1YI7A

Beta-d-xylosidase (selenomethionine) xynd from clostridium acetobutylicum
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
534
structure length
534
Chain Sequence
SLIKNPILRGFNPDPSICRADTDYYIATSTFEWFPGVQIHHSKDLVNWHLVAHPLNRTSLLDMKGNPNSGGIWAPDLSYHDGKFWLIYTDVKVTDGMWKDCHNYLTTCESVDGVWSDPITLNGSGFDASLFHDNDGKKYLVNMYWDQRTYNHNFYGIVLQEYSDKEKKLIGKAKIIYKGTDIKYTEGPHIYHIGDYYYLFTAEGGTTYEHSETVARSKNIDGPYEIDPEYPLLTSWHDPRNSLQKCGHASLVHTHTDEWYLAHLVGRPLPVGNQPVLEQRGYCPLGRETSIQRIEWVDNWPRVVGGKQGSVNVEAPKIPEVKWEKTYDEKDNFDSDKLNINFQSLRIPLTENIASLKAKKGNLRLYGKESLTSTFTQAFIARRWQSFKFDASTSVSFSPDTFQQAAGLTCYYNTENWSTIQVTWNEDKGRVIDIVCCDNFHFDMPLKSNVIPIPKDVEYIHLKVEVRVETYQYSYSFDGINWSKVPAIFESRKLSDDYVQGGGFFTGAFVGINCIDITGNNKPADFDYFCYKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-xylosidase, family 43 glycosyl hydrolase
publication title Crystal structure of beta-xylosidase from clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
total genus 141
structure length 534
sequence length 534
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF17851 GH43_C2 Beta xylosidase C-terminal Concanavalin A-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yi7A02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 1yi7A01
4M01A 1OKQA 3U4XA 2PHWA 4BQ1A 1LU1A 4GKXA 5JOXA 4WVWA 3C7GA 1G9CA 3N3HA 3WN0A 1GICA 1N1YA 4H55A 1LTEA 1GZCA 1C4RA 4YW3A 4IQPA 1KDMA 5A7VA 1CQ9A 1LJ7A 3D5OA 1CPNA 1YYNA 1OQ1A 1Q56A 1DQ1A 3ZYRA 1PT2A 4FFFA 4PF5A 1R1ZA 4KC8A 2CL2A 3WN1A 1N1TA 1QOOA 2B4WA 2WQZC 5H9PA 1ULFA 2NN8A 4XJWA 3UK9A 1AZDA 4YG3A 4U6DA 2DVGA 4R9CA 1RINA 3BOPA 2A6WA 4KBBA 4L8QA 3FLPA 5CNAA 1WBLA 2D6MA 3WG2A 4PVIA 3QLQA 1G9AA 2D3RA 1AXZA 2DYCA 1IS3A 4AGRA 3QEDA 2ARBA 3AP7A 3C2UA 3NV4A 4K1YA 1O4ZA 3UGGA 1DZQA 3UGHA 3WCRA 3R05A 1S0IA 4HL0A 2GNMA 3O0WA 3PVEA 4R9AA 5T55A 3SITA 1ULGA 4FOVA 1OYGA 3N7KA 2ZMLA 3AZYA 2A5ZA 3FLRA 3U14A 2R16A 2PHXA 5GLUA 4ASMB 1ST8A 1LENA 3UGFA 4LBQD 1MS9A 1SFYA 4AGGA 3POYA 3VT2A 1S0CA 2GN3A 4FPFA 3QEEA 4GALA 2GMEA 3AP6A 3WOGA 2VY0A 5A7VB 1ENSA 2WT2A 2FHRA 4YG0A 3V0AA 1I3HA 2LALA 3SLIA 3ZXLA 4ATEA 1MS0A 4FOWA 4DRRA 4YM2A 2VH9A 5HCAA 1IKQA 2ZGUA 3M3QA 1VALA 3AZXA 1H9WA 2R0HA 5EYYA 5JMCA 2EXKA 5JDBA 3TAWA 3ILNA 1ULDA 1DQ4A 2V5YA 4XDQA 1S0FA 4R9DA 1U0AA 2UWBA 1LOCA 5GZDA 1LOBA 1CVNA 2A71A 3ILRA 3ZXJA 1UN1A 4UW6A 5IK4A 3HMYA 3Q9OA 3V0BA 5FK7A 1SLBA 2QQWA 5T5OA 3TB0A 2D6KA 1Q8OA 4YW2A 2ZGQA 4Y1UA 1LOFA 3ZYPA 2A3XA 4U2AA 2D3SA 2WJSA 1CIWA 2KM2A 4FVVA 4Q1RA 4XTMA 2JE7A 2DUOA 2AEYA 3QZ4A 4O8NA 2W08A 5HCFA 1SBFA 1W0OA 3M3OA 4ISQA 4XOGA 1QGLA 3VV1A 4QQSA 1A78A 1Z0HA 2GMPA 3BODA 3R4ZA 3R4UA 4BLIA 2ADDA 5GLMA 3ZSKA 1KRIA 5JOYA 3ILFA 1FNYA 1YRZA 2PELA 4AVSA 2V73A 1GYEB 1WUVA 2UU8A 3OYWA 3PIGA 4O8PA 5AY9A 3M1HA 2NYYA 3WHTA 3O0VA 3CNAA 5GJ6A 1DYKA 2ERFA 5CAZA 1C1FA 1Z78A 3V0AB 2A75A 3N7LA 3OGGA 2EIGA 4XJZA 1LECA 4XJ8A 1W2TA 4M3CF 1TEIA 3OM2A 1JW6A 1DHKB 1SCSA 3UJOA 2YXSA 2ARXA 2ZGOA 1GNHA 4Y26A 5IK8A 3BYKA 4U6BA 2CNAA 3RMYA 4JCKA 1W6QA 3WDXA 2W52A 3MPPG 2DVAA 4XHBA 2E6VA 3B00A 3WAUA 1WW7A 5H9RA 5E8AA 3BYJA 5GZEA 3PIJA 3VSFA 4FPYA 4CRQA 1V00A 1WLWA 5DUXA 3HN1A 1W6PA 4FPHA 1LESA 4NOVA 2OW4A 2ZAAA 4P9YA 3ZXFA 3BYLA 3WCSA 1G8WA 5GLPA 1KJRA 1LOEA 2WNEA 3AZWA 3VUOA 3WHUA 5DZGA 1V6OA 1HQWA 1V6KA 5EYXA 2AEZA 1D2SA 4FFGA 3OM5A 2ZHMA 3M3CA 1G9FA 2VW0A 2E51A 1PZ9A 2ZGKA 4WV8A 1MZ6A 1VLNA 1GBGA 3AXDA 4XIKA 4YGDA 4BM8A 5CB7A 1QF3A 4LBJA 2DV9A 2WKKA 4LBKA 1G9BA 3OYWB 4FPJA 3M3EA 4FPKA 5GLVA 1S0GA 2EALA 3D60A 3P2NA 3WATA 2H0BA 2YROA 1Y4WA 1CJPA 4YGCA 4YM3A 4RA0A 1MS1A 1GYKA 2DTYA 2YY1A 3WMZA 3O5SA 3AJYA 4XMIA 3C7HA 4YZ1A 1JOJA 4GXLA 3RS6A 3W59A 4YM1A 3BYNA 3IKWA 1W6QB 3FLTA 1FAYA 1GZWA 1EPWA 2ES3A 3A0NA 1I1EA 3BTAA 1VAMA 2NMOA 4YFWA 1VAVA 5FLWA 3D61A 1N47A 2XG3A 2ZA9A 2OVUA 4XBLA 4AVVA 2A7AA 5H9SA 4ZKTB 3ASIA 1KJLA 3L2YA 4N1IA 1W6PB 2DVFA 1IS6A 1JYCA 1SLLA 2NMNA 4XXAA 4YZ4A 1O4YA 1QOSA 1YIFA 1QNWA 4JC1A 2EF6A 4Y20B 2YFRA 1DLLA 3APBA 1ONAA 2R1BA 1WD3A 3C7FA 4YZ5A 1URXA 3N7JA 3WN2A 3RQ0A 1WD4A 2JKBA 3NV3A 2SLIA 3N35A 4FP2A 4N4BA 2OUJA 4TZDA 1BJQA 1ENQA 1A8DA 1IOAA 1JN2P 3LDKA 3VKFC 3QEFA 2JDZA 1LHUA 5T5LA 2ZMKA 3AP5A 1WW6A 3VKLA 2GN7A 2D6PA 3SH4A 5FIXA 1AJOA 3R4YA 1C57A 3NV1A 1HKDA 1W6NA 3WG3A 1G9DA 3D4KA 2P3IA 1V6MA 1YXWA 1AX2A 5E88A 5GLRA 5AVAA 4XJAA 4P14A 4BOWA 1GZWB 1S0EA 4M3CA 4P9XA 1BYHA 1DFQA 1QU0A 3KM5A 2A3YA 2VW2A 2YFTA 2R1DA 3BIWE 2OXBA 4Q27A 1MS5A 1UAIA 2ZGTA 5B6TA 5IUQA 2ZGNA 1UKGA 2JD4A 1MS4A 3D6EA 2P3KA 1SLAA 3I8TA 1UV4A 3AZVA 1G7YA 3FUQA 1OFSA 1W6OA 3WNXA 5KXDA 2ZKNA 1ZM1A 4DRVA 1JUIA 1GKBA 5CA6A 2AR6A 4OZXA 2ZGPA 2Z42A 1BQPA 2Q5TA 4NO4A 4YGBA 3W58A 1WLDA 3AP4A 4BMEA 3LF7A 1S0DA 3AKGA 4MLGA 1GV9A 4RL7A 3R67A 1AXYA 1CONA 3AYDA 1Q8VA 3JUUA 4I30A 1KQRA 3LFIA 1PZ7A 2CY6A 1NXD1 3SC7X 2D43A 4XTPA 1APNA 1ULCA 2AGSA 1LGNA 3B9CA 3H0OA 4PCRA 3AKFA 4FFIA 4LBOA 4FOYA 5T5PA 3ZSJA 1AXKA 2I2SA 1QMJA 1ULEA 4AVTA 1NLSA 3WV6A 3WMYA 4YW4A 4CZSA 5HCBA 4UDKA 2D44A 4XXPA 2UWCA 4Y1VA 3T2TA 2EXJA 4FPEA 3A4UA 4PQ9A 3O0XA 4Y1ZA 4TYSA 2ENRA 4YGEA 1W6NB 1LGBA 1UX6A 1AVBA 3CU9A 2A70A 2W39A 3OY8A 2A6XA 1RIRA 4BMBA 2UWAA 3KSTA 5IK5A 1V6NA 5T5JA 5GLNA 3VT1A 2CTVA 1A3KA 2CWMA 4O8OA 1IS5A 2ZGLA 1FATA 2EXHA 2DWRA 1X50A 4XIOA 3AX4A 4MYEA 1SBDA 4XZPA 3WDWA 4UW5A 2PHUA 1QDOA 3POSA 3C7OA 4XMAA 4N2RA 3WPVA 2D6OX 2ZMNA 1W6OB 1VIWB 2R49A 5DUVA 4LBQA 1GNZA 4YW1A 5JOZA 5GLQA 1N3QA 2HYKA 4D47A 1UZZA 4Y1XA 1Y7BA 4C1XA 3B3QE 2UURA 1FX5A 1WLCA 3JU9A 4FPOB 3B69A 5GLWA 3V0BB 5AYCA 1LEMA 3U75A 1MACA 1WCSA 3AYCA 3IPVA 4K1ZA 3AZZA 1QKQA 2EXIA 2DTWA 3ZSLA 2D6LX 4GA9A 4C1WA 1CN1A 5EWSA 1GYHA 2XB6C 3GALA 4NOTA 1DGLA 4YG6A 4XJ9A 5H9QA 3TAYA 5A8CA 5C0PA 5KXBA 3VSSA 4YFZA 2PHRA 1SLCA 1H9PA 4Q1PA 1LHOA 1MS3A 3WG1A 4YW5A 4DFSA 5T52A 4F83A 1YO8A 1LOFC 1QDCA 2WSUA 2A6VA 1F31A 5AYDA 3OY8B 1AJKA 1DQ2A 4WVVA 3AJZA 5A8DA 1FYUA 3WDTA 3NQHA 4ONZA 1QOTA 4XJUA 1Q8QA 2ZGSA 2ADEA 2DUQA 1G86A 1DYPA 1IKPA 4FPCA 3AYAA 1DQ5A 1LHWA 3NWKA 4FQZA 2YFSA 4N2ZA 1KDKA 2ZACA 2VDTA 3KF5A 3MW4A 1S0JA 3VKMA 4LBQB 5GZFA 1QNYA 2DU1A 3MEPA 3MW3A 4W65A 2JJ6A 3A0KA 5DUUA 5ANNA 4LBNA 4P9WA 1LGCA 1IS4A 1S0BA 2DVDA 4XE9A 5IT6A 2GNBA 3SISA 3IPVB 2JE9A 3GNEA 1W0PA 4FPGA 4XILA 4KMIA 5FKCA 4SLIA 3LCPA 3AKHA 1CR7A 1HDKA 3OBTA 1YI7A 4KCBA 1WW4A 2RHPA 3WUCA 1UL9A 2AENA 3AXEA 2NP0A 5FKBA 1WBFA 1DQ6A 2P3JA 3AKIA 1GZ9A 4UDKE 2P37A 3N36A 2AC1A 3D5YA 2B7YA 2CWSA 5FMDA 3RWKX 2VUAA 4LBMA 3ZSMA 5FREA 1LEDA 4PBOA 5DUWA 4UW3A 1CESA 4UDGA 3VKNA 4DQAA 4WZFA 1Q8PA 1CPMA 5DG1A 1VKDA 4PVAA 1KITA 5DG2A 3WVJA 5FRAA 2ZZJA 5B6SA 3D5ZA 1S1AA 4EQVA 1LODA 4YZ3A 2OUHA 4XHXA 5JLVA 5GLLA 1JXNA 1C1LA 1J1TA 3KQRA 3PVOA 3LDRA 5E89A 4AK5A 3KF3A 2AH2A 3WUDA 2NZ9A 1LU2A 2GNTA 3WG4A 3USUA 3ZPYA 3M2MA 3OBRA 4UDIA 3QCWA 1LOGA 3OJBA 4D69A 5FK8A 1V6JA 5F9TA 5BYNA 2WSVA 3PVNA 2P34A 5EXOA 5GLTA 4HANA 3WDVA 2DVBA 2GMMA 1SBEA 4AGVA 1W6MA 1F9KA 1RITA 5GLZA 2VU9A 4GWMA 5DZEA 2ZGMA 3IM0A 1MS8A 1DQ0A 5JVVA 2X8TA 5GLKA 1UZYA 5AYEA 2LTNA 1D0HA 1LCLA 3VSRA 4R9BA 4YLZA 4COTA 5T54A 5GM0A 2GNDA 3PJQA 3V65A 5KXCA 4Q26A 3VSZA 3HR9A 4M00A 3LSEA 1N1SA 2BQPA 2A6YA 1V6IA 1ZA4A 2VW1A 1H30A 1N1VA 4YM0A 4DS0A 1JBCA 2R0FA 3AP9A 1Y9GA 2EAKA 3AYEA 5DXDA 1SCRA 2AUYA 1MVEA 3MW2A 2XQRA 4FFHA 4Z8BA 1LHVA 4Y22A 5L73A 3UJQA 2ZGRA 1FV3A 1AF9A 4CTEA 1LHNA 2D3PA 3RMXA 3ZXEA 1UYPA 4AK6A 2QQUA 4ISRA 4Q2FA 2E7QA 4FOQA 2GALA 3ATGA 5GALA 4Y1YA 5KXEA 2DUPA 3LEMA 3PMEA 3VKOA 2NM1A 2E7TA 1MR5A 1N3PA 1AX1A 1GSLA 3USUB 2JECA 3WZ1A 3LIGA 3UL2A 3LSDA 3B01A 4Y24A 1FNZA 1ENRA 2YZ4A 2TEPA 2WT1A 1Q8SA 2AREA 2ZABA 1UMZA 5T50A 4M3CB 2ZHLA 3DGTA 4BPZA 2PHTA 1W6MB 3AFKA 4XYXA 4YZ2A 2VXRA 3FUOA 3FFZA 1Y9MA 3N7MA 2C5DA 1GLHA 3FBYA 3WDYA 2YV8A 4KCAA 2G4IA 4UDJA 3ENRA 3V64A 1BZWA 4Q8LA 4ZXKA 3VT0A 4AYUA 2W68A 1N3OA 3OM6A 3SNMA 3NV2A 2QQVA 2A3WA 3LIHA 4K21A 4K20A 3ZVXA 4PBPA 1BKZA 4GWNA 1HLCA 3C7EA 5GZGA 1WL7A 3WLUA 5FMBA 4FPLA 1BXHA 3WDUA 3RSJA 1PZ8A 3ZXKA 4ITCA 1JYIA 3QC2A 5CBLA 2WLQA 3LV4A 4JRAA 3OM7A 2P2KA 2X8SA 5JOWA 1GANA 4BLJA 3T1MA 4Y22B 3I4IA 1SLIA 2WT0A 2YMZA 3OPZA 4XBNA 2ZBJA 3WASA 1B09A 1JHNA 1LULA 3R4SA 1MVQA 5GLOA 5DZFA 3AK0A 3WPUA 4ATFA 3OM4A 3K1UA 3O12A 3WPYA 3T1LA 1DBNA 4DPNA 2AYHA 3SH3A 5F5QA 2PHFA 4M3CE 3RRDA 1XQNA 2CYFA 3IMNA 5LK5A 2ZHNA 4LBLA 4KC7A 4XBQA 3SH5A 2X8FA 1FV2A 3DUIA 4Q8KA 1SACA 5IK7A 3POWA 1GYDB 2GDFA 5GZCA 1HQLA 1MZ5A 5FMCA 4Y20A 1UPSA 1WW5A 1W18A 2A6ZA 3INAA 5SV8A 1AX0A 1SLTA 2FMDA 4UW4A 2DU0A 1LOAA 2ZHKA 1DIWA 2SBAA 2D6NA 2C9AA 4AWDA 4GKYA 2DURA 3RG0A 2D7FA 4FP3A 3IN9A 3WPZA 4AK7A 4FQ4A 1V6LA 1F5FA 2E53A 4U36A
chains in the Genus database with same CATH superfamily
1OKQA 2B5HA 4QPGC 5JXJA 4GKXA 5DAQA 3V56A 4AFDA 4IGOA 1OSGA 2CU5A 1G9CA 2EAAA 1N1YA 5FYHA 3KT4A 1GOGA 1NXMA 1WMDA 4IQPA 4X6QB 1CQ9A 3D5OA 1OQ1A 1HRV3 1YYNA 1Q56A 1DQ1A 3KVAA 3ZYRA 3ROUA 1MZEA 2P1BA 2WN3A 5LRSA 2ID4A 3O1PA 4N53C 2VMGA 4KC8A 2CL2A 3VBRB 3WN1A 2FDJA 1F35A 5IW0A 3WW4A 1QOOA 4ZZ5A 5J37A 5H9PA 4U6DA 3J7HA 5DDJ2 2W3JA 2WAOA 4F3JA 1W05A 4IEXA 2FD8A 2LM3A 1E5RA 3VZMA 4L8QA 3VHOA 3W9AA 2X8KA 4E27A 4E9KA 2V5DA 3FLPA 4EJRA 2D6MA 4JGYC 1PO13 1RUI1 3QLQA 5IJRA 2X10A 4PVIA 4Q29A 2FDFA 4BQXA 4CU8A 3VBOB 1QH7A 4K1YA 4C90A 4OHXA 5LASA 3UGGA 3UGHA 3NNLA 5AC92 3I49A 3KVBA 2GNMA 4CDWA 1KGYA 3PVEA 4R9AA 3N7KA 5FZFA 1FOD1 3AZYA 2A5ZA 3WF2A 2R16A 5IVVA 1I6XA 1ST8A 3O1SA 4QGMA 1MS9A 1SFYA 1F4AA 3VT2A 1S0CA 1NKGA 1TG7A 3HOBA 1ASJ2 5C3SA 1VB4A 5L36A 1R1A3 1O3SA 1WA4A 2D40A 3VD7A 5A7VB 1ENSA 3V0AA 2LALA 3SLIA 1GUIA 4ATEA 3D82A 2VH9A 1GR3A 2RR13 5C8CC 5HCAA 3CKHA 2ZGUA 3BTZA 4CUBA 1QJY2 2XVLA 4CDUC 1JTZX 1NY72 1SPPA 3H3ZA 4JDNA 4QX0A 4JDMA 3ZO0B 4D7SA 5IAVA 5FZOB 1DQ4A 2ZJCA 3I3QA 5CG8A 1OHFA 3WW3A 1HXS1 1LOBA 5D8AB 1T2XA 4UW6A 3HWJA 2R063 3KT7A 2WS91 2D6KA 1XNCA 4NIAA 1RUH2 5FP9A 2B42B 2J7MA 2ZGQA 4Y1UA 5K9YA 4E4SA 2WYSA 2WO7A 2WJSA 3I2FA 4PJYA 4JRLA 5FCCA 1BHGA 3QZ4A 1W0OA 4CE8A 1VE0A 3TNPB 4XOGA 1CX4A 2R32A 4G4FA 1Z0HA 4L11A 5FY1A 3R4ZA 2P6HA 2BFUS 3FFQA 3TEZA 2CHHA 4PLMA 1Z7S3 4YRDA 3ZYIB 5A33A 2H6CA 3N9OA 1MQTA 1WUVA 3QOPA 3OYWA 5KHHA 1C1FA 1Z78A 2BERA 3HQUA 4CCEA 4CPBD 2RMU1 3H9AA 3N7LA 4AG4A 1YFYA 1LECA 4XJ8A 2VTFA 3B7MA 1YFXA 4M3CF 5FBJA 3VBSB 2WWSA 4IEVA 4JGZC 3OM2A 1SCSA 3JQXA 4HPKB 2R043 4OLLA 5F3IA 2IUWA 5D1IA 1XYNA 1RHI1 4Q4V2 1RTVA 1PO23 3ST7A 3VBUC 4JCKA 1W6QA 2K2SA 4MXWA 5F5IA 1VBC3 2DVAA 2WQ8A 3A7QA 4YVSB 4AZZA 1WW7A 5H9RA 4DY3A 5B4NA 5GZEA 3KHBA 3QH7A 5CYYA 2WFF3 4P9GA 1CGPA 4RSUA 4FPHA 1LESA 4INDA 1NLRA 1S2BA 1COV3 1KJRA 3AZWA 3DXUA 1AR91 1WGPA 5BXXA 5EYXA 3ZYGA 4ET7A 5ANQA 2PFWA 4JKMA 5C3RA 3M3CA 2XLAA 1TNRA 4A3XA 2E51A 1CWPA 4OI4A 2PXJA 4KQ7A 5HXMA 4PI0A 4WV8A 1ZX5A 2C6SA 4XIKA 2XWBB 1JYNA 4BJ0A 2VJXA 2WKKA 1YCIA 1AYN2 5EQUA 4Q0SA 2XDVA 4XF9A 4K9SA 4NIIA 3P2NA 4NHYA 4NHKA 2GC1A 1H8TC 2RJKA 1SFNA 3CQOA 3BPZA 4NPMA 4IERA 1GYKA 5C4WA 1HJFA 5L7OC 3C7HA 4MGSA 2JIJA 2HWB3 3NW4A 3O1MA 3KGZA 1IQAA 1YWKA 3BYNA 1R083 3BVCA 4Q4V3 1C8NA 4K8FA 4W6XA 2HBTA 1VAMA 2W1SA 3W5NA 1LB2A 2YBPA 4MADA 1RUJ2 1DLCA 5FUPA 1H4GA 5H9SA 2PQQA 3ZYFA 4UXAA 4LO6B 3M8LA 3WNKA 1CZVA 2CV6A 1TE1B 1W8NA 3LOBA 1ONAA 2EVXA 1WD3A 3WN2A 2QUOA 1W2UA 3VBRC 4OI2A 3NV3A 2RJLA 3N35A 3H3LA 4FP2A 4QXBA 2WZ8A 4TZDA 3O1TA 3LDKA 2Z79A 1IOAA 5FR3A 4RFRB 1YQCA 3VKFC 1ZZ9A 5A7OA 2JDZA 2Y8KA 3J8F3 2JDHA 4LO8A 2ZMKA 2Y0IA 4M0NA 4AEJA 4UFHA 3VKLA 3BI3A 2D6PA 2ORZA 3D8CA 3ZFGB 1VBA1 1R091 3DYOA 4OMCA 3VBOC 3D4KA 4OUSA 4JZRA 1AX2A 5E88A 3MIEA 2XXZA 1TME2 2ZX1A 3ZXAC 3FWEA 3I59A 1ZBA2 1HB1A 1S0EA 2YFTA 3KM5A 5J96B 1UCXA 3DV8A 2O8OA 3O1RA 4KL1A 2VOVA 4MGQA 1MS5A 2RS31 1CZTA 3LOIA 3T3YA 3TWIA 2BWCA 2FCVA 2P3KA 1UV4A 3I8TA 3BKZA 1I5ZA 2VUJA 3WNXA 5KXDA 2WZEA 2YYOA 4DRVA 3WW1A 5IHRA 1VBD2 4OZXA 2VE1A 2ZX2A 3B94A 2C4XA 3IDBB 3LF7A 4BMEA 2FDHA 5FZKA 3LEIA 3KZ4C 2XJRA 5A3MA 3EQEA 4MLGA 1AXYA 2JG8B 2NPIA 4BQWA 1AR63 2FZ2A 4QX2A 1PZ7A 1NXD1 2VOXA 3OUJA 3ZKUA 4EE2A 4DMIA 3AKFA 1EV12 1W8UA 3GCXA 5ISLA 2VPVA 5JUVA 4LBOA 5D8AC 3ZSJA 5CADA 2I2SA 2QQOA 1MPXA 4XACA 4YW4A 1TQ5A 3UT0A 3JBG1 2YPJA 5HCBA 1D2QA 1QHDA 1ALYA 1CD3G 1UYZA 2D44A 2PAMA 3A4UA 3KLSA 4LIUA 4O7XA 4PQ9A 4ZPIA 4CXWA 1W6NB 1QJX1 1NE4A 2A6XA 2RE9A 3POEA 2UWAA 4GB33 1V6NA 1RMU1 4QGLA 4QKDA 5T5JA 1A3KA 4QHZA 3O7OA 1IS5A 3Q8CA 2ZGLA 4DIQA 4EZ4A 1FATA 1W2NA 4GH4B 1ZZ8A 2BVBA 3POBA 4D7YA 4O9GA 4XIOA 3AX4A 4BYYA 2PTMA 1SBDA 4PF1A 4UW5A 3K4DA 4V2VA 4GMP3 4XMAA 5DUVA 2UY9A 1ZNPA 2Y38A 5JPMB 5GLQA 1UZZA 4D47A 4MHUA 1W9FA 1Y7BA 1E5SA 5GLWA 5GKAC 1VMJA 2NLRA 3AYCA 3VBSC 4LR4A 3JD73 2G9FA 2DTWA 1SG3A 4COUA 4FSJA 3J7LA 1CN1A 5EWSA 1JI6A 4YWAA 1GYHA 4P08A 5CFCA 5JI7A 1DGLA 1MEC2 4QX8A 4YVSC 3TAYA 2YFZA 4COWA 4N9IA 2D5FA 1Q3EA 1ZA7A 4LQRA 4YFZA 4P9LA 1SLCA 1H9PA 4W50A 2IXIA 2JKXA 4EROA 1LHOA 1OXCA 4CP0A 5T52A 2WNVB 4AEDA 3ACGA 2RJ2A 4YW7A 1JYWA 4K8RB 3OY8B 1AJKA 2OZJA 1RXFA 1PVXA 4WVVA 2ARAA 4L99A 5A32B 1FYUA 5A8DA 1AL22 4PDWB 3WDTA 4CCOA 3PU3A 2W1UA 3ACFA 4HFSA 1GNYA 5IVYA 4AVCA 1PGW1 1DQ5A 3NWKA 3MUZ1 3H42B 2HWE2 2ZACA 2VDTA 3TN92 3MW4A 3VKMA 1SHWB 1QH6A 4W8JA 3ORJA 1NCRB 5FYMA 3RPQA 2VTXJ 5GZFA 5ACA3 2G9ZA 2ZEWA 1D4VB 3MEPA 1AR83 4W65A 3VDAA 3U07A 5IT6A 1W03A 2VM9A 2DVDA 1D4M2 4GWIA 4HN0A 4Q0VA 4YVWC 1UIKA 3EBRA 3IPVB 5FKCA 5CEHA 3LCPA 4W4ZA 4NPRA 4CPBA 3T0BA 2BTVC 1YI7A 5F2WA 3KV9A 3VD4A 1XE0A 1UL9A 1JS9A 3AXEA 5FKBA 1FT9A 3AKIA 1GZ9A 3N36A 2OQ7A 3OEBA 3EMRA 1UX7A 5FMOS 5C9AA 5FZ4A 4TLGA 1LKNA 4WZFA 4ZONA 4LHKA 1CPMA 5DG1A 4E4DX 5F7UA 4PVAA 5DG2A 4Q0QA 5B6SA 2ZZJA 1S1AA 4KU8A 4PLOA 2UYAA 1LODA 3ZFFA 4EQVA 2Q8OA 4R4ZA 4XHXA 5JI9A 5CU1A 3H8XA 4MGYE 4Q4W2 2VNOA 3PVOA 5BNNB 1UMIA 1VBE3 3NMBA 2C1FA 5L9VA 3ZDSA 4Z1VA 3MDPA 3USUA 4EN7B 1LRHA 3OBRA 5LW9A 3ZR6A 4IESA 2WSVA 2PA7A 4V2WA 3ZMOA 1C8M1 1SBEA 1S4CA 5FYCA 4QQHA 4DINB 1AR71 1RITA 5GLZA 3ZFGC 5J3UA 4MG2A 2X8TA 4CEWB 1OOPB 5AYEA 2YGMA 2QQKA 3K77A 3ZDVA 5FOBB 2ZTNA 3K51A 4COYA 1XJAA 4NUBA 4R9BA 5FZIA 2X53S 5HV4A 3VSRA 1RUC3 3CF6E 4LK7A 5KXCA 1PGL2 2VL4A 2VBBA 2XJQA 3ABZA 5A3WA 4CDXB 4QX5A 1H30A 1CIYA 1JBCA 3I3EA 4NHLA 4BA6A 1SCRA 1OLRA 1MVEA 2AUYA 3MICA 3MLJA 3DL3A 4FFHA 5L73A 4Y22A 2RS12 3LPGA 1FV3A 1AF9A 4Z82A 2E9QA 4AF9A 3MF9A 5J48A 2QQUA 2JE8A 1XSRA 2GALA 4KWLA 4LJHA 4FT8A 4JV4A 4HK9A 3CU7A 2E7TA 2N7GA 1W04A 2JG8C 1RUE1 1GSLA 2HWC3 2XL9A 2EIBA 2Z2SB 4RGGA 3IAPA 4WM8B 3UL2A 1BLZA 5CFDB 1FNZA 4O9EA 2TNFA 1YC61 1Q8SA 3GDBA 2V4AA 4DUWA 3V0BA 2J42A 3FFZA 2C5DA 1NX9A 3RNSA 1GLHA 3JD71 3S7IA 1NCQA 3E97A 4Q8LA 4AYUA 2MEV3 2QNKA 3RGBA 3OM6A 3LIHA 1FPN2 4IEZA 4QPIA 4PBPA 1FMD3 1GOHA 2X05A 2VNVA 3T4HB 3MZHA 1WL7A 3RSJA 1H1IA 4GH4C 4BXFA 3ZXKA 5HBAA 4DXSA 1HRI2 2JDKA 5I91A 3MIDA 4MGIE 4JDOA 4Y5Z0 2RDRA 3KV5A 1RVF3 3I4IA 3KCXA 3UESA 1IPJA 2YMZA 4L2NA 1YQ2A 3PURA 3SCFA 3WASA 4IV1B 3R4SA 1CAWB 4Y20A 4ES8A 5I0UA 1K5MA 5DZFA 3AK0A 5FQ0A 1FI2A 3OM4A 3RYKA 2QJVA 3J9SA 3ZN6A 1BEV2 1BK0A 4XQWA 1QJU2 1DBNA 3FN9A 4RQPC 4DPNA 4PQQA 1XC6A 1J3QA 4M3CE 3RRDA 1XQNA 1UW8A 2CYFA 2ZHNA 3D0JA 5K4LA 2X8FA 3PUAA 3NJVA 5GZCA 1MZ5A 2OA2A 1O5UA 2TUNA 4WVZA 1W18A 1OUXA 2A6ZA 5SV8A 4BE3A 2BP6A 4UW4A 1O91A 5DN2A 4KBZA 2SBAA 1LR5A 1U5YA 2HEYF 4AWDA 5F8PA 1BMV2 4PDWC 1RUF1 4QX7A 2DURA 2RM23 2D7FA 4FP3A 4LO7A 1K45A 1WZXA 2ARCA 2E53A 5DMYA 1UZ0A 3U4XA 1XU2A 4UFLA 4N53B 4BQ1A 4XUPA 3RJ2X 5A1FA 3FL7A 4AHZA 5JCTA 2EIEA 4WVWA 1GFF2 1NCRC 3C7GA 3ES4A 2Q8DA 5A6QA 1GICA 2DCJA 1S2EA 4BQ5A 3OG2A 4A6OA 4LT5A 2JG9A 3K3OA 5F3CA 4YPJA 1KDMA 1LJ7A 2VC9A 2WR9A 4DXTA 4J6GA 1NA1B 1BEV3 1QY4A 4PF5A 2A1XA 4I02A 1HB3A 1R1ZA 1EYBA 1VRH1 4A3ZA 2V72A 1RUG1 5KWRA 2B8MA 1OT5A 1DF0A 2BOIA 5A3PA 1JZ4A 2B4WA 1CAVB 3UK9A 3H1MA 4B8EA 1XB9A 3QH6A 4A45A 1JOPA 5FY9A 4GMP0 3LD8A 4IV3B 4R9CA 4H3WA 4KBBA 2VZUA 4TWTA 1WBLA 4D6QA 3BCWA 3WG2A 5FPAA 4Z07A 1QQP1 4QXKA 4QDRA 4BWOA 4XCAA 5A3OA 1V9U1 2VMIA 3VDDC 4AGRA 5K7PA 4AFAA 1SDDB 1GOFA 3LA7A 3C2UA 4CCDA 5CISA 3NV4A 2PN5A 1UYXA 3NSTA 5BNNC 4I0BA 1A8MA 3O0WA 3SITA 5T55A 1L7QA 5A6YA 4FOVA 1OYGA 5C5UA 1WCKA 1PK6A 1RUI3 4H7MA 3T08A 3SCGA 1EAH2 3U14A 4ASMB 1BVVA 4AW7A 2B9UA 5FY0A 2JWPA 3LGRA 4META 5A1AA 4MSVA 2VOKA 5FO9B 4HXCA 5CIRA 4FXGB 5FAXA 4FPFA 3I2HA 4CEWC 4YG0A 1GP6A 3ZXLA 4DRRA 4YM2A 4A4AA 1FOD3 1GQHA 4Y3OA 4LLFA 1O8SA 2IXJA 5FZ7A 2B39A 2XR4A 2QFEA 4X6RB 4CDXC 2EXKA 4IGPA 1ULDA 2FZ1A 5JR2A 4CXXA 1WCUA 4ORFA 3HNYM 4Q4Y2 3I3MA 5A3NA 4AI3A 5F37A 3IMMA 1RB8G 1VMFA 4QB1A 1H6XA 3ILRA 2H6BA 1UN1A 4NHXA 1BBT2 3HMYA 3Q9OA 5FK7A 3WY6A 1SLBA 2HWD2 2QQWA 1W28A 3LA3A 4EN8B 2ZX0A 4ZU4A 1VP6A 4YW2A 2XONA 1I9RA 5FV3A 5A6ZA 5BUVA 3W21A 2DUOA 2GC0A 1XRUA 5HCFA 2EICA 1O5LA 4HKWA 1HXS3 3M3OA 4ISQA 3VV1A 1QGLA 4QQSA 5CFDC 3LB9A 1PNFA 3MBWA 2WS93 3R4UA 2ADDA 4RHV2 3K3NA 1CAXA 3EYPA 2Q30A 3MLLA 5A6XA 3ON7A 2V73A 5JXIA 3VBUB 1GYEB 4LE3A 1RUD1 4DEVA 4O8PA 2NYYA 2HH9A 3V0AB 4DY5A 1DYKA 4LOTA 3VHPA 4CP9A 1CAUA 1S2KA 2A75A 4QMAA 4KGGA 2CSGA 2BVVA 4MH0E 1W2TA 1E5HA 2YHJA 4LKEA 1JW6A 5FZLA 4U6BA 2ZGOA 1GNHA 4Y26A 1KFUL 1SPPB 5DPNA 2CNAA 1HRV2 5J98B 4ASLA 3BYKA 2VZSA 2WBKA 1HIXA 1DGRA 2W52A 3CZJA 3MPPG 3B00A 4OFGA 3WDXA 3WAUA 4UFMA 1KEXA 4AFMA 3BYJA 5FZ0A 2RMU3 1REDA 3LEKA 3PIJA 4IGQA 5BV6A 4RR3A 5KHKA 3VSFA 4URAA 4IV1C 1IZ3A 4IEYA 3BGAA 1UOJA 1W6PA 3R0RA 4DXRA 4NOVA 1A6CA 2OW4A 2ZAAA 2BNOA 4P9YA 3AMHA 3ZXFA 1RHI3 1YQ8A 2MHFA 1H2LA 1LOEA 2PAEA 4AL9A 2YU2A 3E1F1 3WHUA 1PO12 1V6KA 3UETA 4OQ8A 4E4HA 3BUCA 3J4UH 2AEZA 2CAVA 1XNBA 4FFGA 2VMFA 2ZHMA 2VW0A 2FCTA 4FTSA 1XNKA 4WM7A 4F8AA 1MZ6A 4MX3A 1RUNA 4LOSA 3OPWA 4BM8A 4LBJA 3BOWA 4LBKA 5IFTA 3N9NA 3OYWB 3CJIC 1CZSA 3M3EA 4FPJA 1AR93 4FPKA 5F6KA 4LNVA 3EHKA 2XLGA 1PMJX 2YROA 1GQPA 1B35A 1CJPA 1W8ZA 4M4PA 4RA0A 5EV7A 1MS1A 5C7GA 1R1A2 4CEYC 4DNYA 1ODNA 5FPBA 3RZJA 4M0HA 4JVAA 2JDYA 3W59A 4YM1A 4Y33A 3A23A 1W6QB 3OBZA 3FLTA 5HV0A 3UV9A 2ES3A 4PI2A 2RR12 4YFWA 4E8CA 5KC5A 2XG3A 1X8MA 2J1TA 2J1SA 2ZA9A 2R6QA 4JQRA 4UFJA 3KQ4B 4XBLA 2W9XA 2Q8EA 4AVVA 5IYYA 5DAXA 4ZU7A 1PMIA 1IS6A 1RJ7A 3MGUA 1J1LA 1YIFA 1QOSA 4JC1A 4QQLA 4Y20B 5JSPA 3APBA 1NA1C 2R1BA 3C7FA 1WKYA 2VQUA 1URXA 2R062 1O4TA 1OQDA 1ZBE1 1OURA 2I74A 5FO7B 4KNCA 4A2UA 1VPHA 2JKBA 5A7WA 3J7MA 1X9TA 1L7RA 1A8DA 1W3XA 1PHMA 3ACHA 3RZKA 1LHUA 4IV3C 1WW6A 4LXLA 1CJDA 3SH4A 5FIXA 4I01A 2WZPP 4XDOA 1AYM1 1Z7S2 4CYDA 5C4WB 2HWF1 3PUHA 1AJOA 1ZYBA 3MIGA 3R4YA 1C57A 2PLV1 4YSFA 1G9DA 4YYOA 2P3IA 4UT5A 2TBVA 4QAWA 2VNRA 2Y33A 1ND3A 4HSJA 3IZOA 4I0WB 4IE0A 4M3CA 4P9XA 3M7AA 5LEKA 5G04L 1VBA3 2D98A 2R042 2R1DA 4NJ4A 5BNPA 4CA9A 1UAIA 2QQLA 1F8VA 1R093 2F17A 1NG0A 1PO22 2XBO1 3U4SA 1VBC2 1G7YA 3FUQA 2OKXA 1W6OA 5I0RA 1OMIA 2ZKNA 3HNBM 3DYMA 1GKBA 3RJRA 1VBB1 3NNMA 4CDQA 2WFF2 3K4ZA 4LO4B 4YGBA 3T09A 3W58A 1DCSA 1WLDA 3WEZA 4BQ2A 2RS33 2QBXA 4B1MA 3R67A 3E5XA 1CONA 1COV2 3AYDA 4AOCA 2ILMA 3SC7X 3LFIA 4BZ4A 3WT3A 2D43A 5ABJA 1ULCA 1ZZCA 4TTGA 3H0OA 4LORA 3RYRA 4MLOA 1AXKA 1WMEA 4ZS2A 1ULEA 1H4HA 5I0SA 2B9VA 2UWCA 3DPRA 3FMGA 2ENRA 1YQ6A 3ZLIA 4LLOA 5FZHA 2W39A 5E1RA 4BMBA 1JZ2A 3KSTA 2GC2A 3ZYBA 4CDWC 5GLNA 2B46X 3AFGA 3I59B 3ITQA 1MZFA 1X9PA 1W8HA 4O8OA 2DWRA 4JTOA 1OI6A 1X50A 2E31A 3JBG3 2HWB2 4GD4A 1OLMA 2BRTA 4MYEA 2VNGA 1OC1A 1IHMA 1QJX3 1R082 3ALQA 4N2RA 3WPVA 5JOZA 4YW1A 4N8MA 1GNZA 3VBFA 3NJZA 1RMU3 4X8NA 5ERLA 5FYZA 3B3QE 1PM7A 1FX5A 1WLCA 2UURA 4FPOB 1VB2A 5AYCA 1FXZA 1LEMA 3U75A 1MACA 3KGLA 4MOAA 1QKQA 2EXIA 2BGPA 2WO3A 2D6LX 3SHRA 4ZY9A 2XB6C 3B9IA 5FPZA 2R071 3OUIA 4YG6A 5H9QA 1YHFA 1PIV1 4XPVA 4QX3A 4AR2A 3LDBA 3AKQA 5BNOA 3CBNA 4PT6A 2PHDA 4AAXA 4AK3A 1UWWA 4Y1VA 3THTA 4Z92B 2OX0A 4YW5A 1HV0A 5I0TA 3VN4A 3O1OA 3J8F2 2WA4A 3ZFEA 1UU5A 2DCYA 2WQ4A 5AYDA 2VUCA 4RYDA 4Q4X1 3NQHA 1UY1A 3T2OA 1YIPA 1Q8QA 4FTEA 2VECA 4YVWB 4LHNA 3LFMA 1G86A 4Y5TA 4E8DA 1LHWA 3HPNA 2YFSA 5M0TA 5FP7A 3U10A 1KDKA 4XZUG 1MQTC 5C71A 2BFUL 4P5HA 3I2OA 5ANNA 3A0KA 1LGCA 1IS4A 3WP4A 4XE9A 1XYOA 2GNBA 2Q0AA 4OHVA 3SISA 2JE9A 2WO2A 1W0PA 4FPGA 4XILA 2OYZA 3AKHA 1O6UA 5LZ6A 1HDKA 4QD2A 2WO1A 1WW4A 2YDEA 4OULA 1F4HA 4CUGA 5CFCB 5DAPA 2NP0A 2J22A 2P3JA 4UDKE 2PYTA 2P37A 3RVHA 2B7YA 3CMGA 2W47A 1O3QA 5FPUA 1JYXA 4D6RA 3NJXA 4RS5A 3VBHA 2LW8A 3ZSMA 2WZR1 2CDPA 2O0OA 1AR62 4H7LA 3DKQA 1CESA 2K46A 2I07B 5JR7B 3VKNA 1I5PA 1Q8PA 5FZDA 3S30A 4AEDB 1VKDA 1WMXA 2JD9A 4QQOA 5FYTA 5FRAA 3FHAA 4L0PA 2WN2A 4IXLA 3ZN4A 2WC2A 3HQXA 4YZ3A 2RS51 5JLVA 2FCUA 1GP4A 3GM8A 2RDSA 1J1TA 4ZU5A 3HNMA 3OGRA 3JZVA 4OQ9A 1W90A 1HX6A 3WUDA 1OA2A 1LU2A 2BV4A 4UFKA 3WG4A 3ZPYA 3ZSEA 2MPFA 1LOGA 3OJBA 4GB32 5FK8A 3THPA 5F9TA 3SQOA 1UF2C 1KXGA 2DVBA 2GMMA 4HANA 3WDVA 4AGVA 1W6MA 2WNUA 1PNGA 3UKNA 5FXZA 1E5IA 4PIZA 2C26A 5JVVA 2BWAA 5G05L 1JZ6A 3KB5A 4IE5A 5C4WC 1UOFA 1W9YA 4L9BA 4RGKA 2LTNA 3WINE 3OOXA 4COTA 5FJKA 5GM0A 2GNDA 3PJQA 1C8M3 3RI8A 4CSWA 3HR9A 3KCCA 4M00A 4QM8A 1N1SA 2BQPA 2A6YA 1V6IA 1ZA4A 1AR73 2WABA 2FMYA 1N1VA 3JD72 4YM0A 1DG6A 4DS0A 3AP9A 1UOBA 2R0FA 5DDJ1 5C9AB 3AYEA 1JOBA 2XQRA 1W2OA 2XHNA 4KWKA 3KHCA 4XFCA 4AQ2A 2QZ3A 3KD4A 1W39A 4OHWA 4IE7A 2D3PA 3ZXEA 1C5IA 4HPKA 1VRBA 3ZFFB 2VCMA 3ATGA 5GALA 3BPSA 5DAWA 3PMEA 5AC91 3USUB 2JECA 1ZREA 2J1EA 3B01A 4DZGA 1ENRA 2YZ4A 3WF1A 1EPZA 2AREA 5HXVA 2ZHLA 4QU1A 2BUKA 3HD8B 1ASJ1 4CU9A 5IVBA 3FBYA 2G4IA 2VR4A 1RUE3 3V64A 3K2OA 3P3PA 4QDSA 3U0ZA 4IEOA 5ACA2 1ZZBA 3SNMA 3NV2A 3U1XA 1AR82 4K21A 3U78A 3IAQA 4B3NA 4YARA 3I3DA 1ULOA 3IB3A 2CGNA 4FPLA 2W94A 3OUHA 1QJY1 4PIYA 3WQ7A 1PZ8A 1NY71 1OUSA 4Y5SA 2GC3A 1F15A 1H8VA 2ZPXA 4EWDA 1Q43A 4EZHA 4JRAA 3MIFA 3PJYA 2X8SA 4FO9A 2VMCA 4RQPB 4Y22B 2VBDA 2WT0A 2D97A 5FY8A 1GMMA 2QDNA 1RUH1 2WLPA 5FZ6A 3I2KA 3PUSA 1PX3A 1J83A 3WPYA 4ES9A 4N7IA 2AYHA 4N7UA 3NAPA 1UYYA 5F5QA 3OF1A 5FZ3A 4S2FA 3WSOA 5LK5A 4PHZA 1Y9QA 2PMWB 2YU1A 4MVTA 4MGZE 3WNOA 1VBE2 4XFGA 3HT2A 4BQ3A 5EIYB 5FLIA 4WZCA 5B4XA 3P1IA 3EO6A 2VVDA 1VRH2 1AX0A 1NCQB 3HAGA 4B29A 5I0DA 1SLTA 4CCKA 1DIWA 4QPIB 4GKYA 4IE6A 3THCA 3RG0A 5A80A 2JB8A 2E63A 5FPVA 4AK7A 4IETA 3MO4A 3E6DA 1DYOA 3H8OA 2JDAA 4LUMA 5DAVA 4N90A 2PHWA 4LUKA 1IG0A 2DBNA 3OCPA 1RUC2 3OD0A 3FE5A 5IAXA 4ARYA 5JOXA 1JYTA 1OQEA 3QACA 4MXVA 4XF4A 5FYVA 1DU3D 2JEMA 3GHNA 3WN0A 3KMHA 1LTEA 1GZCA 2P5BA 1RUF3 3FC0A 3M70A 1K5MB 3VB9A 1XNDA 3G6JB 3ZN6B 1XE7A 3N9PA 4OUMA 4XQ4A 5FJHA 4LMFA 2OZ6A 5TSWA 5CFCC 1N1TA 3VDDB 2ETEA 3GXUA 4XJWA 1HN1A 2D93A 4UF0A 4YG3A 5KC6A 2F6BA 2DVGA 2HWC2 4W6YA 1RINA 2VMHA 1AYN1 1QJFA 3T4VA 4R8HA 4AEDC 3THDA 3BU0A 3HVDA 4G3YC 1VRH3 1G9AA 1RUG3 2IVJA 1AXZA 3OSDA 1IS3A 3H7JA 4FBFA 1X8EA 4K7JA 4Q0PA 3GZTB 4NIGA 1UXZA 1ULPA 5C2MA 1OD3A 1S0IA 3POJA 4HL0A 2EA7A 4OUEA 3ZIWA 4XFIA 1IPSA 1ULGA 2MEV2 4CCNA 4NWWA 1FMD2 2R30A 4XDPA 2ZCWA 2HBUA 1QQP3 2XJPA 4L97A 5GLUA 1LENA 3S7EA 3TYJA 4LBQD 1V9U3 4R52A 4AGGA 3POYA 3WNLA 1EP0A 1UPIA 2AZ5A 2GN3A 1RUJ1 1REFA 3ZXDA 1W8FA 3I2DA 3QEEA 4GALA 2GMEA 3AP6A 3PUQA 3T0AA 2WINB 4YNIA 2WT2A 3WOGA 3O1UA 1RVF2 4C0BA 3NKTA 4FOWA 5FP4A 1ND2A 1YUDA 1VALA 3AZXA 1H9WA 5EYYA 1HV1A 3I97A 3G7DA 5LWBA 3UKTA 2VG9A 3OGJA 2LRPA 3ILNA 2V5YA 4XDQA 1S0FA 4R9DA 3AMNA 3VSZA 5C9AC 3IDAA 2UWBA 1LOCA 1OPOA 4B4QA 4WBBA 3FBMA 4LA2A 2A71A 3WMYA 4CP2A 5FMOL 2YC4A 2HEWF 1U12A 4TLFA 1Q8OA 2P4EA 3ZFFC 2DCZA 4CU6A 2CGOA 1LOFA 4AI0A 2A3XA 2FBEA 4MZUA 2IFRA 5FYUA 1UZVA 2KM2A 1GWMA 4Q1RA 4XTMA 2JE7A 4NIHA 2W08A 2XKPA 1TME1 1POV1 1W06A 4N9HA 1ZBA1 3ZYHA 5KBFA 4B1LA 1A78A 2GMPA 3BODA 5LK7B 1XBFA 2RM22 4JQTA 3ZSKA 4XFAA 1KRIA 4ASKA 3ILFA 1FNYA 1YRZA 2IFWA 2PELA 2WNVA 2KXLA 4UBGA 4EN0A 5T3NA 2UU8A 3AVRA 3PIGA 3M1HA 4K40A 5C5TA 3O0VA 3CNAA 5GJ6A 4I2OA 3QD6A 1VBD1 5FP8A 3VD3A 2EIGA 2W92A 4XJZA 1AUYA 3MI8A 1J58A 3VHNA 1TEIA 2GAUA 5LB6A 2JDNA 3ACIA 3KWVA 1Q5OA 5IK8A 2O1QA 2XL7A 2YC0A 2Z4FA 3VLBB 4EWEA 1RUD3 5FXVA 2VBPA 1DGWA 4NRPA 3IBMA 5E8AA 3UNPA 1EV11 2XWJB 4LULA 3M3IA 3R6SA 1WLWA 4NRMA 2ZX4A 5C3QA 4KU7A 3BYLA 5GLPA 3WCSA 2B4KA 3CJIB 4FI9A 4DB5A 2BOJA 4EYUA 2W2IA 2V09A 1D2SA 4ZXEA 4QPYA 2JENA 1G9FA 1H2MA 3VL9A 2ZGKA 3ZKYA 3LKJA 4CEYB 2HYXA 1GBGA 3AXDA 1CAXB 1QF3A 2DV9A 3R4DB 5BY5A 5JWPA 4ZHNA 1AHSA 5JZGA 4R4XA 3TBDA 3VZJA 1S0GA 2EALA 1RUI2 5AVPA 3ZPOA 3WATA 4XFBA 2H0BA 1NCQC 1CAUB 2DBIA 4JHTA 4IE4A 1RUOA 2ZOEB 5FP3A 1OD5A 1PMHX 2I45A 4YGCA 4CCJA 4QPIC 3WMZA 2DTYA 2YY1A 2ATFA 4YZ1A 3IIIA 5KHIA 4IEPA 4XF1A 1U5IA 3RS6A 5EPAA 4HSLA 1JH5A 3LPFA 5FWEA 1FAYA 2XOMA 1GZWA 1EPWA 3KCYA 1FOD2 5EZWA 1I1EA 1MEC1 5EFUA 4PIXA 1VAVA 5FZ8A 4DOUA 3CIHA 5LBCA 3OD4A 2HWF2 4RR3B 4XURA 4URTA 2OVUA 1OOPA 1YLLA 3PLQA 4AQ6A 4ZKTB 1KJLA 3NJYA 4B4RA 1W6PB 1K5MC 2DVFA 4H14A 1J3RA 2NMNA 4XXAA 4YZ4A 1E57A 1O4YA 1QNWA 2EF6A 1QEXA 4CCLA 1DLLA 1PVC1 3T30A 1OBNA 4ZS3A 3AKRA 3POGA 5A7NA 3WF4A 4XF3A 1OVSA 1K5JA 1AL21 1LNSA 3HBKA 4N43A 5C3PA 1WD4A 1NZIA 5LA0A 2VZOA 2BGCA 2ZAHA 4WM7B 3VZLA 4N4BA 1BJQA 1ENQA 1ZRIA 1NLQA 1RXGA 3QEFA 2Z5WA 3Q8EA 1POV0 1HN0A 1HXS2 2HWE1 2IXKA 5T5LA 3TN91 4CCMA 3T0DA 2B45X 3N4MA 2FDGA 4CUCA 3P6BA 2LUWA 2GN7A 3GHMA 2WS92 1ZBE3 1B35B 4A7KA 2P17A 2X09A 1GP5A 1D4M1 1X82A 3AL6A 4WM8A 1HKDA 5F3GA 1K42A 1JMUB 1V6MA 5F32A 2BPA2 5GLRA 4HLTA 5AVAA 3LZZA 4IL7A 4P14A 4UBHA 4HVQA 1KS5A 1QU0A 2IC1A 2W46A 4XC9A 3UYJA 3E5QA 5A7PA 3BIWE 2OXBA 2W1QA 4Q27A 1AYM3 2ZGTA 2HWF3 2ZGNA 3BU7A 1UNBA 1MS4A 1OA4A 1JUHA 2PLV3 2JG9C 4I3PA 3AZVA 4RFT0 5LA9A 3SMHA 4BIFA 1R64A 1NZCA 2RMU2 3VDBA 5CA6A 2AR6A 1QXRA 2XUMA 1M06G 2Z42A 4O8NA 2ET7A 5FPXA 3HN3A 1WLTA 3AP4A 5F5CA 3AKGA 5A7WB 4Q4W1 3S5AA 5FUIA 5LA1A 1GV9A 1QXJA 1RHI2 2WUHA 4RL7A 2XBO3 1Q8VA 3FX3A 3JUUA 4I30A 1KQRA 2X5IA 3D3AA 3S0MA 4CDWB 1APNA 2QKDA 2OS2A 4FFIA 4PCRA 1VBB3 3ZYJB 4AFBA 2Q1MA 1QMJA 5EJ3A 1NLSA 4HT1T 4CXYA 4CZSA 4XXPA 3AVSA 5LA2A 3WQ0A 2EXJA 4FPEA 3O0XA 5I93A 4YGEA 1LGBA 1UX6A 1AR92 2VZRA 1AVBA 1DGWX 3BN6A 3OGSA 5KR7A 3CU9A 1RIRA 3VGIA 1UY3A 4JKLA 4XAEA 5K0UA 2CTVA 2CWMA 4JHZA 4OCTA 3VZKA 2EXHA 1JZ7A 1PGL1 3C8XA 5BNPB 3I2JA 3PHMA 4XZPA 3WDWA 3HQRA 4QPGA 2PHUA 1QDOA 5D2AA 3C7OA 3POSA 4TN7A 3RI9A 4CU7A 3NKGA 2D6OX 2ZMNA 1W6OB 3ETQA 2KD7A 2RS11 4LBQA 2QQPA 2PHLA 1N3QA 5HPOA 1ZZ7A 3JQWA 5D21A 5J7MA 4XEZA 2YPDA 4AFCA 4AHWA 2IXHA 4K1ZA 3H1WA 1ACCA 3DCQA 4LKSA 3ZSLA 5LBEA 3N9QA 2BDRA 4N53A 1W8OA 4D0QA 2W1WA 3HIFA 1IPKA 2ZXQA 3GALA 4XJ9A 3MF6A 1EUTA 2QTWB 3EB7A 4C0HA 4BXSV 5KXBA 3VSSA 1W99A 2ORXA 1SEFA 3DPRB 1TMF1 1MS3A 2GP5A 2HKXA 4A42A 4BDVB 4BU2A 4CUAA 4DFSA 4F83A 1YO8A 2P6CA 4JGYA 1QDCA 2WSUA 1UOGA 1MQTB 1F31A 2A6VA 4QHOA 5F1RA 3J26N 3LEGA 2V4VA 1DQ2A 4EV0A 2R073 4HONA 1NQJA 1FPN1 1CAVA 1PIV3 2F4PA 4XJUA 4E2GA 4NPLA 2JDPA 2VQTA 2WIIB 5EHDA 2ADEA 3WP5A 5AFEA 1IKPA 2E7AA 2MNGA 3AYAA 4FPCA 1HRI1 5JIUA 4AHXA 4YW6A 4N2ZA 4IEQA 2GSYA 2JXAA 4K3UA 3KF5A 5DABA 1S0JA 4MXWB 1OVPA 1UMHA 5F5AA 3VBFB 1QNYA 2DU1A 2XVGA 5DUUA 5HI0A 4Q4X3 1OF4A 1VBA2 5A70A 1SZBA 4HG6B 4LKFA 5DQ0A 1R092 3GCWA 1TL2A 2RV9A 5K8SA 4KMIA 5FDBA 3A22A 3OBTA 2KA3A 1QJU1 2VCBA 5CKMA 5C8CA 1W0NA 4FAHA 4A7YA 5IVEA 3RZHA 2AENA 4HVRA 1W9TA 1WBFA 1DQ6A 3N9MA 4CDUA 2AC1A 5FMDA 2DCTA 3D5YA 2CWSA 2VO5A 3RWKX 2RS32 5BNOB 2Y60A 4LBMA 4RR3C 5HCHA 5JAXA 3GZAA 4OHYA 4UDGA 3CDZB 4S2HA 4XETA 2IXCA 3ZFEB 3SKVA 4ZZ8A 1C28A 1KITA 5LCWL 3WVJA 3BB6A 5FWJA 1DDLA 2LROA 1OH3A 3H8UA 2OUHA 1BMV1 3CJXA 1IG3A 3KQRA 3DF0A 1AL0G 4JKKA 3KF3A 2WZR3 2AH2A 2DF7A 4WM7C 2GNTA 1OF3A 3M2MA 3QCWA 4UOJA 4QX1A 3E6BA 3IT8A 5BYNA 5EXOA 2P34A 5GLTA 2J1UA 4OI1A 3GGLA 3JBG2 2RS53 4AQTA 1F9KA 1B35C 3IIAA 3QBQA 4MGKE 2Y6HA 5DZEA 3IM0A 1MS8A 1DQ0A 4RN5A 1WA6X 2Y6KA 5JMOA 1QJX2 1CX1A 1K12A 1LCLA 3P3NA 3WP6A 1O7FA 1RMU2 4YLZA 1UY0A 4JGZA 3V65A 4Q26A 1XU1A 2NQYA 4BCUA 1UQXA 1JYVA 2VQAA 4XW3A 4RS5B 3VBUA 3VBHB 4GIQA 4C8DA 2Y6JA 3BALA 2FDKA 1T6BX 3VZOA 3MW2A 4Z8BA 1LHVA 4QHBA 4MGTA 3UJQA 4BISA 2XJVA 2VZVA 4CTEA 1LHNA 3RMXA 5FTTC 1YEWA 2XJTA 3LEMA 5KXEA 4Y1YA 2DUPA 4IW3A 2OT7A 3VKOA 2RDNA 3DXTA 2NM1A 5DDJ3 2GP3A 4HKOA 1YFWA 3CO2A 2Q8CA 3WZ1A 1BCXA 2E33A 4E2SA 3MHZA 5FFOC 4AVBA 3MUY1 4GAZA 4QKBA 2WT1A 4S2DA 1BK1A 1EAH1 2ZABA 2RG4A 4BPZA 3DGTA 5APAA 1W6MB 2WNUB 3POFA 2IWGB 2Y26A 3AKTA 3PNAA 4LEJA 1Y9MA 3L2HA 2XH6A 4W6WA 3W5MA 3WDYA 4WVMA 1F5JA 5AC93 3ENRA 3WXPA 1BZWA 4OYUA 4ZXKA 1H8TA 1N3OA 2W68A 3CEWA 5L7OA 2A3WA 4ONUA 1NOVA 4K20A 1J3PA 3ZVXA 5FMBA 1ND3C 3WDUA 2QE3A 4GQ7A 1L3JA 5FZAA 3GZUC 1PGW2 4ITCA 5FYYA 5FZMA 1ASJ3 5BNPC 5JPNB 1JYIA 3KV4A 1PX4A 2P2KA 3ECQA 4J1XA 4S2GA 4BB3A 3OM7A 1GANA 2DFBA 4Q4Y1 3T1MA 1IGOA 4XBNA 4I3GA 5EJ1B 1BBT1 1B09A 2HWD1 5GLOA 3BIEA 4CDQC 1U5ZA 1KD7A 1TZOA 1QJY3 3NNJA 5L9BA 3JB8A 4A41A 2XVKA 3O12A 2FQPA 1VAKA 4O65A 4QQ2A 4QU2A 3GJAA 1JHJA 3POIA 3VZNA 3VBRA 2P3YA 2QDRA 3IMNA 3NVCA 5ABJC 5J09A 4KC7A 1DZRA 2Y0OA 4XBQA 3KT1A 4D94A 5FZ1A 1FV2A 1W9SA 3PU8A 2OQ6A 1ODMA 3OB8A 4I0AA 3OEAA 4RHV1 4BQ4A 2Y34A 4CP1A 1RUH3 2VMEA 2GDFA 5IK7A 4KG8A 3EXUA 1WCDJ 1UPSA 1DP0A 1WW5A 3DPRC 3INAA 2Y6LA 3MFAA 4P5YA 4QB6A 1J59A 4EWAA 4MUVA 2FMDA 4P9IA 2DU0A 4DEQA 3AMPA 4KH9A 2D6NA 3ZOIA 2C9AA 2QQJA 3VBOA 2J1RA 3AM2A 4BK5A 1H2KA 1RJ8A 3WPZA 4FQ4A 1HRV1 1F5FA 3TEWA 4NROA 2O8QA 2GU9A 2JX9A 4U36A 4M01A 2E26A 4HZFA 2DFCA 1LU1A 1HW5A 1XE8A 1C8M2 3N3HA 3VBFC 3TEYA 1AR72 4H55A 1Y3TA 1C4RA 3SKJE 1DZTA 3WF0A 1JODA 3SEEA 4YW3A 5EJZB 5A7VA 4GJZA 4OHZA 1CPNA 4FFFA 4B7EA 3ZM8A 1PT2A 5IWFA 1PO11 3NAPB 3RWNA 1GWLA 2YUEA 3DECA 5I8TA 4XUNA 3RFRA 4KI5M 5J36A 2WQZC 1ULFA 2BNMA 2NN8A 4LTAA 4QXHA 1AZDA 1IQDC 4XQDA 5FZOA 5BNOC 3AC0A 4JX0A 1RC6A 2A6WA 3BOPA 3DN7A 5CNAA 4AI1A 5D8AA 2OPKA 1C3HA 3SXWA 5KHGA 3ZFEC 4AEKA 2D3RA 4XAAA 5A33B 5CKNA 2DYCA 3GJBA 3ES1A 3QEDA 1NAEA 2ARBA 2G9GA 3AP7A 3NNFA 1O4ZA 1DZQA 1R1A1 3WCRA 3R05A 3H50A 1RUE2 3MYXA 5LY1A 1F2NA 1UY2A 4NR1A 3LV4A 1AYN3 2ZMLA 4IUGA 3ZMNA 3LAGA 4COZA 2RR11 2VCCA 3FLRA 2VTXA 2PHXA 5E16A 5FPLA 2BZDA 2C9KA 2CGPA 4XFHA 1UIJA 2VY0A 5L9RA 2FHRA 3JCIA 1I3HA 2YGLA 1JU4A 4QPWA 1MS0A 4XCBA 4TSVA 1H1AA 2R061 4NMIA 1IKQA 3VBSA 3E5UA 3M3QA 3NO8A 2R0HA 2J1AA 1ZZ6A 4NHMA 4UF0B 3S5QA 3URFA 1RUJ3 2C24A 5JDBA 5JMCA 3TAWA 4RS5C 3VBHC 4NN0A 1U0AA 4HKLA 1UY4A 5GZDA 4YVSA 1CVNA 3WX5A 3ZXJA 3O14A 5IK4A 4J25A 2K9ZA 3OGVA 4LPLA 3VDCA 5T5OA 4AHYA 3TB0A 1Z7S1 1W3VA 3TNQA 1WWYA 5IVCA 3ZYPA 4U2AA 2D3SA 2IZWA 2WWJA 1CIWA 4FVVA 4OZOA 5SV5A 2AEYA 4LIVA 5IVFA 2FDIA 1S55A 2YG0A 3NL1A 5LEJA 1SBFA 1PM4A 2W95A 4BLIA 5GLMA 4QXCA 2R041 5JOYA 4XVHA 2WNUC 4AVSA 3AKPA 1PO21 4Z2WA 2XMLA 2F4LA 2Y64A 4LKDA 3LWCA 1VBC1 3KS7A 5EP9A 3WHTA 5AY9A 1P8JA 5CAZA 1G9BA 2ERFA 4NWVA 1TME3 2HJIA 4GJYA 4BQYA 5FLJA 1POV3 1W9WA 3OGGA 1Y43B 3T2QA 1ZBA3 2WFF1 4YVWA 1RUF2 2VGDA 1ND2B 2QVSB 1DHKB 3UJOA 3RZGA 2YXSA 2ARXA 2ZEYA 3H8RA 3MV01 5C3OA 3RMYA 1TVGA 2CDOA 1COV1 4MV2A 1NQDA 2GZWA 4XF0A 4XHBA 2E6VA 3U37A 4AAPA 1US3A 1NT0A 2JDUA 4OI0A 4HMZA 1VBD3 2ZX3A 5A3LA 1SFPA 3I7DA 4FPYA 3FHQA 4CRQA 3WQBA 1V00A 5FZBA 5DUXA 3HN1A 1K3IA 1KFXL 5JXGA 5LBBA 4LA3A 4DXZA 1G8WA 2WNEA 2CAUA 4IEUA 1EUUA 3VUOA 5DZGA 2GH2A 1V6OA 1HQWA 5JIAA 4HVOA 3ZXGA 4AI8A 4DO0A 2VUDA 1JZ5A 1RUG2 5CZKA 1RL3A 1EV13 3B5LB 4E4ZA 3OM5A 3Q8FA 3E6CC 5JSOA 4EN6B 4O61A 1PZ9A 5FOJB 4C91A 2VVEA 4TXWA 1VLNA 2HWB1 3GYDA 4KWJA 4YGDA 1W8WA 3MIBA 5FZEA 1UU4A 5CB7A 3VL8A 5BNQA 3H7YA 3HJRA 5CVRA 1PVC2 1XXNA 1R081 3K75B 4Q4V1 5GLVA 3VHRA 2E32A 2BU9A 3I2GA 3D60A 1QQP2 1G6NA 1Y4WA 3FHIB 1V9U2 1YQ5A 1U5XA 3H1YA 4QGNA 3ZFGA 4A7ZA 4YM3A 3MV11 3LQCA 3O5SA 3AJYA 4MO3M 4UWDA 4XMIA 3F2ZA 3VD9A 1JOJA 4GXLA 5FQ0B 1UO9A 3CL1A 3IKWA 1X36A 4J1WA 2WYFA 3MFCA 3A0NA 3BTAA 5FZCA 1HB2A 2NMOA 5FLWA 3D61A 1N47A 1UD1A 4LE4A 2A7AA 3ASIA 3L2YA 3KV6A 4N1IA 1JYCA 1SLLA 2YC2A 3B93A 3DYPA 3J8F1 2YFRA 3MPBA 1GQGA 1UKRA 2QQIA 3U11A 3SEPA 3N7JA 4YZ5A 1MEC3 3CZUA 2WFPA 3NAPC 5LRRA 3RQ0A 5C33A 2ET1A 2OIIA 3GF6A 5F39A 1LAJA 2SLIA 2W5FA 3M4FA 1O59A 2JG8A 3CHXA 2OUJA 4LO5B 1OPMA 1JN2P 3DEMA 4B4PA 2VZQA 1H0BA 5LATA 3PMSA 4IEWA 3ETPA 5JZGB 4GWJA 5IVJA 1HB4A 3DKWA 3IDEA 3VD5A 1ZRFA 3AP5A 1PVC3 3BYWA 1HJGA 2UYBA 5FYBA 2BBAA 2BYVE 3OPTA 3O1VA 1AL23 4XUOA 1YJKA 2LS6A 3NV1A 1W6NA 2JG9B 5FYIA 2BJSA 2VMDA 3WG3A 1YXWA 2XPJA 2Y6GA 5FXXA 2HWE3 1WMFA 4NVPA 4FXKB 1T6GC 2KR2A 3IWZA 1GZWB 4XJAA 3TN93 3WF3A 4BOWA 1J84A 4HOOA 1BYHA 1D7PM 1DFQA 2A3YA 2VW2A 4GH4A 5A7QA 3RZZA 1UXXX 3GBGA 5B6TA 5IUQA 1D4M3 2W87A 3S6PA 3T2PA 2ZZQA 1UKGA 2JD4A 3D6EA 2VZTA 1RUD2 1SLAA 4XABA 1AR61 3WNMA 1JZ8A 1OFSA 3S57A 2VXJA 1ZM1A 1ZRRA 1JUIA 4B7KA 2XQXA 2X29A 4NE9A 4RGAA 2VZPA 5FO8B 1QWRA 2ZGPA 1BQPA 2Q5TA 3HT1A 4NO4A 3NNGA 2VQ0A 4N43B 1S0DA 3B02A 2WA3A 2JICA 3PTRB 1XYPA 2VZ1A 4RQPA 3PUIA 5FXWA 2DCKA 3AMQA 2CY6A 2WNOA 1V70A 1GU3A 4GB31 2AGSA 2BEOA 3B9CA 1LGNA 1QJZA 4XTPA 5CG9A 4FOYA 2YB7A 4JAAA 5T5PA 4AVTA 1PK6B 4DUVA 3WV6A 4UDKA 4EN9B 3WNPA 3T2TA 4Q4W3 5F2SA 4Y1ZA 4TYSA 4GMP1 3PL0A 2A70A 2W91A 3OY8A 1ZVFA 3PTYA 4MHRA 1C5HA 5A32A 5IK5A 3VT1A 4PDWA 3ME2A 4M4RA 1D0GA 3ZX7A 5L19A 1EY2A 1STMA 4D8MA 1OA3A 5A3UA 1TMF2 1UZWA 4AQSA 2YFUA 4AEMA 1O3RA 1L7LA 5A7SA 1NCRA 1VIWB 2R49A 3UKVA 3ZN5A 2HYKA 5BPXA 4D6SA 4E2QA 5FY7A 4Y1XA 2RDQA 4C1XA 2JDMA 3JU9A 4P02B 3B69A 4XUTA 4ARXA 3HEIA 3V0BB 1WCSA 4LK6A 3IPVA 1JZ3A 1ND2C 3AZZA 3I3BA 1BVP1 4KG0A 4GA9A 2Q4SA 4C1WA 4AI2A 2X5IB 4NOTA 2RS13 5LBFA 1QIQA 5A8CA 2XUEA 2GH8A 2VULA 3CLPA 3TOJA 5C0PA 2L9LA 4OVEA 3OTFA 3Q8AA 2PHRA 3X29B 3RZLA 4BIOA 4Q1PA 1YJLA 5JXHA 4HBNA 3WG1A 2HEVF 1VR3A 1LOFC 3J7NA 2UY8A 2WRAA 5FBZA 2G1MA 4GULA 3VDDA 3AJZA 1SQ4A 1ZBE2 2RVAA 5ACA1 1AR81 4CP9B 5K0UB 1H6YA 4ONZA 1QOTA 3OBAA 4UFIA 4CVUA 5BNNA 2ZGSA 2ZKLA 1X33A 2DUQA 3FJSA 2XHKA 1DYPA 4I09A 3Q8BA 4FQZA 1TMF3 2ZEXA 4QPGB 4AVAA 5A3TA 2WNVC 4CCCA 3AKSA 4HK8A 3W20A 3RDIA 2O14A 4LBQB 2C0ZA 4A6SA 3MW3A 1FPN3 2JJ6A 2BBVA 4LBNA 4P9WA 1AYM2 1ENXA 1S0BA 3A21A 3WW2A 4CEWA 1KS4A 2PLV2 1XNAA 3GNEA 4SLIA 2WDBA 1CR7A 1HRI3 2QZ2A 4AE2A 4F7ZA 4KCBA 1V0AA 2RHPA 4FCAA 4H2AA 3SCHA 3WUCA 2R7EB 1QXPA 1ZRCA 4UYBA 4OMDA 3BTXA 4CDXA 4FTBA 2VUAA 4AI9A 1VBE1 3LA2A 1PGSA 5FREA 2XBO2 1LEDA 4G9SB 4PBOA 4QKFA 1YFUA 5JSRA 4GZ9A 4A44A 5DUWA 4UW3A 1RYYA 3L9JT 4JGYB 1QJU3 3TEXA 4DQAA 3PVBB 1VBB2 2XKOA 3FZ3A 4QB2A 3D5ZA 2Q1ZB 4PLNA 1POQA 2XJSA 2QQNA 2VVFA 1OLME 4JTNA 5GLLA 1W8TA 4BHPA 1JXNA 1C1LA 4HN1A 3LDRA 4AK5A 5E89A 4COVA 1NYWA 4L92A 2NZ9A 4XUQA 5FUNA 3BTYA 1OKOA 2WWUA 5FYSA 4Q5OA 5CFDA 4D69A 4UDIA 1RGSA 5IFPA 2ZS6B 1V6JA 3C3VA 1RUC1 4V1PA 1OFNA 3PVNA 3WQ1A 5JZGC 1XNTA 1O3TA 4Y4RA 4QDQA 1REEA 4LHLA 1XOYA 2VU9A 2XGXA 4GWMA 2ZGMA 5FY4A 4P9JA 5GLKA 1UZYA 3AMMA 5A1LA 3JXSA 1A34A 4Y4YA 1DGRN 1D0HA 2DDUA 1H2NA 5C8CB 2VAUA 1TNFA 4D3WA 4UI9L 5T54A 5C6CA 3MLKA 5AFBA 3N9LA 2BW8A 4CDUB 2QCSB 3LSEA 2VW1A 1SMVA 3JB4C 3GBWA 1Y9GA 1OOPC 2EAKA 5DXDA 4QWNA 2HWC1 2ZGRA 2VZ3A 1GZTA 2JIGA 5C8WA 1YNAA 2Y6FA 4IV1A 3P5BA 1UYPA 1CAWA 1VMHA 4AK6A 4ISRA 4Q2FA 2E7QA 1US2A 4FOQA 3WNNA 4NRQA 4NAMA 4XFFA 2D5HA 5FZ9A 4RD7A 2JB4A 3F95A 3MIHA 3D0SA 4N43C 2BGOA 3LE0A 3UGFA 3USSA 4KWUA 1M4WA 1MR5A 3IDCB 5CKQA 1N3PA 1AX1A 5FY5A 4LITA 2K0GA 3LIGA 5F3EA 4BH9A 2R072 2MEV1 3LSDA 1NUKA 2IXLA 4SBVA 4Y24A 2TEPA 2HLEA 2PAKA 1FMD1 1PIV2 3GZEA 2XJUA 2VCAA 1GWKA 1SDWA 4IDZA 1UMZA 4P00B 1ND3B 5T50A 3GBFA 4M3CB 4YZ2A 2PHTA 1PK6C 3AFKA 4XYXA 3ACLA 2VXRA 3FUOA 1YI9A 3N7MA 4LHSA 3CJIA 3ZR5A 3KSCA 4UAPA 2YV8A 4AXOA 4KCAA 4BK4A 2W0XA 4WM8C 3TRSB 4UDJA 3VT0A 1RVF1 4KMQA 3HBZA 2QQVA 3I2IA 2VOTA 1H1MA 3K46A 4Q4X2 4JGZB 1BKZA 1VJ2A 4GWNA 1EAH3 1HLCA 3C7EA 2WL1A 3WLUA 4CEYA 4CDQB 3ZIXA 4K6BA 1BXHA 4FAGA 5GZGA 5J1XA 2PQSA 5B2GB 5F6LB 3QC2A 3EJKA 5CBLA 2WLQA 2IVIB 4QM9A 5JOWA 4BLJA 1X7NA 4NAOA 1WCQA 1SLIA 5E6HA 3OPZA 5ABJB 2ZBJA 4NIDA 3AL5A 5FLHA 1JHNA 4D7TA 1LULA 2QQMA 1MVQA 2EIDA 3ELNA 2G19A 4QKNA 4Z2AA 1O8PA 3WPUA 4ATFA 1NE6A 1QJEA 1W2AX 3K4AA 4X8PA 1ZRDA 5I8YA 3K1UA 2VOWA 3T1LA 1NA1A 2OPWA 5IATA 2Z69A 2WAAA 3WR0A 5KHJA 1JU3A 3SH3A 4Q4Y3 1HQNA 1XSQA 2BNNA 4Q0UA 2PHFA 2X5IC 5I8SA 3WD5A 1BBT3 4LBLA 1OH4A 3SH5A 2HWD3 3DUIA 4Q8KA 3AB0A 4QT6A 2RM21 2WZR2 3H3UA 1SACA 1GYDB 2ZEZA 3POWA 3RZMA 4IV3A 1HQLA 1OLQA 2YBSA 5FMCA 2AACA 2H0VA 2J1VA 1XPWA 4WVMB 2Q1FA 2VD7A 1UU6A 2A73B 1H8TB 3I54A 3K48A 1LOAA 3WP3A 2ZHKA 5L7OB 4DUXA 2XLFA 2YBKA 2RS52 5K0UC 4QQPA 4RHV3 3NRUA 5LY2A 4KGQA 3IN9A 5FZGA 1V6LA 3RYPA 3PDQA 5C70A 4HETA 1BEV1
chains in the Genus database with same CATH topology
1OKQA 2B5HA 4QPGC 4GKXA 3V56A 4AFDA 1OSGA 1G9CA 2EAAA 1N1YA 3KT4A 1NXMA 1WMDA 4IQPA 4X6QB 1CQ9A 3D5OA 1OQ1A 1HRV3 1YYNA 1Q56A 1DQ1A 3ZYRA 3ROUA 1MZEA 5LRSA 4N53C 2VMGA 4KC8A 2CL2A 3VBRB 3WN1A 5J37A 3WW4A 1QOOA 5H9PA 4U6DA 5DDJ2 4F3JA 4IEXA 2LM3A 3VZMA 3W9AA 4L8QA 3VHOA 4E27A 2X8KA 4E9KA 4EJRA 3FLPA 2D6MA 4JGYC 1PO13 1RUI1 3QLQA 4PVIA 4Q29A 3VBOB 1QH7A 4K1YA 4C90A 4OHXA 3UGGA 3UGHA 5AC92 2GNMA 4CDWA 3PVEA 4R9AA 3N7KA 1FOD1 3AZYA 2A5ZA 2R16A 1I6XA 1ST8A 4QGMA 1MS9A 1SFYA 3VT2A 1S0CA 1ASJ2 1VB4A 5L36A 1R1A3 1O3SA 1WA4A 2D40A 5A7VB 1ENSA 3V0AA 2LALA 3SLIA 4ATEA 3D82A 2VH9A 1GR3A 2RR13 5C8CC 5HCAA 2ZGUA 1QJY2 2XVLA 4CDUC 1JTZX 1NY72 3H3ZA 4JDNA 4JDMA 3ZO0B 4D7SA 1DQ4A 2ZJCA 5CG8A 1OHFA 3WW3A 1HXS1 1LOBA 5D8AB 4UW6A 3HWJA 2R063 3KT7A 2WS91 2D6KA 1XNCA 1RUH2 2B42B 2ZGQA 4Y1UA 5K9YA 4E4SA 2WJSA 4PJYA 4JRLA 5FCCA 3QZ4A 1W0OA 3TNPB 4XOGA 1CX4A 2R32A 4G4FA 1Z0HA 4L11A 3R4ZA 2BFUS 3FFQA 4PLMA 1Z7S3 4YRDA 3ZYIB 5A33A 2H6CA 1MQTA 1WUVA 3QOPA 3OYWA 5KHHA 1C1FA 1Z78A 2RMU1 3H9AA 3N7LA 4AG4A 1YFYA 1LECA 4XJ8A 3B7MA 1YFXA 4M3CF 3VBSB 3OM2A 2WWSA 4IEVA 4JGZC 1SCSA 3JQXA 4HPKB 2R043 4OLLA 5D1IA 1XYNA 1RHI1 4Q4V2 1RTVA 1PO23 3ST7A 3VBUC 4JCKA 1W6QA 2K2SA 4MXWA 1VBC3 2DVAA 4YVSB 1WW7A 5H9RA 4DY3A 5GZEA 3QH7A 2WFF3 4P9GA 1CGPA 4RSUA 4FPHA 1LESA 4INDA 1NLRA 1S2BA 1COV3 1KJRA 3AZWA 1AR91 1WGPA 5BXXA 5EYXA 3ZYGA 2PFWA 3M3CA 2XLAA 1TNRA 4A3XA 2E51A 4OI4A 4KQ7A 4WV8A 1ZX5A 4XIKA 2XWBB 2WKKA 1YCIA 1AYN2 4Q0SA 4XF9A 4K9SA 3P2NA 4NHKA 2GC1A 1H8TC 2RJKA 1SFNA 5L7OC 3BPZA 4IERA 1GYKA 5C4WA 3C7HA 3NW4A 2HWB3 3KGZA 1IQAA 1YWKA 3BYNA 1R083 4Q4V3 1C8NA 4K8FA 4W6XA 1VAMA 1LB2A 1RUJ2 5H9SA 1H4GA 2PQQA 4UXAA 4LO6B 3M8LA 1TE1B 2CV6A 3LOBA 1ONAA 2EVXA 1WD3A 3WN2A 2QUOA 1W2UA 3VBRC 4OI2A 3NV3A 2RJLA 3N35A 4FP2A 4TZDA 3LDKA 2Z79A 1IOAA 3VKFC 1ZZ9A 2JDZA 3J8F3 4LO8A 2ZMKA 2Y0IA 4M0NA 4AEJA 3VKLA 2D6PA 3D8CA 3ZFGB 1VBA1 1R091 3VBOC 3D4KA 4OUSA 1AX2A 5E88A 3MIEA 1TME2 2ZX1A 3ZXAC 3FWEA 3I59A 1ZBA2 1S0EA 2YFTA 3KM5A 5J96B 1UCXA 3DV8A 2O8OA 4KL1A 2VOVA 1MS5A 2RS31 3TWIA 3LOIA 2BWCA 2P3KA 1UV4A 3I8TA 1I5ZA 2VUJA 3WNXA 5KXDA 2YYOA 4DRVA 3WW1A 1VBD2 4OZXA 2ZX2A 3B94A 3LF7A 3IDBB 4BMEA 3KZ4C 2XJRA 5A3MA 3EQEA 4MLGA 1AXYA 2JG8B 2NPIA 2FZ2A 1AR63 1PZ7A 1NXD1 2VOXA 4DMIA 3AKFA 1EV12 2VPVA 4LBOA 5D8AC 3ZSJA 5CADA 2I2SA 4YW4A 1TQ5A 3JBG1 2YPJA 5HCBA 1D2QA 1QHDA 1ALYA 1CD3G 2D44A 2PAMA 3KLSA 3A4UA 4PQ9A 4Y1VA 1W6NB 1QJX1 1NE4A 2A6XA 2RE9A 2UWAA 4GB33 1V6NA 1RMU1 4QGLA 5T5JA 1A3KA 3O7OA 1IS5A 2ZGLA 1FATA 4GH4B 1ZZ8A 2BVBA 4D7YA 4O9GA 4XIOA 3AX4A 4BYYA 2PTMA 1SBDA 4UW5A 4GMP3 4XMAA 5DUVA 2UY9A 1ZNPA 2Y38A 5JPMB 5GLQA 1UZZA 4D47A 1Y7BA 5GLWA 5GKAC 2NLRA 3AYCA 3VBSC 4LR4A 3JD73 2G9FA 2DTWA 4COUA 4FSJA 1CN1A 5EWSA 1GYHA 5CFCA 5JI7A 1DGLA 1MEC2 4YVSC 3TAYA 4COWA 4N9IA 2D5FA 1Q3EA 4YFZA 4P9LA 1SLCA 1H9PA 2IXIA 4EROA 1LHOA 4CP0A 5T52A 2WNVB 4AEDA 3OY8B 1AJKA 2OZJA 1PVXA 4WVVA 5A32B 4L99A 5A8DA 1FYUA 1AL22 4PDWB 3WDTA 4HFSA 4AVCA 1PGW1 1DQ5A 3NWKA 2HWE2 2ZACA 2VDTA 3TN92 3MW4A 3VKMA 1QH6A 3RPQA 1NCRB 5GZFA 5ACA3 3MEPA 4W65A 1D4VB 1AR83 3U07A 5IT6A 2DVDA 1D4M2 4HN0A 4Q0VA 4YVWC 1UIKA 3EBRA 3IPVB 5FKCA 3LCPA 4NPRA 2BTVC 1YI7A 1UL9A 3AXEA 5FKBA 1FT9A 3AKIA 1GZ9A 3N36A 5C9AA 5FMOS 1LKNA 4WZFA 4E4DX 4LHKA 1CPMA 5DG1A 4PVAA 5DG2A 4Q0QA 5B6SA 2ZZJA 1S1AA 4KU8A 4PLOA 2UYAA 1LODA 3ZFFA 4EQVA 2Q8OA 4R4ZA 4XHXA 5JI9A 5CU1A 4MGYE 4Q4W2 2VNOA 3PVOA 5BNNB 1VBE3 2C1FA 3ZDSA 4Z1VA 3MDPA 3USUA 4EN7B 1LRHA 3OBRA 4IESA 2WSVA 2PA7A 3ZMOA 1C8M1 1SBEA 4QQHA 4DINB 1AR71 1RITA 5GLZA 3ZFGC 5J3UA 2X8TA 4CEWB 1OOPB 2YGMA 5FOBB 2ZTNA 3K51A 4COYA 3VSRA 4R9BA 2X53S 1RUC3 3CF6E 5KXCA 1PGL2 4CDXB 2XJQA 4QX5A 1H30A 1JBCA 4NHLA 4BA6A 1SCRA 1OLRA 1MVEA 2AUYA 3MICA 3MLJA 3DL3A 4FFHA 5L73A 4Y22A 2RS12 1FV3A 1AF9A 4Z82A 2E9QA 4AF9A 3MF9A 5J48A 2QQUA 2GALA 4KWLA 4FT8A 4JV4A 4HK9A 3CU7A 2E7TA 2N7GA 2JG8C 4WM8B 1RUE1 1GSLA 2HWC3 2XL9A 2Z2SB 4RGGA 3UL2A 5CFDB 1FNZA 4O9EA 2TNFA 1Q8SA 3FFZA 2C5DA 3RNSA 1GLHA 3JD71 3S7IA 1NCQA 3E97A 4Q8LA 4AYUA 2MEV3 2QNKA 3OM6A 3LIHA 1FPN2 4IEZA 4QPIA 4PBPA 1FMD3 1WL7A 3MZHA 3RSJA 1H1IA 4GH4C 3ZXKA 5HBAA 1HRI2 5I91A 3MIDA 4MGIE 4JDOA 4Y5Z0 1RVF3 3I4IA 3KCXA 1IPJA 2YMZA 4L2NA 3WASA 3SCFA 4IV1B 3R4SA 1CAWB 4ES8A 5I0UA 1K5MA 5DZFA 3AK0A 5FQ0A 1FI2A 3OM4A 3RYKA 2QJVA 3J9SA 3ZN6A 1BEV2 4XQWA 1QJU2 1DBNA 4RQPC 4DPNA 1J3QA 4M3CE 3RRDA 1XQNA 1UW8A 2CYFA 2ZHNA 3D0JA 2X8FA 5GZCA 1MZ5A 2OA2A 1O5UA 2TUNA 4WVZA 1W18A 2A6ZA 5SV8A 4BE3A 4UW4A 1O91A 2SBAA 1LR5A 1U5YA 2HEYF 4AWDA 1BMV2 4PDWC 1RUF1 2DURA 2RM23 2D7FA 4FP3A 4LO7A 2E53A 3U4XA 1XU2A 4N53B 4BQ1A 3RJ2X 4AHZA 5JCTA 4WVWA 1GFF2 1NCRC 3C7GA 3ES4A 1GICA 2DCJA 4LT5A 2JG9A 1KDMA 1LJ7A 4J6GA 1NA1B 1BEV3 1QY4A 4PF5A 4I02A 1R1ZA 1EYBA 1VRH1 1RUG1 5KWRA 2B8MA 1DF0A 2B4WA 1CAVB 3UK9A 3H1MA 4B8EA 3QH6A 4GMP0 4IV3B 4R9CA 4H3WA 4KBBA 4TWTA 1WBLA 3BCWA 3WG2A 4Z07A 1QQP1 4QXKA 4BWOA 1V9U1 2VMIA 3VDDC 4AGRA 5K7PA 4AFAA 3LA7A 3C2UA 3NV4A 2PN5A 3NSTA 5BNNC 4I0BA 1A8MA 3O0WA 3SITA 5T55A 4FOVA 1OYGA 1WCKA 1PK6A 1RUI3 4H7MA 4AW7A 3SCGA 1EAH2 3U14A 4ASMB 1BVVA 2B9UA 3LGRA 4META 4MSVA 2VOKA 5FO9B 5CIRA 4FXGB 5FAXA 4FPFA 4CEWC 4YG0A 3ZXLA 4DRRA 4YM2A 1FOD3 1GQHA 4LLFA 2IXJA 2B39A 2QFEA 4X6RB 4CDXC 2EXKA 1ULDA 2FZ1A 4ORFA 4Q4Y2 1RB8G 4AI3A 3ILRA 2H6BA 1UN1A 3V0BA 1BBT2 3HMYA 3Q9OA 3WY6A 5FK7A 1SLBA 2HWD2 2QQWA 3LA3A 4EN8B 2ZX0A 4ZU4A 1VP6A 4YW2A 1I9RA 5BUVA 2DUOA 2GC0A 1XRUA 5HCFA 1O5LA 4HKWA 1HXS3 3M3OA 4ISQA 3VV1A 1QGLA 4QQSA 5CFDC 3LB9A 1PNFA 2WS93 3R4UA 2ADDA 4RHV2 1CAXA 2Q30A 3MLLA 2V73A 1GYEB 3VBUB 4LE3A 1RUD1 4O8PA 2NYYA 3V0AB 4DY5A 1DYKA 3VHPA 1CAUA 1S2KA 2A75A 4QMAA 4KGGA 2BVVA 4MH0E 1W2TA 2YHJA 1JW6A 4U6BA 2ZGOA 1GNHA 4Y26A 1KFUL 5J98B 3BYKA 2CNAA 1HRV2 4ASLA 1HIXA 1DGRA 2W52A 3MPPG 3WDXA 3B00A 4OFGA 3WAUA 4AFMA 3BYJA 2RMU3 1REDA 3PIJA 5BV6A 3VSFA 5KHKA 4RR3A 4IV1C 1IZ3A 4IEYA 1W6PA 3R0RA 4NOVA 1A6CA 2OW4A 2ZAAA 2BNOA 4P9YA 3AMHA 3ZXFA 1RHI3