX 5EBAA 5XINA 3S1UA 1QO2A 2WCGA 3MT1A 2Y7GA 1K03A 2QCEA 2WWCA 1D3HA 3CLMA 4PEEA 3I6RA 3RITA 3W01A 2FQIA 2Z2UA 3VOHA 1E4IA 4GUHA 3M0IA 1TQXA 4IQEA 4BEQA 1TX0A 5LZLA 3LGDA 4NJJA 3A64A 3KRSA 2C1GA 2BVDA 4F0RA 1O60A 3J7HA 3L4UA 1WBHA 2YGYA 3RK8A 2VCBA 2YA2A 3E96A 3FSUA 4LU0A 3NWRA 4UMAA 1GUVA 2CU0A 4ML9A 5HQMA 2BVWA 3N6JA 3U0HA 1FDYA 1ZAIA 4O1BA 2BP1A 4Q8MA 1X6NA 5TD4A 1WDPA 2F6KA 1C8YA 2EPMX 1PHQA 3EWZA 3PAOA 3S2NA 1S5VA 2XIOA 4PYSA 3URNA 5U7SA 5DFAA 5LNUA 1GJPA 4LYKA 2CLOA 1QPRA 4LH8A 5D2WA 3ZLHA 2Y8UA 1VHCA 3MY9A 1OFAA 1RUSA 1S2WA 2NWSA 1YXCA 2BZNA 4LC6A 3RYSA 1R38A 4GIAA 4ATWA 1UASA 5BXRA 1UH4A 5GJNA 5K3VA 3ARUA 3M7SA 3N2BA 2YA0A 3PBVA 1J0JA 4P8XA 1XLIA 1WKFA 3IGUA 3XIMA 4AFYA 3ZR6A 4DELA 3ONBA 4FZIA 1KB3A 4QX4A 1PEZA 4HYVA 1RVGA 2PU1A 1MNSA 1MW1A 1HJVA 1W1A1 2HVOA 1THFD 4WJ8A 3HFYA 3VIHA 1HTIA 4PRWA 3UD6A 5A8QA 4FI4A 1CDGA 4HQVA 5D05A 1H7XA 4E8GA 1XP3A 4L4LA 3CUIA 3M0LA 4P8VA 4F0KA 3KVKA 3GDLA 2CLKA 1FOBA 3D3FA 1GGOA 3W7KA 4WQ6A 4QBXA 4Z1AA 4E8CA 1UWAA 2HS8A 1DV7A 3OGSA 4ZO8A 3GS6A 4YXGA 3LPPA 2YBVA 5KITA 2BBFA 3BAKA 4TIMA 4PC8A 3BQ6A 1ZB5A 1EJSC 4JZ5A 5A69A 2WCAA 4M81A 1VRDA 4QE1A 1GJWA 2A7RA 8XIAA 2YPIA 3PQIA 2VRKA 1XDJA 3POHA 5IBXA 2DZPA 2XWDA 3TNOA 1UR8A 4K6AA 4P8UA 1W5QA 1EOMA 3R5EA 5HJXA 3GR4A 3KAOA 5D04C 1TZZA 4Q8VA 5C55A 1YE6A 3AXMA 4WJXA 2VM8A 4JN7A 4GXPA 4DX3A 3WMBA 2VGGA 2CHNA 4M6VA 3O07A 3BOFA 1N7KA 4M3PA 5AYBA 3LV5A 3BLPX 4FB7A 1J12A 1W3YA 3F2DA 3UJFA 3VD3A 1SW7A 1XINA 3JZUA 1JXKA 3WUEA 2O7SA 1CXFA 3WD0A 5AZ1A 3ABQA 3BW3A 3CHFA 3VC5A 2FB3A 4JNYA 2RUSA 3AJXA 1W1VA 2XFFA 4KFNA 1J0KA 3CLWA 1EJXC 2PDIA 1UZDA 1XCFA 5E6YA 2XSXA 1BF2A 1NF0A 3AOFA 1DYSA 1W1TA 5A6LA 3AISA 5A6SA 5G2WA 3MWCA 1K9FA 3VXGA 1YPXA 4DJFD 1O5KA 5LHFA 2CITA 4W9TA 4X9YA 1VEOA 3IJLA 2FVLA 3GNPA 3EEZA 3SCQA 2YL5A 4OQVA 4RV3A 1N7RA 3GK0A 1OF8A 1KA9F 4LVBA 1EEPA 4XK2A 2XH0A 4Q8PA 3NL2A 4YJ5A 2CLLA 4J7RA 1M03A 1KFBA 3NQCA 4CNPA 2VEFA 3LRLA 2HWGA 1HZYA 1XLDA 2WC4A 3B3DA 3FLUA 4I90A 3TNBA 1UWUA 4IHCA 4S3FA 3BZGA 3BGJA 3VX0A 1BD0A 3HPZA 5I07A 3EWYA 1NFGA 2ZRXA 3URBA 2CLFA 1RLDA 1KTCA 3MKCA 3AYVA 3H2AA 2CXEA 3TA9A 3IVSA 3CC1A 1JPKA 5EA9A 3ANVA 1PX8A 3S9YA 3CHCA 3CB8A 1H50A 3UPWA 4NP7A 3D5HA 3LCLA 3SFWA 1OFBA 5K7JA 3C3UA 2V81A 1L6SA 4KW2A 3SJNA 1UB3A 3OVPA 4QM1A 1DWJM 4CQDA 4YTTA 1YXDA 4S38A 1Y8BA 4G9PA 3M0JA 4DPPA 1NOUA 2B7QA 4MB1A 1HL2A 2VEIA 4XV0A 3C0LA 2XGIA 3M6YA 3PZ9A 2YW4A 1Q2RA 4K1GA 1QPOA 2VC5A 2WC7A 5JH1A 3U3HA 1F61A 3P60A 3FEQA 1RY0A 2PDUA 5I24A 3RCNA 4Z2LA 2VDHA 4HSOA 1O1HA 1UJQA 4LUSB 3VGBA 4QAWA 3OBAA 1R30A 3GNDA 4MMWA 4C1NA 3QZEA 1GVFA 3LBCA 5DBTA 1YE4A 4BCEA 1EZ2A 3UWEA 1AQMA 4L7ZA 4MB5A 1MW0A 4DWSD 3TN4A 1XDLA 3G3DA 1YDVA 2HISA 3K5XA 4YU1A 3O6DA 1E72M 4H3DA 3H55A 4IFKB 4UOJA 3AYRA 4L1GA 4Q6XA 4L9XA 1WA3A 4JTGA 3F03K 1YIXA 1XIIA 2G50A 4PUNA 4CD6A 1H09A 2A21A 3VNLA 2CZ5A 1YHTA 5FF0A 3QMSA 3N3TA 3ECQA 1Z32X 4UUIA 4CQAA 4XISA 3W75A 1HNYA 3WBXA 2OYMA 3R25A 3PF3A 2CERA 1TA3A 2ON3A 4JTUA 2Y0FA 1Q3NA 5CEWA 1QWGA 2WHLA 4AIUA 3GKFA 4H8VA 2ZTJA 1V93A 4GRSA 3CHEA 4GYPA 4BI6A 3WL1A 1FWEC 6TAAA 1RY8A 1UH3A 1XGZA 3SAZA 1HKJA 1S5WA 5FJIA 2E0PA 3DCPA 3FS2A 4XBKA 4US5A 2VGIA 2Q3RA 1BTCA 3HQPA 3ABSA 4PMUA 2R9RA 4J3UA 2BB0A 3C0JA 4I9JA 5DMMA 4NJIA 4DUVA 4Z2KA 5FEPA 3KS5A 5CJMA 3M9YA 4DNHA 1PZ3A 5D9NA 2OSWA 2UWFA 2CBVA 3O1NA 4O10A 4CUCA 4HNCA 5FEZA 2CKSA 4AQLA 3N13A 5DELA 3CAWA 4X63A 5D8ZA 1O5RA 4GINA 4UZSA 5HK4A 2VRQA 1I0BA 1PWMA 4A8IA 3TWBA 4IXXA 1H41A 1W2VA 1FDJA 3HMCA 2O9OA 3LRKA 1NP0A 2PLJA 2J78A 4CCCA 4OOUA 3DI0A 4L56A 5LKYA 1HN1A 2TYSA 1E73M 2DZAA 1POJA 2ZXQA 4GO9A 2YSWA 3R8HA 4DJFC 5A2CA 3AO0A 4GUGA 4UBPC 3UZWA 4HU8A 3TLQA 4MVAA 1F3XA 3ABOA 5C0QA 4BQ5A 1P0BA 1XGDA 3LXBA 1UHVA 3R0UA 1I2PA 2EG7A 2PWHA 3TX9A 4QNWA 2A79A 1P6CA 3RLHA 1ZUAX 2A85A 5F1UA 4WEVX 4XZHA 1FWHC 2P8BA 2PCEA 1DQUA 5REQA 3MS8A 1RAKA 4F0SA 3V0SA 2DQWA 2VVNA 4FXSA 2Q6ZA 3SCNA 3AZRA 2A3LA 3NAVA 1EHAA 4NILA 4A21A 4N4PA 3STGA 4NX5A 1NFPA 8TIMA 1UIOA 3V0TA 4N7QA 3KBUC 4HBKA 1VCFA 3SURA 4G56A 4KS0A 3ABRA 4PR4A 4PL1A 2BGSA 3E6EA 3W71A 2E1DA 4A35A 3TUUA 3T0TA 3UJSA 2W4XA 1BYDA 2A2IA 1UWRA 2QQ6A 1MMFA 1TWSA 1JXJA 3T40A 1VFMA 4Y9OA 4QG9A 1MEIA 1EJWC 3WJWA 2HK0A 2Z1SA 2NX1A 2VX5A 4ZXLA 3F1QA 2BXVA 1S2AA 2HSAA 3EWDA 2Z1WA 4A05A 5T9CE 4OUEA 2B7OA 2OKTA 1V6YA 4WDTA 1SO3A 2NQ9A 3ZT5A 1XLKA 3TJXA 3F59A 1A5BA 1LRNA 3WDHA 1F8IA 2G96A 2PD5A 4EPDC 3D6NA 4S1FA 1CGTA 4H2HA 3EDEA 3GUGA 5B7ZA 1X7IA 1RW9A 4WXYA 3BXWA 3PBGA 4QE5A 2PFHA 3FVMA 2HQAA 4G6CA 3NA8A 4EVZA 5LIWX 1T0OA 4O11A 1AW5A 1E4MM 2EAWA 4TO8A 3S5YA 2E8ZA 3VX1A 1VFLA 2GWNA 5D37A 3NEVA 1R9YA 6CGTA 1E9LA 4NZCA 4UQ9A 3AXIA 2P50A 2TAAA 2F6XA 2JEQA 4MJMA 2G3JA 1FHVA 1M5WA 5KZ6A 4ZCWA 1K70A 4NG3A 3VGHA 3FK4A 2V82A 3N2CA 4O19A 5CGTA 3WSUA 1AH3A 3ARSA 3DAQA 3STPA 2C0AA 3QQWA 4IUOA 4H8NA 4XZNX 4M82A 3ZQ9A 3S6OA 1SFSA 2E6AA 4ENLA 1KKOA 3NZRA 1JRCA 2D3NA 2YCLB 1GEQA 2REQB 4MLJA 3D0CA 2GUBA 2INEA 4L64A 3W9ZA 2XVNA 1DHKA 4HTBA 4ATDA 2ALDA 1IXNA 1GOMA 1JF5A 4GC4A 5I3KA 4V1XA 2Y24A 1GEHA 3LHYA 2GK1A 4LBUA 3P74A 4BY3A 5H2ZA 3IGHX 2YDAA 3QR3A 1PIIA 1OCBA 4FA3A 4HK6A 4OT7A 5G4WA 4WF7A 4NAFA 3MV11 4OBRA 5GQBA 1FVPA 3M46A 1XYMA 2IS7A 2X7VA 1QO5A 5K4XA 3NOEA 2CETA 2OLAA 1SW3A 1EWDA 2FDSA 4DLOA 4NKCA 1UKSA 4H6QA 3WLTA 5A2AA 3STCA 1W56A 3VD9A 2UY5A 4PUUA 3T8LA 2ZRYA 1YTEA 1SJAA 4L1XA 5AC5A 3BG5A 3Q37A 2DZUA 4LV4A 3TMQA 3W53A 5I2UA 4XZIA 4ORMA 3RLVA 3I3DA 2R1LA 1LXKA 1E43A 2VZSA 2GQ9A 4JTQA 2X1TA 4MUZA 4AG0A 4E2DA 1I2NA 2YW3A 3SCTA 4F79A 1ZQ5A 2G41A 1IGSA 2VCAA 3O0FA 1HKMA 2OFJA 5BXSA 5AVNA 4Y96A 3FCPA 2WMKA 3NQVA 3WJYA 1LLZA 5FF3A 3W1QA 4IIFA 2OZTA 4N9CA 4EWJA 2XVPA 1JUBA 4OWGA 4Y9PA 3LOTA 3VDCA 4Z17A 3B0XA 4DN1A 2W67A 3VAVA 4M19A 4I7VA 5FACA 1Z44A 5M03A 4GY0A 3A3HA 2VOTA 3MV01 3N11A 1RALA 5BOEA 2CHOA 4O13A 1ONXA 3SGZA 4HTYA 1VYRA 3A4XA 1UWTA 3PTDA 4S3GA 1DEDA 1IT0A 2AAMA 2V2HA 3SSJA 2E68A 1MUWA 3EDJA 3PM6A 1R2TA 3AS1A 1DXEA 5I78A 1L6YA 4LQ1A 3GVRA 4CN6A 5GJPA 1E1FA 1QNOA 4H19A 4PCNA 5AHLA 3B8SA 3VGFA 3FA5A 4AAJA 1JCTA 1UZ1A 1RQEA 4HZ6A 5HMFA 1X97A 3C86A 5LGZA 1MSSA 3AQUA 1YADA 3CWOX 3DESA 2KXRA 3B8VA 1EC7A 1OX4A 3DFOA 1KGUA 4PMZA 2QCGA 3KOYA 1TMHA 4TU1A 4UOZA 4HOXA 3IGXA 4WKFA 3TYEA 2Y6ZA 4DI8A 1KWKA 4UR7A 4BS0A 1U83A 2X41A 1QI2A 3CU2A 6ENLA 3CMFA 3ITCA 2PWFA 4JN6A 1RWGA 3R89A 5C8BB 2J7DA 7REQA 1V4YA 2ZUTA 2DT0A 2VYOA 3BAYA 4LEFA 4EAMA 4RNJA 3C2YA 3MMTA 3W7GA 1M7PA 3UR7A 4B5NA 1SW0A 4PMYA 3W7MA 5AHNA 1Q2SA 4F4RA 1UROA 2PB1A 4X61A 3CK5A 2XINA 4FSAA 2PZNA 2PBGA 3H2FA 2J7GA 3TEVA 3OLIA 5CPTA 3FXYA 1FKXA 5I77A 2J25A 1EJUC 2DH3A 5BU9A 1ZJBA 3O8AA 2Y5EA 2MNRA 3V1HA 3WDQA 1GYMA 2GUUA 4QHRA 3UG3A 3GC2A 4C5YA 4MIMA 4AVNA 2CYGA 3GFYA 2XZ9A 1RWFA 3PUOA 5G1TA 3SUWA 3V5FA 2CLHA 3RHGA 3EMZA 1RLCL 3L2LA 5CCZA 4RDZA 1A3XA 4DWSB 3IARA 2QUNA 4CD7A 4REQB 5D2TA 3P80A 2OWCA 1OF6A 3AIBA 4Y6GA 1DE5A 1EYEA 5A94A 3CHDA 5A6JA 4MAVA 4PFMA 3LCFA 1CWYA 3GXFA 1UR4A 2UY4A 3CT7A 4KWUA 3LI0A 5FJRA 4YNGA 2PDXA 3LK6A 1L8NA 4J3SA 1Z48A 3CTLA 4AUBA 1IHIA 4XWUA 2OODA 3TAKA 1LWIA 1RBAA 4TQTA 4QCEA 2EHHA 2GJNA 1R3YA 2XTKA 5D4YA 3W2KA 2Y61A 3TAOA 4KWOA 2GJXB 4LVDA 2D3LA 4EOUA 3C3NA 3KBMA 3E02A 4HHPA 3QSRA 4O1AA 4MWAB 3HF3A 3GG8A 3VM7A 5ABHA 4R9OA 2PPGA 1VPXA 1Q6CA 2OELA 4TVCA 4O1CA 4OTKA 3SQSA 3WYZA 4YIWA 3TN3A 4YVPA 4XZBA 4LV9A 4AWSA 2PU0A 2OQLA 4S3AA 3L21A 4NZ3A 5M1TA 1TTQA 3S8HA 4CN4A 4UC5A 3E0WA 5ABFA 4X22A 1LQAA 4JCMA 4Q32A 3AC0A 2NQZA 1KGXA 4DLQA 2JIWA 2ZOXA 3Q94A 1DWFM 1H63A 3NDZA 3A5VA 2OO0A 1XLBA 3DYOA 1XS2A 1EP3A 4ZO6A 3RXZA 1WV2A 1X7FA 1UPPA 2QJGA 3AZTA 1DWAM 1OK6A 3L0KA 3WUFA 1U1JA 3G1DA 3L66A 2G95A 3ZJ6A 3CO8A 3BOXA 1OFEA 4WDUA 3VINA 1JNDA 2G4JA 3I10A 3R4IA 3S4TA 3DXIA 4WOQA 1XYCA 5IHRA 3EA2A 3WBYA 3JR2A 1UWSA 4KRTA 5D9MA 2QCDA 4N9EA 1K7FA 5C2XA 4JTDA 1M1BA 1SM9A 2RDTA 3KEHA 4IL2A 1ICQA 3REQB 3QM3A 3MCNA 3H8AA 4FX7A 1YBQB 4DO7A 4IFRA 4IPPA 2Z25A 3C2RA 1OJMA 2EF9A 4LANA 3WQCA 1ZZMA 3WQEA 4C91A 1G5AA 1WAUA 3AXXA 4U5KA 1FDZA 2OR2A 3WF3A 5CGQA 1B9ZA 3TIMA 1NWUA 3AMLA 4MB4A 2OX1A 4CEXC 2CFFA 3TVAA 1K77A 3W84A 1Q4WA 1P0KA 5D32A 3WLRA 1OFDA 1LL6A 2ODOA 3RCYA 2V9DA 2ZZ7A 4GYFA 5C7VA 3PWAA 4EK7A 1B4EA 4GVFA 1VBJA 4RR4A 5DBUA 4DZAA 4ZENA 4ADTA 2PURA 4TX9A 4XD4A 4C6KA 1R9XA 5MKGA 2PE4A 4MHBA 3EDFA 3NM1A 4W7UA 5T26A 3WBWA 4R34A 4UNIA 4MNKA 1TVNA 3MYPA 1QI5A 2A6LA 2OOFA 4UTTC 4QNEA 1WKYA 1KRBC 5AYIA 1BRLA 1YDNA 5IDIA 4R5EA 4PEKA 1JI2A 4ADUA 4JCLA 1DHPA 3CV1A 3MC5A 3TA6A 2GOKA 3PWIA 1O7AA 4Z1YA 2O56A 1H51A 2BG5A 4KCVA 1K8CA 1UD5A 1GW9A 2C6QA 5BMWA 3KL5A 3KLKA 1N8IA 3TYZA 1ONWA 1PXGA 1PZ1A 1E0XA 4HSNA 4DXXA 1PO9A 1F4HA 1JDEA 1ALDA 1WZAA 2GVGA 2WV8A 2YFNA 4O8RA 3VOGA 7PTDA 2IXVA 3UA4A 1V02A 2WSYA 3KW3A 1TIMA 4J1OA 3VFLA 2YBTA 4UTFA 1HKWA 1L6WA 2XH4A 4DHGA 3GH4A 4JTKA 4V33A 5FAGA 3V35A 3LBOA 2NWRA 3WLQA 4U31A 1OGGA 2XVKA 4P5UA 3SUVA 3B8UA 1GQKA 3FKRA 3MUXA 1DXIA 2PWVA 2V3GA 3UYCA 2E5DA 5FKYA 1XLFA 1LLQA 4HA3A 4KCWA 3EX2A 4GJIA 3W29A 2R24A 3LCHA 4HCDA 2OXNA 5DRCA 5JMUA 1ICPA 3QLDA 3RX4A 1EDGA 5BW6A 4ZXOA 2VZKB 2X42A 4YVXA 3EKGA 1C8VA 1IIHA 1GYLA 1KBLA 4Q4PA 3FVDA 1OIMA 1S3HA 3TTEA 3WQVA 2EG6A 3I6EA 3HGOA 3CZKA 2J7BA 3PVFA 3FYOA 1ZFJA 4GO8A 5IRPA 3IVUA 2GJLA 5F2MA 4FNQA 2W0UA 4F48A 1XKYA 5F4XA 2OEJA 1IEQA 3DX5A 3QY8A 4DZ5A 1LL7A 3AJ7A 2YB4A 1F3WA 4IIHA 3KFTA 5CPNA 2CESA 5G5IA 1N55A 3WQ6A 4PMNA 1GZGA 1Z7AA 3T0AA 4GZJA 1AD4A 3SRDA 4CQCA 2QLYA 2QF8A 3TZFA 4DZHA 2ASHA 3AMDA 3W7CA 5CPLA 1E0TA 5D33A 3HPXA 4BZYA 4P7LA 1J01A 1TQJA 1MFVA 1OFRA 3N15A 3T78A 3VABA 3IIPA 4GPNA 1KM5A 3AWNA 1QI0A 4UTKA 3N2OA 2B7NA 1HQTA 3SZ8A 3GE7A 5J5DA 3KE0A 1DIOA 4FS9A 1V6TA 1H2JA 2XSBA 3N9SA 2DORA 5FI8A 1QPNA 1YLVA 4GCXA 4BWLC 4NT0A 3FJ4A 1OEPA 4O0ZA 5BOOA 3BSHA 2J13A 3VUPA 1MQRA 4FLQA 4PBGA 2VEPA 3QQ0A 3GTHA 4AW7A 2R8WA 4KGJA 2QUUA 4Y9AA 1TUFA 3BJFA 3GX9A 4EF8A 2CHRA 1G69A 2GVYA 4AY8A 3PP7A 1QW8A 5G1YA 1D7FA 3ZOAA 3AHYA 3BK0A 4H9UA 1TWDA 3NCOA 2FFIA 3U7BA 2ZTKA 1JD9A 1EC8A 1WZLA 1VB9A 2W92A 4KEUA 1DJXA 1RV8A 1JZ5A 3LGEA 5LIYX 5T9BG 2V69A 3G8EA 2NQ5A 1PZ2A 5F2IA 1RXOB 4PMQA 4WVXA 2JFEX 1LOHA 4ZODA 2C14A 2A3BA 5D9OA 1W32A 1WAWA 3S3GA 1BSLA 2AGKA 4NY2A 4JTTA 4MYAA 2PTWA 2E28A 4J3VA 1LLOA 3CAKA 4XBJA 2HZGA 3BMVA 3FJLA 3SRHA 4DO5A 3MU7A 1SJBA 1A0EA 1TUXA 1XR2A 4GX8A 4S3EA 4D1JA 1W5NA 1JQXA 3WQ4A 1E3XA 3K13A 4MJZA 5G4EA 1HM3A 3N14A 1W31A 4PTVA 5C6MA 3UZJA 2WZMA 2R91A 5A6AA 1VFSA 1RCXB 4KT2A 4KIRA 1HL9A 3EPOA 2PD9A 1D7KA 4RK8A 4JN8A 3GUWA 3VNJA 2E9BA 1R2RA 2HBVA 1PB0A 4YS1A 2D0FA 2NZLA 1JUEA 3E2SA 1HJSA 2H8XA 4ZQMA 5A2BA 2OG9A 3INPA 2FGZA 4Q4KA 3THCA 3UERA 1FX6A 2WMHA 1CXLA 5LIXX 1NDZA 3UF9A 2D69A 1YEYA 2Z7GA 2JF6A 1NJJA 4ZGYA 1XGEA 3GHRA 4DRSA 2EJAA 4H2CA 4NRSA 2BRWA 4NI8A 1JG9A 1UH2A 4F9JA 3TW6A 4Z0SA 1A5UA 1GQLA 3A23A 1E56A 3K4WA 4GQRA 5E9XA 4ACZA 3H6OA 3N9RA 1KXVA 4IX2A 4O53A 1NF7A 4IJCA 1WP6A 4EWND 3N6QA 1TJPA 3OQEA 4GXMA 3Q4DA 4E3VA 1GZJA 3S5OA 4HOWA 1R2SA 3ZS4A 1B9BA 4L1WA 4Z08A 3TYBA 4F2UA 4GIRA 4CQ9A 4R7JA 3VNKA 3HN3A 3FA3A 1E51A 2BY1A 1OCNA 4DM2A 1CXIA 1V7AA 6A3HA 4DI9A 1ZP3A 5T91A 3P67A 3UXKA 1YNPA 4QEHA 3TFCA 3HQNA 3LPOA 2D24A 4GYKA 3UR8A 1V02E 4C7GA 4LAKA 1XRTA 4JTSA 1MRQA 3EWXA 2NLYA 5F7UA 2WNZA 1BEUA 2PZ0A 4GUFA 5CPQA 1T99A 4LYQA 3BL3A 1W3KA 4PUDA 3LHZA 1HFBA 1JI1A 1QU4A 4K7YA 1NWRA 2FZDA 1UPMB 2G3FA 2I14A 1D9EA 4C6MA 1TFVA 3PPFA 1EGZA 1VGAA 2WAGA 4LUSA 4YN5A 1OZMA 3SIMA 2V63A 2I5IA 2VFIA 4XKMA 3W1LA 1XUZA 4F0HA 3WF4A 4LUIA 3PG8A 1AUSL 4AZHA 4AWTA 5CG0A 5CJNA 1W54A 1KFCA 3SCUA 1VS1A 5J5RA 4OBTA 4W86A 3W07A 3RR4A 1PUDA 5DXXA 2W63A 3N19B 3MI2A 3NQGA 3MP5A 2XIJA 3TXVA 2WYSA 1WQ5A 4W5ZA 4OHQA 1FUYA 1FWGC 1GONA 3B8IA 3GH5A 1VBHA 1JJKA 2WHMA 1EHNA 1NIUA 3UVAA 4IX0A 1R5YA 2INZA 4O8AA 1ZBVA 3TW7A 4RE0A 3NDOA 4C65A 1J8VA 3NVDA 2PDJA 4O18A 3NM3A 3FYPA 1LWHA 1KFLA 4IMGA 1E6ZA 4UTIA 3W83A 2R6OA 4W88A 1E9YB 1JCXA 4GXWA 4AYGA 1DJGA 2BASA 3GXTA 1MDLA 3T6CA 1TR9A 4D6CA 3RJXA 4CD8A 3GC4A 3QLLA 1PKLA 1OABA 3L4ZA 1TTPA 2ZC1A 2ALRA 4MTVA 4JPGA 1J18A 1G94A 4V1YA 3VDBA 3LXCA 1PPIA 1SR9A 3ITOA 4PODA 2HCVA 4W8BA 4HZ8A 2PDHA 4A2RA 1YDYA 1C82A 2E5CA 1MO0A 4AX7A 1CIUA 1C90A 3FOKA 3M0YA 2EPHA 4GIEA 1U2YA 2WSQA 3L9CA 1GCYA 3TROA 3UR5A 3RO6A 2PLMA 4CU8A 4FIQA 2UBPC 4XKYA 5FSDC 2Y62A 3WQWA 2FFCA 2EG8A 1FH9A 1TX2A 3EPMA 1GVRA 4Y7EA 4C1NB 3R43A 1EEXA 3MW7A 1BXCA 2Q01A 2XHYA 3BG9A 3GYCA 4ZQCA 3G2GA 1X1ZA 5EGRA 2YIHA 1XIGA 3AICA 1XSKA 3W88A 4AWEA 4GNKB 1TSIA 3NYDA 1UW9A 4ZTXA 5FIPA 3QV7A 1D8CA 4PGLA 4WSJA 3EXTA 4XZMX 4UNKA 1C29A 1RP8A 4C1LA 5BMXA 1KRAC 4LJ3A 3ZLGA 3SW6A 3VFCA 5EMMA 3EB2A 4LC8A 1M7XA 3FNDA 1QPKA 4WIWA 2PGFA 4HCHA 2FH8A 4IP5A 4IIGA 2JKPA 3PB0A 4IOTA 3TTOA 3KHJA 1FWWA 1TG7A 3W27A 3SQLA 3UETA 3LERA 4HN4A 4XAPA 2PTZA 4U33A 4L4PA 4DNMA 4FAMA 5CSSA 4FALA 3VOCA 1XISA 1B3XA 3QVQA 2QHAA 4O14A 1LRTA 1VEPA 3B04A 1SO6A 3AHTA 5I79A 1JCJA 4G7FA 1US3A 2ISVA 2DQXA 4AZ7A 3IUDA 1YTDA 1BFNA 1YNQA 1Z3NA 4JFVA 3V4BA 4QJ5B 1E0WA 2XVGA 2ZUVA 1NY1A 2ATSA 1W17A 1VH7A 4Q4MA 4HSHA 3W22A 3GO2A 4E2VA 2DT1A 4JHZA 2QUVA 3PSVA 1C93A 2XDFA 3W00A 4E38A 3WDRA 1FXQA 1KM3A 5I7GA 2Y5SA 2WPBA 1Q5MA 5XIMA 3W86A 4CNSA 1QK2A 1IIGA 2V30A 3W2UA 3U4FA 2BHUA 4W89A 3FIGA 4EIVA 4PCSA 1Z8AA 3HJZA 4IMDA 3APYA 2ZX6A 1XIDA 1IE7C 3ZSTA 1F2JA 3O2LA 4GISA 4RV8A 3W2LA 1QK0A 1BLIA 3C8NA 4LGXA 2OMAA 1IEVA 1S5TA 4FNPA 1TJ2A 3WFZA 4ZE5A 4ZFMA 3WD3A 4K8GA 3B8WA 3F5JA 1ZGDA 2WZEA 1AJ0A 1G4EA 3RGTA 1S5NA 3F4WA 5AKQA 2X1IA 3W7QA 4IMAA 3LLXA 1CYGA 3W2NA 1KCLA 2ZXDA 2XU2A 1WB0A 4W93A 3U57A 4RDWA 4BEUA 3MP3A 4Z2HA 5U4NA 3BLOA 2EEXA 1WKEA 3GZAA 4EXAA 3WD4A 4DJEA 2Q09A 2ABBA 3TV8A 1EQPA 2VFHA 1ISVA 3T81A 3CWHA 3UWQA 4Q7IA 1VRXA 2WSPA 3KBNA 4X3ZA 1XPYA 4W84A 4ZSTA 3IAPA 4KF1A 5CSUA 2BOEX 3EA1A 2VFFA 1XSJA 4EKJA 1MUMA 1K9DA 4TV5A 1JFXA 4LOCA 2YCLA 4HCLA 1XLLA 2REQA 2PTXA 4IT1A 5I3HA 3KWXA 1P0DA 1W1YA 1WDSA 9RUBA 3CTTA 2OLHA 4LFYA 1H3GA 3L65A 4WR3A 3QRHA 1W9PA 3BLFA 3N2MA 2R1PA 4DUWA 1HKKA 1PYFA 5I02A 3AUJA 5K9CA 2FGLA 3IAQA 3MUY1 4YTSA 1VFOA 5CG7A 5HR6A 1ISWA 1EZWA 2GQ8A 4KWVA 3N4FA 5CSRA 1WO2A 2YKKA 2DP3A 3NOYA 3F5KA 5AECA 1PTGA 4L9YA 4NZ4A 1CI1A 3Q45A 4AX6A 4FNUA 3A13A 4GGHA 1XIMA 1VIZA 5ENLA 4HOZA 2XGZA 4X9SA 1UUQA 4JQ4A 5FAJA 3GTIA 3WL0A 3R7MA 3NO5A 4GH3A 1HM2A 4JFWA 2OGJA 4YYCA 1IZKA 4JR5A 3H7RA 1E40A 2V5BA 3BLIA 3G1SA 1JPDX 3NZQA 3AS3A 3CM4A 1EOKA 1VQTA 3UEQA 4LYRA 3A6OA 3S0CA 4Q8NA 1JZ8A 2DV0A 2CZDA 3PNUA 1EL3A 3M41A 1B30A 4M29A 3FHQA 1HMWA 3LTYA 2CLMA 3BW4A 3IS4A 3U4AA 3IIXA 1IWAA 2VZVA 1ZBKA 2V5JA 2VC9A 3QEZA 3HG2A 3ICJA 1RJRA 4HMNA 4KQNA 4H7ZA 4HP5A 3EOLA 1X98A 5E70A 3GDTA 3K30A 1KKRA 4C6JA 3HGJA 2FZNA 4V28A 3KCJA 4DJFA 3W24A 3RF9A 4LCRA 1RSCA 1H0IA 3IJQA 1CTNA 3M0HA 3N25A 4JQAA 3C52A 1G4TA 5BRQA 5KZMA 3FHAA 3CJPA 2WMGA 4NAEA 3R58A 1REQB 3ZVHA 1JF6A 1BVZA 1XG3A 4XG1A 2VX7A 1OB0A 3UWUA 4IZGA 3CZLA 1SJCA 2YB1A 1GORA 3U2ZA 4RUBA 3I7QA 2CWXA 1UWIA 1OFOA 4MF4A 4CNNA 2DDXA 4O12A 2GK1B 4IQLA 3S5NA 1F3TA 1KLZA 3N4EA 3PNZA 5D38A 3G5EA 4HNTA 5CBBA 3F2BA 2Q8ZA 1V7YA 3CH9A 4GBDA 3RN6A 3GD6A 1SMDA 4GVHA 1EGUA 2WJZA 4ZB2A 3RIKA 2O9TA 3QXBA 3DFNA 3VYLA 5I6SA 3KWSA 3LQGA 4MOZA 4EPKA 3RPDA 5BYWA 4ZSUA 3GR7A 1AFSA 1A5OC 1IR1A 3LMZA 2AQWA 3GDKA 1ODZA 2Q02A 2VDGA 3ARPA 5I00A 1V3JA 3AIRA 1JDAA 4LX4A 4QE4A 3LZ5A 3R1ZA 3DFHA 3NQ7A 3WELA 1B5TA 1FWCC 4FLSA 2OSXA 2A3EA 3H2NA 3LNMA 3RM8A 2EO7A 1PKYA 4O16A 1FWJC 4PUEA 1XLHA 3LCIA 4R3UA 1B57A 1R3VA 3QTGA 1HUVA 5E9AA 1TB3A 3KP0A 3GWQA 3PR2A 3XINA 3O7UA 1C8QA 3CAVA 4DAIA 5IFTA 3RRAA 1C8XA 1Y65A 1A4LA 2IW0A 3OBEA 1OG0A 3SI9A 1NEYA 3T07A 5FOOA 3OLGA 5HDRA 4MJ2A 4NSBA 3WQ8A 4ZL1A 3S46A 1Q7MA 2YCKX 2WQPA 1BAGA 4KWSA 2FTPA 1E71M 1UYQA 3MHUA 1LLWA 3WQOA 2OYKA 4R7WA 3EWWA 3OJGA 4JIPA 2ISDA 3LU2A 4K36A 3GXIA 3TC3A 3WFAA 3EBVA 4MY8A 1NDWA 1PCWA 4B5WA 1F9CA 1TV7A 2PAJA 3WCZA 1EBGA 1ME9A 2RKXA 3CS2A 3WK1A 1ZL1A 4A29A 4DWSA 1V6UA 1F5ZA 4LVAA 3G1FA 1GW1A 2ZZ1A 2QJHA 2ESCA 5MF5A 4REQA 3VOIA 2INFA 3LA4A 2J6XA 1VPYA 1RCQA 1YTKA 2ACQA 4ZQRA 2QULA 5IBXC 1VLIA 4CD4A 4GY1A 3TQVA 5D9PA 4QEEA 3ID7A 1E70M 2G8ZA 1RBLA 6XIMA 2FGBA 4XZLX 3EOOA 2GVEA 2FB2A 4D6HA 4IWWA 3JVAA 2YYUA 5FJOA 3EYPA 3RR1A 5F2LA 4GVIA 3USZA 2J4GA 4HPNA 1W3JA 4QR6A 2ONEA 5DANA 1HN0A 1CGYA 4ZOAA 2ZZ3A 1XPGA 7REQB 1MQPA 3QKZA 3URQA 1EJRC 1GVQA 2NLIA 6XIAA 4ZO7A 4G2DA 4P2VA 1PIGA 2XVLA 1KFKA 3F4NA 3VIGA 1K3UA 1OJOA 3ES8A 3LG3A 3TU9A 4CVUA 2MANA 4KETA 3P14A 4PTWA 5TF0A 1GT8A 3GVWA 1AVAA 4UMBA 3QC3A 1EXPA 3KOWA 3GH7A 4RNHA 1Q7QA 3NL3A 1GVEA 4S3KA 3CBWA 1O12A 4M6PA 3GHUA 4PMRA 1IZJA 3C56A 1LRQA 1X1NA 4DO4A 1B54A 1BG9A 5CBJA 1TPC1 4OECA 4DYKA 4CVWA 3IRDA 1VHNA 3LSCA 2VELA 2Y2WA 1O0SA 1M68A 3SCSA 4UTWC 3GLCA 3CUZA 1SMAA 4I3GA 5LXXA 3M07A 3GM8A 3MI3A 1S38A 4GHRA 3H2EA 3KCOA 2AKZA 3V1PA 2YDRA 1QI4A 3AHVA 1CEOA 1VAHA 3REQA 3ELFA 1Q63A 3W1PA 1B1YA 1FFQA 1XW8A 1V77A 1DJQA 2XPKA 1Q65A 3MVTA 2PDYA 1KM4A 2E6DA 1B3OA 1G0CA 4GH1A 1OCJA 2ZX9A 1DIDA 2WHJA 2NV1A 1CPUA 1PX4A 7ODCA 1QBBA 1IT8A 1ODUA 2WW5A 4AD3A 1YQ2A 5I3IA 1S2VA 1XYLA 3TYAA 2UY3A 3PPCA 1KCKA 4S2CA 1R85A 2WMJA 1E6RA 1XYBA 4HMDA 5BCAA 3IIOA 2ACRA 9XIMA 3OODA 3L0GA 2Z24A 1QOQA 1N7PA 4A2SA 3WLSA 1FWTA 2RJHA 1OIFA 1BYCA 3W3OA 2PI6A 4Q4RA 3LYEA 2CXGA 2OZ3A 3VNZA 5TAOA 3AAMA 1SSDA 2R1MA 3QFWA 3M6DA 2DY3A 1ISYA 1JZ2A 3VZZA 3EX4A 3EDKA 5I06A 4L5ZA 4IXHA 2E09A 3BGAA 2QR6A 2XIMA 4B3KA 4F66A 4ZFCA 3DENA 4YWSA 3QV9A 2P5NA 1R46A 5ABFB 4ADSA 1EWEA 1ZSXA 1DTUA 3UD1A 5H6HA 3M0ZA 3WLMA 2V68A 1XBVA 1TPEA 1PAMA 3NZ1A 1UC5A 1HVQA 3P61A 2B7PA 4MYXA 4ZZ9A 3WH6A 3E74A 2DT3A 5EL1A 4J27A 3H2MA 4QLJA 1W3IA 1DORA 3NNTA 4U10A 2Q71A 2P88A 2QVNA 3T2OA 6ALDA 2BRPA 4GNVA 4B90A 4LB3A 2V4IB 3MUIA 2P76A 3DFSA 4IF2A 3OVQA 1XD0A 3U9IA 1M6JA 3G0XA 3W37A 5E0CA 3L2IA 1N8WA 1S2TA 2QDEA 2ZQ0A 1ZALA 1JQVA 4D8LA 4FOUA 3MVIA 1JYVA 3KTCA 1AH4A 3PBUA 4M7TA 4IGNA 4U2YA 3TH6A 1J6PA 4JTRA 1XBXA 3I7SA 4PBEA 1J96A 3CQJA 4Q22A 3EDDA 3GNNA 2W91A 2V2DA 1PZ0A 4I6KA 4ICCX 4LXFA 3LNPA 2WM1A 4PSPA 5CAKA 3N2XA 2W27A 1RCOB 1XH2A 3GW0A 1EJ7L 3UWVA 3GTNA 1I8QA 3NFUA 4UWMA 3RPTA 4E5TA 1EIXA 1AG1O 1QDSA 3D3AA 3K1GA 4V27A 5DF0A 4R88A 3S2JA 4QQUA 3IUHA 4F2BA 2DSWA 1E4NA 3I3BA 2VWSA 2DIKA 3WNMA 3ZT7A 1XV8A 4I8YA 3S42A 1X1JA 2Z0IA 3EPNA 1J0HA 3RUBL 4HU0A 1G01A 3QC0A 3GU1A 5MKGB 3H21A 3KDNA 4LF1A 3TQPA 3W7DA 3N2TA 3R0DA 2QDHA 1J6OA 3L23A 2IPFA 5KETA 2YA1A 5LA1A 4M1BA 4O17A 3TTSA 3DIPA 4V15A 3BSGA 1BRLB 3CL7A 3M7WA 3LDVA 1YDOA 2WK2A 4RW5A 1NTHA 3O6AA 4J5NA 1ITCA 3IJDA 5HA7A 4AY7A 3TJLA 2PGEA 3LN3A 3TE9A 4JQ2A 1E6SM 4QDWA 2QV4A 1F05A 2NQLA 2NXGA 4RE4A 4RW3A 3MKKA 1OFQA 1OC7A 2XN1A 4NNAA 1LORA 2JF7A 4DUOA 4JQ3A 3Q67A 1H5VA 1V03A 5RUBA 3OGRA 3PZNA 3MO7A 3ZLFA 3ZZ1A 1FWBC 3PN8A 1VCGA 4JX4A 4RKAA 5BRPA 3MSDA 1JCMP 2P8CA 2WWDA 2W3ZA 2QUTA 3WD1A 1KNWA 4QJ1A 5HMDA 5FF7A 1K1DA 1I6NA 1FP8A 2VUYA 4KEVA 1UG6A 3IJ7A 3WEZA 3N12A 2C7FA 4O0QA 3VZXA 1JDFA 1XQKA 2VO5A 3V5OA 4FXRA 3MDUA 1GOQA 1OSEA 2AAAA 4LCSA 3R10A 2ZUNA 4PE8A 3B9OA 2DUAA 3BW2A 1A0CA 1X6LA 1T8QA 4CU6A 3H4WA 4LRSA 5FJJA 1P4CA 3W1XA 1KQZA 3NXFA 3OEXA 1N7QA 3PSWA 4GOAA 4JIIX 1LZOA 4H7VA 3BMWA 3KHDA 3V36A 2HV5A 1CCWB 3UY8A 1CLVA 4INFA 3PBYA 1VBGA 3UCQA 4RCXA 3VCNA 2DU2A 1EA0A 5DLCA 1FBAA 4DJDD 1VLWA 4QROA 3VIOA 1J11A 3RDKA 1WBJA 4JTHA 3MZNA 3GTFA 1UOZA 4L61A 1PX3A 2GVLA 4CCZA 4AEEA 1CGWA 3C6CA 3KDOA 3FJ6A 4P8WA 4DAFA 5E0KA 2PP0A 3B9AA 1BVNP 4WCJA 3VGDA 4D6GA 2V3DA 2HVMA 2VR5A 1KV8A 3LTSA 3LCWA 4ZMGA 1EJTC 4GC3A 3U2EA 2V8ZA 2EGZA 2VFGA 4AEFA 2YX0A 4AMCA 4ATLA 1OVDA 1ZTVA 3GIPA 2WQDA 3OZMA 2PRHA 4DBEA 3SCOA 2AMXA 3RAOA 1MI3A 3DHDA 2X1UA 3CXOA 4H83A 4QISA 3ZJ7A 4CU7A 3PBWA 5F4WA 1S5MA 1JL8A 3QY6A 4HJFA 3WK3A 4TTGA 3GBDA 3ARQA 4AZCB 2YCEA 5J8LA 1TCMA 1PYMA 1K7XA 1OQFA 1M7JA 3PZGA 3L4WA 3MSYA 3TJIA 3KL0A 1TJ1A 3ARVA 1YMYA 2HROA 4DF2A 1NARA 2I9EA 3QV8A 3SY5A 5HOSA 1HG3A 2BRVX 3B0PA 4AZ6A 4P7RA 1JFHA 5AC4A 1AZ1A 3KOFA 4DXKA 2XIQA 2G0WA 2I17A 3VCRA 1SJDA 2FKPA 4CEUC 4TOQA 5D8WA 4O4VA 4NU7A 3ZVIA 3SQMA 4MZYA 1UZHA 2WZTA 7TAAA 1UKPA 4RXFA 3AROA 3F2CA 3G1XA 2NQJA 4A8RA 1JYXA 3NYZA 4WJEA 4WUIA 4PBFA 1VC4A 1W3HA 4GZEA 3W1MA 3VDAA 4Y9NA 4S3DA 1G1YA 4QITA 4HGXA 4IMCA 3PUGA 1T41A 1YPFA 3ZJ8A 4C6QA 3PZUA 4LAMA 2BWGA 1QRQA 3QYSA 1Q6FA 3AZSA 2G37A 4H6EA 3W7NA 3E2RA 2W61A 3K1DA 1YXYA 3T2PA 3UZZA 1PWLA 3R94A 3RRXA 1SZGA 2C1IA 3VZYA 3WD2A 1JDCA 4H00A 5DMNA 1OHLA 3D46A 1IV8A 1ISXA 2H8ZA 3CIWA 2PTYA 4MFDA 1SFJA 3ITTA 3DHUA 1LOQA 1T6MA 4J4KA 3DG3A 3BCDA 3ENLA 4FEZA 3HQOA 1CZ1A 1JZ3A 2GWGA 3EMQA 2ZDSA 3M5ZA 3W74A 4N4QA 4ACZB 1K4GA 3WEMA 1XCXA 1TWZA 1Q66A 3M1ZA 4HHMA 2DEPA 1OT1A 1VBRA 4TUFA 1X8FA 1SQ7A 1RJPA 3HTWA 4WK9A 3UA3A 3P2VA 1JYNA 4EACA 4MFEA 3NQ2A 2PDKA 3IUIA 3TR2A 1NH6A 2P10A 4BQ3A 4DY1A 4XVDA 2Y88A 5C9RA 3BOLA 4MNLA 3MSRA 4I9AA 1EC9A 1GQJA 2BHYA 2YCJA 4UTLA 4BWLA 4AD2A 1DQWA 4OVXA 4LUYA 2ZZ2A 3K2GA 1ZJIA 5LA2A 2VT0A 2EKGA 2ZA2A 3DFPA 1AJZA 3QHNA 1V08A 3BLLA 2IPGA 1BXNA 3GC5A 1BWLA 2AQVA 2HNHA 4DLMA 3ARTA 4Q8OA 3GVGA 3H26A 1HX0A 1V0LA 3NQEA 2JBMA 1K8YA 4HZMA 2XJ7A 3VNDA 3UESA 1OD8A 3NDYA 1FP9A 1PTAA 1QWKA 1YX1A 1KM1A 3DC0A 1NDYA 2ADAA 4NX0A 1LWJA 1GVYA 4F9DA 1ADDA 1RQBA 2C0HA 1M3UA 1F4AA 4AZ5A 1W5OA 2XIIA 4XZWA 1KTNA 3W25A 1Q6QA 1OYAA 3EA3A 4NJGA 1P43A 1W6TA 2OO6A 4W87A 2A3HA 3CWNA 4AC7C 4IG2B 1Y7VA 3HGRA 4MLRA 3CV6A 4DJDC 1K9TA 2Z1VA 2PA6A 4FNTA 1EA9C 4JKKA 4LPCA 4AMAA 4AZGA 1C91A 2O4QA 4QRNA 2PUZA 4A3UA 2PODA 4AZIA 5CQ1A 1SZEA 4GY7A 4NJKA 3BAJA 5BWFA 4TTUA 5GPRA 2ZX5A 4ML4A 3RNDA 1T8XA 3MI6A 5KSWA 3BWWA 1OG6A 3NGFA 3KBWA 3T9PA 1BQCA 3FDKA 2NXIA 3CZEA 2EPLX 1ZP4A 5HWMA 1DOSA 2V5CA 4S23A 3OW1A 2HPMA 3NO3A 3I6TA 1GHRA 4Z2IA 1H1YA 1XC4A 3L4TA 3IPWA 3WQGA 1XYZA 2O7QA 3RM9A 2PDGA 1A5LC 1J2BA 1OM0A 1GJUA 4GCAA 1MEHA 4WGXA 3VDHA 3N6HA 3RMJA 3GG1A 4JX6A 1AW2A 4TV6A 1I8JA 2NUYA 1ZLPA 1JVNA 1ELSA 2XZ7A 3W6LA 4GGBA 3DZ1A 5CC5A 1CB7B 4B4HA 4XKYB 2PRMA 4B5VA 3SGUA 4I5UA 1DE6A 3FN9A 1XH1A 3M5XA 1M53A 4H01A 3PZTA 4FK9A 3U6WA 2G5WA 3B0YA 4RZ5A 1TZ7A 4K8HA 4Q33A 3LPFA 1NU5A 1UD4A 1B2YA 3OTRA 2BV9A 1NFBA 2QZRA 3NURA 3VTRA 3EB3A 2OGYA 3M47A 2H90A 4HK5A 2I56A 3AHZA 5K9XA 1FQ0A 1Q45A 1EPVA 1GNXA 3B8DA 3TYUA 4GABA 1TPUA 3W1NA 1UR0A 1JGMA 3PTMA 3DUGA 4AHOA 2IPJA 4JYEA 3GG0A 4PSRA 2QKFA 1O94A 3MHGA 2IQTA 3MQTA 2WOQA 2NVDA 1I2OA 2ZFAA 2J9YA 2AGTA 3APTA 2ZA3A 5FEWA 4WKHA 2VP8A 1DWIM 1YKWA 5KEZA 4XIAA 3FJNA 3KVLA 3ZR4A 3TQ0A 1B4KA 1D3GA 4P7QA 8CGTA 3UZYA 4CN1A 2NVAA 3R8GA 2GPTA 2J47A 2DSZA 3IV3A 5KZDA 2C1HA 4RE3A 2ZIDA 4LALA 3S1GA 4Q4OA 3A4JA 3CH0A 3B06A 3LLDA 4Z42C 1BKHA 1FWFC 4JD4A 1B0IA 2OTDA 4GX9A 4W4QA 3E3HA 1AQFA 3N29A 4HHHA 2NV2A 3Q2DA 2VQTA 1RVKA 5HJYA 3QR8A 2DUXA 3E49A 4DBUA 3OZOA 3KP1A 2YL8A 2CCRA 1QUMA 4J28A 1A0DA 1GTHA 4ERGA 1DJNA 3F4VA 1OINA 4LUJA 3E5PA 2Y8KA 3AIWA 1IXOA 1OJPA 5HWJA 5A8GA 3HG4A 4ERIA 3PK7A 3TCEA 1UR1A 5LNWA 3FKKA 2J8FA 3ITLA 3ORWA 3E9AA 1SPQA 3GTXA 3S2LA 4ZBCA 4BF9A 1LL4A 2QAFA 1PTDA 4I9TA 1B3WA 1JEZA 1SFLA 5TQLA 5JIPA 1E1CB 1OJNA 4K68A 4XIMA 2GSHA 1YPIA 2VZOA 2WNWA 3OQ8A 3NXLA 3LI1A 4EANA 4UXDA 3B8TA 2O9RA 3I4EA 5ECUA 1DWHM 1SZNA 4IL0A 2EQDA 4YWIA 2CLEA 4GYJA 4OFCA 3WK0A 1FWIC 4IJRA 2PS2A 3QMTA 4MZ8A 3VIJA 1EFZA 4DF0A 2PDMA 3MP4A 3PJWA 2QMJA 4NNCA 3CPUA 4JIRA 2QCHA 1LYXA 2ZVIA 1XLGA 5EMKA 1WNOA 2CBJA 2DFAA 4DLFA 4ZB0A 2A1YA 2DZTA 4HK7A 4P7OA 3B9NA 5CC7A 5SWUA 4B92A 4CGTA 3LPGA 2ISSA 3DDMA 3G1VA 1US0A 2EBNA 1L9WA 3JU2A 3B0UX 5B7YA 2WM0A 3TKFA 2POZA 1WCGA 1K7EA 1NQ6A 1UIPA 4PCTA 2FMNA 2BSLA 3VNYA 2I57A 2I5GA 4LEQA 1TPFA 1REQA 4GI4A 1RD6A 4B91A 1O5QA 1EBHA 1W1ZA 2GSJA 2BS9A 5CKSA 1MZHA 3CZJA 3NSNA 2CPUA 1TKKA 5TNVA 8A3HA 6REQB 2QJNA 2E6FA 3G6MA 5G4HC 2GJPA 3UXAA 4FIRA 2HMCA 1X38A 1Z41A 3B9EA 4UQCA 2TODA 1QHZA 3LUTA 1VYSX 2GQ3A 1RP9A 1Y5WA 3LTPA 3CT2A 5AFDA 4M6UA 1ZCOA 1WXYA 3S5SA 4IICA 1G6CA 2WMFA 1J9YA 2JIEA 1EYWA 1EGVA 1XIEA 4AHPA 4JY9A 3EKLA 3A22A 1TRIA 3STEA 3T8QA 3VIIA 3R11A 2V67A 4Q6JA 7TIMA 1E1EA 1V0MA 3UZXA 2F2HA 1O4UA 3IIZA 3TXZA 5IFPA 1F1SA 1HJXA 4GNJA 4ECLA