5GLMA

Crystal structure of coxyl43, gh43 beta-xylosidase/alpha-arabinofuranosidase from a compost microbial metagenome in complex with xylotriose, calcium-free form.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
330
structure length
330
Chain Sequence
b'VPRGSHMEPLVTHIYTADPSAHVFDGKVYIYPSHDIDAGTPENDMGDHFDMRDYHVLSMNSIPGEVTDHGVALDIKDIPWAGRQLWAPDAASKDGKYYLYFPAKDKEDIFRIGVAVSDSPAGPFKPESEPIKGSYSIDPAVFKDDDGKYYMYFGGIWGGQLQRWTTGEYAGHDASKTDLEQDDAPAIGPRIALMSDDMLSFAEPVKEISIVDEQGNPILGGDHDRRFFEAAWMHKYNGTYYLSYSTGDTHYIVYATGDNPYGPFTYRGVILNPVIGWTNHHSIVEFNGKWYLFYHDSSLSGGKTHLRCIKVTELTHNADGTIETISPYIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 43
publication title Crystal structure of metagenomic beta-xylosidase/ alpha-l-arabinofuranosidase activated by calcium.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 85
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 5glmA00
3PIJA 3C2UA 3CU9A 4N1IA 2AEZA 1Y7BA 5GLKA 2B4WA 1YI7A 2YFRA 3QEDA 1Y9GA 4AK6A 1GYDB 2QQUA 3SC7X 4U6BA 2X8TA 5GLLA 4N2ZA 2ADDA 3OM5A 1W2TA 3D5ZA 3LDKA 1PT2A 3OM7A 4FFGA 4QQSA 3WAUA 2AEYA 2X8FA 3AKIA 1WL7A 4UDIA 3C7OA 3R4YA 5GLOA 4N2RA 4D47A 3BYLA 4O8NA 1GYEB 4UDGA 5JOZA 3VT1A 5FLWA 4KC8A 4U6DA 3QZ4A 5C0PA 3WPYA 3WPVA 3OM4A 1Y9MA 3WN2A 3LIHA 2EXIA 4PVIA 3ZXJA 4COTA 5GLRA 5GLNA 3ZXLA 4AK7A 5GLMA 5GLPA 3KF3A 1GYHA 3D5YA 3WPZA 4UDKE 3U75A 3BYKA 4KCBA 2QQWA 5FKBA 3NQHA 3R67A 5A8CA 5A7VA 3ZXKA 5FIXA 5GLQA 3LDRA 3TAWA 3UGHA 5A8DA 2EXHA 3LIGA 4O8PA 2VDTA 3D61A 3LV4A 3VSFA 2EXKA 4EQVA 3WN1A 1YRZA 3VT0A 4PVAA 3VSZA 3OM6A 3VT2A 4KCAA 1UV4A 5FMDA 4NOVA 4MLGA 5A7VB 3R4ZA 3VSSA 4UDJA 3QEEA 2X8SA 3OM2A 4KC7A 3WASA 4KMIA 3C7HA 3RWKX 3WN0A 2QQVA 1OYGA 4AK5A 1VKDA 2ADEA 4O8OA 5AYCA 3UGFA 5FK8A 3C7EA 2OXBA 5FMBA 2AC1A 3AKFA 3AKGA 3KF5A 3PIGA 5AYEA 5JOXA 3C7GA 3QEFA 3BYNA 3WPUA 3BYJA 4ONZA 5FMCA 3C7FA 3WMZA 4UDKA 1Y4WA 3WMYA 2YFSA 1YIFA 3QC2A 5B6SA 5AYDA 3WATA 4FFFA 5AY9A 5FK7A 4N4BA 5JOWA 4FFHA 4FFIA 5JOYA 1W18A 3P2NA 3UGGA 2YFTA 3LFIA 1UYPA 5B6TA 5ANNA 2EXJA 3LEMA 3D60A 3LF7A 3AKHA 5FKCA 2XQRA 3VSRA 1ST8A 3U14A 3KSTA 3K1UA
chains in the Genus database with same CATH superfamily
3PIJA 3C2UA 3CU9A 4N1IA 2AEZA 1Y7BA 5GLKA 2B4WA 1YI7A 2YFRA 3QEDA 1Y9GA 4AK6A 1GYDB 2QQUA 3SC7X 4U6BA 2X8TA 5GLLA 4N2ZA 2ADDA 3OM5A 1W2TA 3D5ZA 3LDKA 1PT2A 3OM7A 4FFGA 4QQSA 3WAUA 2AEYA 2X8FA 3AKIA 1WL7A 4UDIA 3C7OA 3R4YA 5GLOA 4N2RA 4D47A 3BYLA 4O8NA 1GYEB 4UDGA 5JOZA 3VT1A 5FLWA 4KC8A 4U6DA 3QZ4A 5C0PA 3WPYA 3WPVA 3OM4A 1Y9MA 3WN2A 3LIHA 2EXIA 4PVIA 3ZXJA 4COTA 5GLRA 5GLNA 3ZXLA 4AK7A 5GLMA 5GLPA 3KF3A 1GYHA 3D5YA 3WPZA 4UDKE 3U75A 3BYKA 4KCBA 2QQWA 5FKBA 3NQHA 3R67A 5A8CA 5A7VA 3ZXKA 5FIXA 5GLQA 3LDRA 3TAWA 3UGHA 5A8DA 2EXHA 3LIGA 4O8PA 2VDTA 3D61A 3LV4A 3VSFA 2EXKA 4EQVA 3WN1A 1YRZA 3VT0A 4PVAA 3VSZA 3OM6A 3VT2A 4KCAA 1UV4A 5FMDA 4NOVA 4MLGA 5C2MA 5A7VB 3R4ZA 3VSSA 4UDJA 3QEEA 2X8SA 3OM2A 4KC7A 3WASA 4KMIA 3C7HA 3RWKX 3WN0A 2QQVA 1OYGA 4AK5A 1VKDA 2ADEA 4O8OA 5AYCA 3UGFA 5FK8A 3C7EA 2OXBA 5FMBA 2AC1A 3AKFA 3AKGA 3KF5A 3PIGA 5AYEA 5JOXA 3C7GA 3QEFA 3BYNA 3WPUA 3BYJA 4ONZA 5FMCA 3C7FA 3WMZA 4UDKA 1Y4WA 3WMYA 2YFSA 1YIFA 3QC2A 5B6SA 5AYDA 3WATA 4FFFA 5AY9A 5FK7A 4N4BA 5JOWA 4FFHA 4FFIA 5JOYA 1W18A 3P2NA 3UGGA 2YFTA 1TL2A 3LFIA 1UYPA 5B6TA 5ANNA 2EXJA 3LEMA 3D60A 3LF7A 3AKHA 5FKCA 2XQRA 3VSRA 1ST8A 3U14A 3KSTA 3K1UA
chains in the Genus database with same CATH topology
3PIJA 3C2UA 3CU9A 4N1IA 2AEZA 1Y7BA 5GLKA 2B4WA 1YI7A 2YFRA 3QEDA 1Y9GA 4AK6A 1GYDB 2QQUA 3SC7X 4U6BA 2X8TA 5GLLA 4N2ZA 2ADDA 3OM5A 1W2TA 3D5ZA 3LDKA 1PT2A 3OM7A 4FFGA 4QQSA 3WAUA 2AEYA 2X8FA 3AKIA 1WL7A 4UDIA 3C7OA 3R4YA 5GLOA 4N2RA 4D47A 3BYLA 4O8NA 1GYEB 4UDGA 5JOZA 3VT1A 5FLWA 4KC8A 4U6DA 3QZ4A 5C0PA 3WPYA 3WPVA 3OM4A 1Y9MA 3WN2A 3LIHA 2EXIA 4PVIA 3ZXJA 4COTA 5GLRA 5GLNA 3ZXLA 4AK7A 5GLMA 5GLPA 3KF3A 1GYHA 3D5YA 3WPZA 4UDKE 3U75A 3BYKA 4KCBA 2QQWA 5FKBA 3NQHA 3R67A 5A8CA 5A7VA 3ZXKA 5FIXA 5GLQA 3LDRA 3TAWA 3UGHA 5A8DA 2EXHA 3LIGA 4O8PA 2VDTA 3D61A 3LV4A 3VSFA 2EXKA 4EQVA 3WN1A 1YRZA 3VT0A 4PVAA 3VSZA 3OM6A 3VT2A 4KCAA 1UV4A 5FMDA 4NOVA 4MLGA 5A7VB 3R4ZA 3VSSA 4UDJA 3QEEA 2X8SA 3OM2A 4KC7A 3WASA 4KMIA 3C7HA 3RWKX 3WN0A 2QQVA 1OYGA 4AK5A 1VKDA 2ADEA 4O8OA 5AYCA 3UGFA 5FK8A 3C7EA 2OXBA 5FMBA 2AC1A 3AKFA 3AKGA 3KF5A 3PIGA 5AYEA 5JOXA 3C7GA 3QEFA 3BYNA 3WPUA 3BYJA 4ONZA 5FMCA 3C7FA 3WMZA 4UDKA 1Y4WA 3WMYA 2YFSA 1YIFA 3QC2A 5B6SA 5AYDA 3WATA 4FFFA 5AY9A 5FK7A 4N4BA 5JOWA 4FFHA 4FFIA 5JOYA 1W18A 3P2NA 3UGGA 2YFTA 3LFIA 1UYPA 5B6TA 5ANNA 2EXJA 3LEMA 3D60A 3LF7A 3AKHA 5FKCA 2XQRA 3VSRA 1ST8A 3U14A 3KSTA 3K1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIJ A;  3C2U A;  3CU9 A;  4N1I A;  2AEZ A;  1Y7B A;  5GLK A;  2B4W A;  1YI7 A;  2YFR A;  3QED A;  1Y9G A;  4AK6 A;  1GYD B;  2QQU A;  3SC7 X;  4U6B A;  2X8T A;  5GLL A;  4N2Z A;  2ADD A;  3OM5 A;  1W2T A;  3D5Z A;  3LDK A;  1PT2 A;  3OM7 A;  4FFG A;  4QQS A;  3WAU A;  2AEY A;  2X8F A;  3AKI A;  1WL7 A;  4UDI A;  3C7O A;  3R4Y A;  5GLO A;  4N2R A;  4D47 A;  3BYL A;  4O8N A;  1GYE B;  4UDG A;  5JOZ A;  3VT1 A;  5FLW A;  4KC8 A;  4U6D A;  3QZ4 A;  5C0P A;  3WPY A;  3WPV A;  3OM4 A;  1Y9M A;  3WN2 A;  3LIH A;  2EXI A;  4PVI A;  3ZXJ A;  4COT A;  5GLR A;  5GLN A;  3ZXL A;  4AK7 A;  5GLM A;  5GLP A;  3KF3 A;  1GYH A;  3D5Y A;  3WPZ A;  4UDK E;  3U75 A;  3BYK A;  4KCB A;  2QQW A;  5FKB A;  3NQH A;  3R67 A;  5A8C A;  5A7V A;  3ZXK A;  5FIX A;  5GLQ A;  3LDR A;  3TAW A;  3UGH A;  5A8D A;  2EXH A;  3LIG A;  4O8P A;  2VDT A;  3D61 A;  3LV4 A;  3VSF A;  2EXK A;  4EQV A;  3WN1 A;  1YRZ A;  3VT0 A;  4PVA A;  3VSZ A;  3OM6 A;  3VT2 A;  4KCA A;  1UV4 A;  5FMD A;  4NOV A;  4MLG A;  5A7V B;  3R4Z A;  3VSS A;  4UDJ A;  3QEE A;  2X8S A;  3OM2 A;  4KC7 A;  3WAS A;  4KMI A;  3C7H A;  3RWK X;  3WN0 A;  2QQV A;  1OYG A;  4AK5 A;  1VKD A;  2ADE A;  4O8O A;  5AYC A;  3UGF A;  5FK8 A;  3C7E A;  2OXB A;  5FMB A;  2AC1 A;  3AKF A;  3AKG A;  3KF5 A;  3PIG A;  5AYE A;  5JOX A;  3C7G A;  3QEF A;  3BYN A;  3WPU A;  3BYJ A;  4ONZ A;  5FMC A;  3C7F A;  3WMZ A;  4UDK A;  1Y4W A;  3WMY A;  2YFS A;  1YIF A;  3QC2 A;  5B6S A;  5AYD A;  3WAT A;  4FFF A;  5AY9 A;  5FK7 A;  4N4B A;  5JOW A;  4FFH A;  4FFI A;  5JOY A;  1W18 A;  3P2N A;  3UGG A;  2YFT A;  3LFI A;  1UYP A;  5B6T A;  5ANN A;  2EXJ A;  3LEM A;  3D60 A;  3LF7 A;  3AKH A;  5FKC A;  2XQR A;  3VSR A;  1ST8 A;  3U14 A;  3KST A;  3K1U A; 
#chains in the Genus database with same CATH topology
 3PIJ A;  3C2U A;  3CU9 A;  4N1I A;  2AEZ A;  1Y7B A;  5GLK A;  2B4W A;  1YI7 A;  2YFR A;  3QED A;  1Y9G A;  4AK6 A;  1GYD B;  2QQU A;  3SC7 X;  4U6B A;  2X8T A;  5GLL A;  4N2Z A;  2ADD A;  3OM5 A;  1W2T A;  3D5Z A;  3LDK A;  1PT2 A;  3OM7 A;  4FFG A;  4QQS A;  3WAU A;  2AEY A;  2X8F A;  3AKI A;  1WL7 A;  4UDI A;  3C7O A;  3R4Y A;  5GLO A;  4N2R A;  4D47 A;  3BYL A;  4O8N A;  1GYE B;  4UDG A;  5JOZ A;  3VT1 A;  5FLW A;  4KC8 A;  4U6D A;  3QZ4 A;  5C0P A;  3WPY A;  3WPV A;  3OM4 A;  1Y9M A;  3WN2 A;  3LIH A;  2EXI A;  4PVI A;  3ZXJ A;  4COT A;  5GLR A;  5GLN A;  3ZXL A;  4AK7 A;  5GLM A;  5GLP A;  3KF3 A;  1GYH A;  3D5Y A;  3WPZ A;  4UDK E;  3U75 A;  3BYK A;  4KCB A;  2QQW A;  5FKB A;  3NQH A;  3R67 A;  5A8C A;  5A7V A;  3ZXK A;  5FIX A;  5GLQ A;  3LDR A;  3TAW A;  3UGH A;  5A8D A;  2EXH A;  3LIG A;  4O8P A;  2VDT A;  3D61 A;  3LV4 A;  3VSF A;  2EXK A;  4EQV A;  3WN1 A;  1YRZ A;  3VT0 A;  4PVA A;  3VSZ A;  3OM6 A;  3VT2 A;  4KCA A;  1UV4 A;  5FMD A;  4NOV A;  4MLG A;  5C2M A;  5A7V B;  3R4Z A;  3VSS A;  4UDJ A;  3QEE A;  2X8S A;  3OM2 A;  4KC7 A;  3WAS A;  4KMI A;  3C7H A;  3RWK X;  3WN0 A;  2QQV A;  1OYG A;  4AK5 A;  1VKD A;  2ADE A;  4O8O A;  5AYC A;  3UGF A;  5FK8 A;  3C7E A;  2OXB A;  5FMB A;  2AC1 A;  3AKF A;  3AKG A;  3KF5 A;  3PIG A;  5AYE A;  5JOX A;  3C7G A;  3QEF A;  3BYN A;  3WPU A;  3BYJ A;  4ONZ A;  5FMC A;  3C7F A;  3WMZ A;  4UDK A;  1Y4W A;  3WMY A;  2YFS A;  1YIF A;  3QC2 A;  5B6S A;  5AYD A;  3WAT A;  4FFF A;  5AY9 A;  5FK7 A;  4N4B A;  5JOW A;  4FFH A;  4FFI A;  5JOY A;  1W18 A;  3P2N A;  3UGG A;  2YFT A;  1TL2 A;  3LFI A;  1UYP A;  5B6T A;  5ANN A;  2EXJ A;  3LEM A;  3D60 A;  3LF7 A;  3AKH A;  5FKC A;  2XQR A;  3VSR A;  1ST8 A;  3U14 A;  3KST A;  3K1U A; 
#chains in the Genus database with same CATH homology
 3PIJ A;  3C2U A;  3CU9 A;  4N1I A;  2AEZ A;  1Y7B A;  5GLK A;  2B4W A;  1YI7 A;  2YFR A;  3QED A;  1Y9G A;  4AK6 A;  1GYD B;  2QQU A;  3SC7 X;  4U6B A;  2X8T A;  5GLL A;  4N2Z A;  2ADD A;  3OM5 A;  1W2T A;  3D5Z A;  3LDK A;  1PT2 A;  3OM7 A;  4FFG A;  4QQS A;  3WAU A;  2AEY A;  2X8F A;  3AKI A;  1WL7 A;  4UDI A;  3C7O A;  3R4Y A;  5GLO A;  4N2R A;  4D47 A;  3BYL A;  4O8N A;  1GYE B;  4UDG A;  5JOZ A;  3VT1 A;  5FLW A;  4KC8 A;  4U6D A;  3QZ4 A;  5C0P A;  3WPY A;  3WPV A;  3OM4 A;  1Y9M A;  3WN2 A;  3LIH A;  2EXI A;  4PVI A;  3ZXJ A;  4COT A;  5GLR A;  5GLN A;  3ZXL A;  4AK7 A;  5GLM A;  5GLP A;  3KF3 A;  1GYH A;  3D5Y A;  3WPZ A;  4UDK E;  3U75 A;  3BYK A;  4KCB A;  2QQW A;  5FKB A;  3NQH A;  3R67 A;  5A8C A;  5A7V A;  3ZXK A;  5FIX A;  5GLQ A;  3LDR A;  3TAW A;  3UGH A;  5A8D A;  2EXH A;  3LIG A;  4O8P A;  2VDT A;  3D61 A;  3LV4 A;  3VSF A;  2EXK A;  4EQV A;  3WN1 A;  1YRZ A;  3VT0 A;  4PVA A;  3VSZ A;  3OM6 A;  3VT2 A;  4KCA A;  1UV4 A;  5FMD A;  4NOV A;  4MLG A;  5A7V B;  3R4Z A;  3VSS A;  4UDJ A;  3QEE A;  2X8S A;  3OM2 A;  4KC7 A;  3WAS A;  4KMI A;  3C7H A;  3RWK X;  3WN0 A;  2QQV A;  1OYG A;  4AK5 A;  1VKD A;  2ADE A;  4O8O A;  5AYC A;  3UGF A;  5FK8 A;  3C7E A;  2OXB A;  5FMB A;  2AC1 A;  3AKF A;  3AKG A;  3KF5 A;  3PIG A;  5AYE A;  5JOX A;  3C7G A;  3QEF A;  3BYN A;  3WPU A;  3BYJ A;  4ONZ A;  5FMC A;  3C7F A;  3WMZ A;  4UDK A;  1Y4W A;  3WMY A;  2YFS A;  1YIF A;  3QC2 A;  5B6S A;  5AYD A;  3WAT A;  4FFF A;  5AY9 A;  5FK7 A;  4N4B A;  5JOW A;  4FFH A;  4FFI A;  5JOY A;  1W18 A;  3P2N A;  3UGG A;  2YFT A;  3LFI A;  1UYP A;  5B6T A;  5ANN A;  2EXJ A;  3LEM A;  3D60 A;  3LF7 A;  3AKH A;  5FKC A;  2XQR A;  3VSR A;  1ST8 A;  3U14 A;  3KST A;  3K1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...