3D60A

Crystal structure analysis of 1,5-alpha-arabinanase catalytic mutant (d27a)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
314
structure length
314
Chain Sequence
b'VHFHPFGNVNFYEMDWSLKGDLWAHAPVIAKEGSRWYVFHTGSGIQIKTSEDGVHWENMGWVFPSLPDWYKQYVPEKDEDHLWAPDICFYNGIYYLYYSVSTFGKNTSVIGLATNQTLDPRDPDYEWKDMGPVIHSTASDNYNAIDPNVVFDQEGQPWLSFGSFWSGIQLIQLDTETMKPAAQAELLTIASRGEEPNAIEAPFIVCRNGYYYLFVSFDFCCRGIESTYKIAVGRSKDITGPYVDKNGVSMMQGGGTILDEGNDRWIGPGHCAVYFSGVSAILVNHAYDALKNGEPTLQIRPLYWDDEGWPYLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intracellular arabinanase
publication title Crystal structure of an inverting GH 43 1,5-alpha-L-arabinanase from Geobacillus stearothermophilus complexed with its substrate
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 70
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.99: Arabinan endo-1,5-alpha-L-arabinosidase.
pdb deposition date 2008-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3d60A00
4AK7A 3VT0A 1GYEB 3PIJA 4UDIA 1WL7A 5A7VB 3CU9A 5JOXA 3R67A 3KF5A 2AC1A 3UGFA 2EXJA 3WPYA 5FMBA 3UGGA 2B4WA 2XQRA 3C2UA 3QC2A 2VDTA 4UDKE 4N2RA 5FIXA 5GLPA 3VSZA 3LDRA 3OM4A 3NQHA 3VSRA 2X8FA 3WN2A 5AYEA 3C7OA 5FMDA 3ZXKA 4FFIA 3AKHA 5A7VA 3WPZA 3OM6A 4AK6A 2AEZA 3C7GA 1W2TA 4PVIA 2EXKA 4KC7A 2ADDA 2YFSA 3KSTA 4O8PA 3WPUA 3ZXLA 1GYDB 3QEDA 3D5YA 3VT2A 3C7HA 4N1IA 5FLWA 3AKGA 3OM7A 4QQSA 5GLLA 3TAWA 4FFGA 2ADEA 1YIFA 3VT1A 4AK5A 2AEYA 5GLOA 3ZXJA 3LIGA 3QEFA 3WAUA 3WASA 4FFFA 4ONZA 2EXIA 2YFRA 3AKIA 1OYGA 1GYHA 3BYLA 3SC7X 3U75A 2X8SA 3LF7A 5GLRA 4U6BA 1Y9GA 3OM2A 1Y4WA 5B6SA 3C7EA 3BYJA 3QZ4A 4KC8A 4N2ZA 5A8DA 5JOZA 5JOYA 4N4BA 3LDKA 4O8NA 4D47A 3D5ZA 3WATA 1Y7BA 5AY9A 1PT2A 5AYDA 3BYKA 1Y9MA 3PIGA 5FK7A 4U6DA 3R4YA 5FK8A 4FFHA 5FKCA 2EXHA 5JOWA 3BYNA 4NOVA 3LEMA 4EQVA 5GLMA 4KMIA 4O8OA 3U14A 5FMCA 2YFTA 3C7FA 5C0PA 3VSFA 3D61A 3AKFA 2QQWA 1UYPA 2X8TA 4PVAA 5ANNA 3WN0A 3WN1A 4KCBA 3P2NA 4KCAA 3LV4A 3OM5A 3K1UA 3R4ZA 3LFIA 5GLKA 5GLNA 2QQUA 3VSSA 3RWKX 3WPVA 3D60A 2QQVA 4UDGA 4MLGA 3QEEA 1YI7A 3LIHA 1ST8A 5A8CA 4UDKA 1VKDA 4COTA 3UGHA 4UDJA 5AYCA 3KF3A 2OXBA 1YRZA 5GLQA 3WMYA 5B6TA 3WMZA 1UV4A 1W18A 5FKBA
chains in the Genus database with same CATH superfamily
4AK7A 3VT0A 1GYEB 3PIJA 4UDIA 1WL7A 5A7VB 3CU9A 5JOXA 3R67A 3KF5A 2AC1A 3UGFA 2EXJA 3WPYA 5FMBA 3UGGA 2B4WA 2XQRA 3C2UA 3QC2A 2VDTA 4UDKE 4N2RA 5FIXA 5GLPA 3VSZA 3LDRA 3OM4A 3NQHA 3VSRA 2X8FA 3WN2A 5AYEA 3C7OA 5FMDA 3ZXKA 4FFIA 3AKHA 5A7VA 3WPZA 3OM6A 4AK6A 2AEZA 3C7GA 1W2TA 4PVIA 2EXKA 4KC7A 2ADDA 2YFSA 3KSTA 4O8PA 3WPUA 3ZXLA 1GYDB 3QEDA 3D5YA 3VT2A 3C7HA 4N1IA 5FLWA 3AKGA 3OM7A 4QQSA 5GLLA 3TAWA 4FFGA 2ADEA 1YIFA 3VT1A 4AK5A 2AEYA 5GLOA 3ZXJA 3LIGA 3QEFA 3WAUA 3WASA 4FFFA 4ONZA 2EXIA 2YFRA 3AKIA 1OYGA 1GYHA 3BYLA 3SC7X 3U75A 2X8SA 3LF7A 5GLRA 4U6BA 1Y9GA 3OM2A 1Y4WA 5B6SA 3C7EA 3BYJA 3QZ4A 4KC8A 4N2ZA 5A8DA 5JOZA 5JOYA 4N4BA 3LDKA 4O8NA 4D47A 3D5ZA 3WATA 1Y7BA 5AY9A 1PT2A 5AYDA 3BYKA 1Y9MA 3PIGA 5FK7A 4U6DA 3R4YA 1TL2A 4FFHA 5FK8A 5FKCA 2EXHA 5JOWA 3BYNA 4NOVA 3LEMA 4EQVA 5C2MA 5GLMA 4KMIA 4O8OA 3U14A 5FMCA 2YFTA 3C7FA 5C0PA 3VSFA 3D61A 3AKFA 2QQWA 1UYPA 2X8TA 4PVAA 5ANNA 3WN0A 3WN1A 4KCBA 3P2NA 4KCAA 3LV4A 3OM5A 3K1UA 3R4ZA 3LFIA 5GLKA 5GLNA 2QQUA 3VSSA 3RWKX 3WPVA 3D60A 2QQVA 4UDGA 4MLGA 3QEEA 1YI7A 3LIHA 1ST8A 5A8CA 4UDKA 1VKDA 4COTA 3UGHA 4UDJA 5AYCA 3KF3A 2OXBA 1YRZA 5GLQA 3WMYA 5B6TA 3WMZA 1UV4A 1W18A 5FKBA
chains in the Genus database with same CATH topology
4AK7A 3VT0A 1GYEB 3PIJA 4UDIA 1WL7A 5A7VB 3CU9A 5JOXA 3R67A 3KF5A 2AC1A 3UGFA 2EXJA 3WPYA 5FMBA 3UGGA 2B4WA 2XQRA 3C2UA 3QC2A 2VDTA 4UDKE 4N2RA 5FIXA 5GLPA 3VSZA 3LDRA 3OM4A 3NQHA 3VSRA 2X8FA 3WN2A 5AYEA 3C7OA 5FMDA 3ZXKA 4FFIA 3AKHA 5A7VA 3WPZA 3OM6A 4AK6A 2AEZA 3C7GA 1W2TA 4PVIA 2EXKA 4KC7A 2ADDA 2YFSA 3KSTA 4O8PA 3WPUA 3ZXLA 1GYDB 3QEDA 3D5YA 3VT2A 3C7HA 4N1IA 5FLWA 3AKGA 3OM7A 4QQSA 5GLLA 3TAWA 4FFGA 2ADEA 1YIFA 3VT1A 4AK5A 2AEYA 5GLOA 3ZXJA 3LIGA 3QEFA 3WAUA 3WASA 4FFFA 4ONZA 2EXIA 2YFRA 3AKIA 1OYGA 1GYHA 3BYLA 3SC7X 3U75A 2X8SA 3LF7A 5GLRA 4U6BA 1Y9GA 3OM2A 1Y4WA 5B6SA 3C7EA 3BYJA 3QZ4A 4KC8A 4N2ZA 5A8DA 5JOZA 5JOYA 4N4BA 3LDKA 4O8NA 4D47A 3D5ZA 3WATA 1Y7BA 5AY9A 1PT2A 5AYDA 3BYKA 1Y9MA 3PIGA 5FK7A 4U6DA 3R4YA 5FK8A 4FFHA 5FKCA 2EXHA 5JOWA 3BYNA 4NOVA 3LEMA 4EQVA 5GLMA 4KMIA 4O8OA 3U14A 5FMCA 2YFTA 3C7FA 5C0PA 3VSFA 3D61A 3AKFA 2QQWA 1UYPA 2X8TA 4PVAA 5ANNA 3WN0A 3WN1A 4KCBA 3P2NA 4KCAA 3LV4A 3OM5A 3K1UA 3R4ZA 3LFIA 5GLKA 5GLNA 2QQUA 3VSSA 3RWKX 3WPVA 3D60A 2QQVA 4UDGA 4MLGA 3QEEA 1YI7A 3LIHA 1ST8A 5A8CA 4UDKA 1VKDA 4COTA 3UGHA 4UDJA 5AYCA 3KF3A 2OXBA 1YRZA 5GLQA 3WMYA 5B6TA 3WMZA 1UV4A 1W18A 5FKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AK7 A;  3VT0 A;  1GYE B;  3PIJ A;  4UDI A;  1WL7 A;  5A7V B;  3CU9 A;  5JOX A;  3R67 A;  3KF5 A;  2AC1 A;  3UGF A;  2EXJ A;  3WPY A;  5FMB A;  3UGG A;  2B4W A;  2XQR A;  3C2U A;  3QC2 A;  2VDT A;  4UDK E;  4N2R A;  5FIX A;  5GLP A;  3VSZ A;  3LDR A;  3OM4 A;  3NQH A;  3VSR A;  2X8F A;  3WN2 A;  5AYE A;  3C7O A;  5FMD A;  3ZXK A;  4FFI A;  3AKH A;  5A7V A;  3WPZ A;  3OM6 A;  4AK6 A;  2AEZ A;  3C7G A;  1W2T A;  4PVI A;  2EXK A;  4KC7 A;  2ADD A;  2YFS A;  3KST A;  4O8P A;  3WPU A;  3ZXL A;  1GYD B;  3QED A;  3D5Y A;  3VT2 A;  3C7H A;  4N1I A;  5FLW A;  3AKG A;  3OM7 A;  4QQS A;  5GLL A;  3TAW A;  4FFG A;  2ADE A;  1YIF A;  3VT1 A;  4AK5 A;  2AEY A;  5GLO A;  3ZXJ A;  3LIG A;  3QEF A;  3WAU A;  3WAS A;  4FFF A;  4ONZ A;  2EXI A;  2YFR A;  3AKI A;  1OYG A;  1GYH A;  3BYL A;  3SC7 X;  3U75 A;  2X8S A;  3LF7 A;  5GLR A;  4U6B A;  1Y9G A;  3OM2 A;  1Y4W A;  5B6S A;  3C7E A;  3BYJ A;  3QZ4 A;  4KC8 A;  4N2Z A;  5A8D A;  5JOZ A;  5JOY A;  4N4B A;  3LDK A;  4O8N A;  4D47 A;  3D5Z A;  3WAT A;  1Y7B A;  5AY9 A;  1PT2 A;  5AYD A;  3BYK A;  1Y9M A;  3PIG A;  5FK7 A;  4U6D A;  3R4Y A;  5FK8 A;  4FFH A;  5FKC A;  2EXH A;  5JOW A;  3BYN A;  4NOV A;  3LEM A;  4EQV A;  5GLM A;  4KMI A;  4O8O A;  3U14 A;  5FMC A;  2YFT A;  3C7F A;  5C0P A;  3VSF A;  3D61 A;  3AKF A;  2QQW A;  1UYP A;  2X8T A;  4PVA A;  5ANN A;  3WN0 A;  3WN1 A;  4KCB A;  3P2N A;  4KCA A;  3LV4 A;  3OM5 A;  3K1U A;  3R4Z A;  3LFI A;  5GLK A;  5GLN A;  2QQU A;  3VSS A;  3RWK X;  3WPV A;  3D60 A;  2QQV A;  4UDG A;  4MLG A;  3QEE A;  1YI7 A;  3LIH A;  1ST8 A;  5A8C A;  4UDK A;  1VKD A;  4COT A;  3UGH A;  4UDJ A;  5AYC A;  3KF3 A;  2OXB A;  1YRZ A;  5GLQ A;  3WMY A;  5B6T A;  3WMZ A;  1UV4 A;  1W18 A;  5FKB A; 
#chains in the Genus database with same CATH topology
 4AK7 A;  3VT0 A;  1GYE B;  3PIJ A;  4UDI A;  1WL7 A;  5A7V B;  3CU9 A;  5JOX A;  3R67 A;  3KF5 A;  2AC1 A;  3UGF A;  2EXJ A;  3WPY A;  5FMB A;  3UGG A;  2B4W A;  2XQR A;  3C2U A;  3QC2 A;  2VDT A;  4UDK E;  4N2R A;  5FIX A;  5GLP A;  3VSZ A;  3LDR A;  3OM4 A;  3NQH A;  3VSR A;  2X8F A;  3WN2 A;  5AYE A;  3C7O A;  5FMD A;  3ZXK A;  4FFI A;  3AKH A;  5A7V A;  3WPZ A;  3OM6 A;  4AK6 A;  2AEZ A;  3C7G A;  1W2T A;  4PVI A;  2EXK A;  4KC7 A;  2ADD A;  2YFS A;  3KST A;  4O8P A;  3WPU A;  3ZXL A;  1GYD B;  3QED A;  3D5Y A;  3VT2 A;  3C7H A;  4N1I A;  5FLW A;  3AKG A;  3OM7 A;  4QQS A;  5GLL A;  3TAW A;  4FFG A;  2ADE A;  1YIF A;  3VT1 A;  4AK5 A;  2AEY A;  5GLO A;  3ZXJ A;  3LIG A;  3QEF A;  3WAU A;  3WAS A;  4FFF A;  4ONZ A;  2EXI A;  2YFR A;  3AKI A;  1OYG A;  1GYH A;  3BYL A;  3SC7 X;  3U75 A;  2X8S A;  3LF7 A;  5GLR A;  4U6B A;  1Y9G A;  3OM2 A;  1Y4W A;  5B6S A;  3C7E A;  3BYJ A;  3QZ4 A;  4KC8 A;  4N2Z A;  5A8D A;  5JOZ A;  5JOY A;  4N4B A;  3LDK A;  4O8N A;  4D47 A;  3D5Z A;  3WAT A;  1Y7B A;  5AY9 A;  1PT2 A;  5AYD A;  3BYK A;  1Y9M A;  3PIG A;  5FK7 A;  4U6D A;  3R4Y A;  1TL2 A;  4FFH A;  5FK8 A;  5FKC A;  2EXH A;  5JOW A;  3BYN A;  4NOV A;  3LEM A;  4EQV A;  5C2M A;  5GLM A;  4KMI A;  4O8O A;  3U14 A;  5FMC A;  2YFT A;  3C7F A;  5C0P A;  3VSF A;  3D61 A;  3AKF A;  2QQW A;  1UYP A;  2X8T A;  4PVA A;  5ANN A;  3WN0 A;  3WN1 A;  4KCB A;  3P2N A;  4KCA A;  3LV4 A;  3OM5 A;  3K1U A;  3R4Z A;  3LFI A;  5GLK A;  5GLN A;  2QQU A;  3VSS A;  3RWK X;  3WPV A;  3D60 A;  2QQV A;  4UDG A;  4MLG A;  3QEE A;  1YI7 A;  3LIH A;  1ST8 A;  5A8C A;  4UDK A;  1VKD A;  4COT A;  3UGH A;  4UDJ A;  5AYC A;  3KF3 A;  2OXB A;  1YRZ A;  5GLQ A;  3WMY A;  5B6T A;  3WMZ A;  1UV4 A;  1W18 A;  5FKB A; 
#chains in the Genus database with same CATH homology
 4AK7 A;  3VT0 A;  1GYE B;  3PIJ A;  4UDI A;  1WL7 A;  5A7V B;  3CU9 A;  5JOX A;  3R67 A;  3KF5 A;  2AC1 A;  3UGF A;  2EXJ A;  3WPY A;  5FMB A;  3UGG A;  2B4W A;  2XQR A;  3C2U A;  3QC2 A;  2VDT A;  4UDK E;  4N2R A;  5FIX A;  5GLP A;  3VSZ A;  3LDR A;  3OM4 A;  3NQH A;  3VSR A;  2X8F A;  3WN2 A;  5AYE A;  3C7O A;  5FMD A;  3ZXK A;  4FFI A;  3AKH A;  5A7V A;  3WPZ A;  3OM6 A;  4AK6 A;  2AEZ A;  3C7G A;  1W2T A;  4PVI A;  2EXK A;  4KC7 A;  2ADD A;  2YFS A;  3KST A;  4O8P A;  3WPU A;  3ZXL A;  1GYD B;  3QED A;  3D5Y A;  3VT2 A;  3C7H A;  4N1I A;  5FLW A;  3AKG A;  3OM7 A;  4QQS A;  5GLL A;  3TAW A;  4FFG A;  2ADE A;  1YIF A;  3VT1 A;  4AK5 A;  2AEY A;  5GLO A;  3ZXJ A;  3LIG A;  3QEF A;  3WAU A;  3WAS A;  4FFF A;  4ONZ A;  2EXI A;  2YFR A;  3AKI A;  1OYG A;  1GYH A;  3BYL A;  3SC7 X;  3U75 A;  2X8S A;  3LF7 A;  5GLR A;  4U6B A;  1Y9G A;  3OM2 A;  1Y4W A;  5B6S A;  3C7E A;  3BYJ A;  3QZ4 A;  4KC8 A;  4N2Z A;  5A8D A;  5JOZ A;  5JOY A;  4N4B A;  3LDK A;  4O8N A;  4D47 A;  3D5Z A;  3WAT A;  1Y7B A;  5AY9 A;  1PT2 A;  5AYD A;  3BYK A;  1Y9M A;  3PIG A;  5FK7 A;  4U6D A;  3R4Y A;  5FK8 A;  4FFH A;  5FKC A;  2EXH A;  5JOW A;  3BYN A;  4NOV A;  3LEM A;  4EQV A;  5GLM A;  4KMI A;  4O8O A;  3U14 A;  5FMC A;  2YFT A;  3C7F A;  5C0P A;  3VSF A;  3D61 A;  3AKF A;  2QQW A;  1UYP A;  2X8T A;  4PVA A;  5ANN A;  3WN0 A;  3WN1 A;  4KCB A;  3P2N A;  4KCA A;  3LV4 A;  3OM5 A;  3K1U A;  3R4Z A;  3LFI A;  5GLK A;  5GLN A;  2QQU A;  3VSS A;  3RWK X;  3WPV A;  3D60 A;  2QQV A;  4UDG A;  4MLG A;  3QEE A;  1YI7 A;  3LIH A;  1ST8 A;  5A8C A;  4UDK A;  1VKD A;  4COT A;  3UGH A;  4UDJ A;  5AYC A;  3KF3 A;  2OXB A;  1YRZ A;  5GLQ A;  3WMY A;  5B6T A;  3WMZ A;  1UV4 A;  1W18 A;  5FKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...