2AEYA

Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with 2,5 dideoxy-2,5-immino-d-mannitol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
537
structure length
537
Chain Sequence
b'QIEQPYRTGYHFQPPSNWMNDPNGPMLYQGVYHFFYQYNPYAATFGDVIIWGHAVSYDLVNWIHLDPAIYPTQEADSKSCWSGSATILPGNIPAMLYTGSDSKSRQVQDLAWPKNLSDPFLREWVKHPKNPLITPPEGVKDDCFRDPSTAWLGPDGVWRIVVGGDRDNNGMAFLYQSTDFVNWKRYDQPLSSADATGTWECPDFYPVPLNSTNGLDTSVYGGSVRHVMKAGFEGHDWYTIGTYSPDRENFLPQNGLSLTGSTLDLRYDYGQFYASKSFFDDAKNRRVLWAWVPETDSQADDIEKGWAGLQSFPRALWIDRNGKQLIQWPVEEIEELRQNQVNLQNKNLKPGSVLEIHGIAASQADVTISFKLEGLKEAEVLDTTLVDPQALCNERGASSRGALGPFGLLAMASKDLKEQSAIFFRVFQNQLGRYSVLMCSDLSRSTVRSNIDTTSYGAFVDIDPRSEEISLRNLIDHSIIESFGAGGKTCITSRIYPKFVNNEEAHLFVFNNGTQNVKISEMSAWSMKNAKFVVDQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords fructan 1-exohydrolase IIa
molecule tags Hydrolase
source organism Cichorium intybus
publication title Insights into the fine architecture of the active site of chicory fructan 1-exohydrolase: 1-kestose as substrate vs sucrose as inhibitor.
pubmed doi rcsb
total genus 128
structure length 537
sequence length 537
ec nomenclature ec 3.2.1.153: Fructan beta-(2,1)-fructosidase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 2aeyA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2aeyA01
3QC2A 4QQSA 3S5QA 3TAWA 4UDKA 3ZXJA 5GLQA 3WN2A 4FFIA 2AC1A 3AKFA 4CCDA 3OM5A 4N2ZA 5JOWA 1WL7A 3U1XA 2X8SA 2X8FA 3K1UA 4KMIA 1VKDA 1W2TA 3KF5A 5AY9A 3NQHA 4AK7A 3WPYA 2XQRA 3LF7A 5FMBA 4U6BA 5C0PA 3C7EA 5JOYA 3LDRA 2QQUA 4UFMA 3CU9A 3VT2A 3LIGA 5GLNA 3D60A 3PIJA 4O8OA 3OM7A 3WN0A 4N1IA 4UDKE 4AZZA 2B4WA 1UYPA 4UDIA 3C7GA 4FFFA 4KCBA 4PVAA 4COTA 3WASA 2EXIA 5A7VA 3C2UA 1Y9GA 2AEZA 2OXBA 4KC7A 4UDGA 5GLRA 3WPZA 3D5ZA 3QZ4A 3KF3A 4NOVA 3ZXKA 2QQVA 3C7OA 4CCEA 3UGGA 5B6SA 4D47A 3LFIA 3P2NA 1YRZA 1Y7BA 2X8TA 1PT2A 3UGHA 3ZR5A 1GYDB 3AKGA 4JQTA 2EXJA 4KC8A 3ZR6A 3QEEA 4MLGA 5FMDA 2YFTA 3VSRA 4FFHA 5GLPA 3D5YA 3ZXLA 4B1LA 5A7VB 2YFSA 1YI7A 3OM6A 2ADDA 1Y4WA 3LIHA 3QEFA 3WAUA 3D61A 5AYEA 5A8DA 3HBKA 2YFRA 4AK6A 3RWKX 3KSTA 1UV4A 3SC7X 5FMCA 5FIXA 4UFIA 4UFKA 3BYJA 1YIFA 3R4YA 4O8PA 5GLMA 4UFLA 3VSFA 3UGFA 5JOXA 3OM2A 3VSSA 3BYKA 3WMYA 1Y9MA 5AYDA 3AKHA 3VSZA 5FKCA 2VDTA 3R67A 5GLKA 2ADEA 5GLOA 4UFHA 4O8NA 3WPUA 3U75A 3LEMA 3AKIA 4UDJA 3H3LA 3LV4A 1GYEB 2EXHA 2QQWA 3C7HA 3LDKA 3R4ZA 4KCAA 5FK7A 1GYHA 4EQVA 3OSDA 4B1MA 3PIGA 3VT0A 4HXCA 3BYNA 4UFJA 3BYLA 5GLLA 3WPVA 3C7FA 1W18A 5B6TA 5FK8A 4U6DA 2EXKA 3WATA 3IMMA 3WMZA 5A8CA 4PVIA 5FKBA 5AYCA 5FLWA 1ST8A 3OM4A 2AEYA 3NMBA 4FFGA 3QEDA 4CCCA 4AK5A 5JOZA 3WN1A 4N4BA 4ONZA 5ANNA 3U14A 4N2RA 4QHZA 1OYGA 3VT1A
chains in the Genus database with same CATH superfamily
3TAYA 3LPFA 3WINE 5GZDA 3POBA 4NHKA 1ZRDA 1AR81 1MQTC 2B42B 4QGLA 2UWBA 1ONAA 4TLFA 5CKQA 5CA6A 4S2HA 4YW1A 1O91A 1X8MA 4WV8A 5HV4A 4Y5SA 2BU9A 1F5JA 5LA2A 1XYNA 1UU4A 1V9U1 2VCMA 4RHV1 1OH3A 1WL7A 4LLOA 3SEPA 1JYTA 5LASA 4K7JA 4TWTA 5AC92 1F4HA 4YGBA 1VMJA 5JVVA 3MI8A 2BNMA 4HANA 1MS3A 4M4RA 4CDUA 1LOCA 1ZZBA 3BODA 2ZPXA 2YV8A 3VHRA 1GZTA 1Q3EA 4YM1A 2OPWA 4L0PA 2HKXA 5BY5A 3EQEA 4COYA 2LUWA 1HRV3 5DUVA 1W8ZA 2E63A 2QKDA 2ZGKA 4IEVA 1DZTA 5F6KA 1DGWX 3K46A 3RVHA 3WP4A 4Y1YA 4D0QA 2B4WA 5JR7B 4YSFA 3LCPA 1J84A 5A1AA 3MIBA 4HN1A 1RVF1 2UWCA 3NJVA 3VHPA 3VD9A 4HT1T 3MHZA 5KHHA 4XXAA 3RJRA 4CCNA 3V0AB 4RS5B 1RUH2 5CVRA 1F35A 2BW8A 4NR1A 1UU5A 3V64A 4AI3A 5FZMA 2DYCA 4NMIA 3JBG1 2ZHLA 3RDIA 1X36A 1KGYA 3MBWA 1UWWA 4JDNA 4D69A 3I4IA 4XJZA 3A4UA 2YGLA 4LHKA 4LBOA 3MZHA 3THCA 3POGA 1DDLA 4XIOA 5CZKA 4Q29A 2WWUA 4FFHA 1VLNA 4FXKB 2BDRA 2MNGA 4X6QB 5FZIA 5GLPA 4YVSC 3AKQA 1AYN2 4L2NA 4IE7A 3B01A 5E16A 1MZEA 1ZZ9A 1EYBA 5JIUA 1GNHA 4LKFA 3ZSEA 3CJXA 5FYTA 3J7NA 2QZ3A 2W08A 1G6NA 2R042 2K2SA 4MXWA 5A6ZA 1NCRC 2GDFA 3NV2A 1BQPA 2BEOA 1CAVB 2IFWA 4QB1A 3R4YA 3H8UA 4XTMA 3HR9A 1JS9A 2V73A 1POV1 4LIVA 5G04L 2JE9A 4PJYA 4AEDC 5GLOA 3MF6A 2RMU3 4FQZA 2NMOA 2VQAA 2Z42A 3WY6A 1PM7A 1RIRA 1US2A 2WQ4A 3X29B 1EAH2 3ZN5A 3JUUA 4Y22A 3FC0A 1C1LA 4BMBA 2JE8A 2V72A 3UJOA 1S0IA 1S2EA 3T0AA 1GYHA 3BVCA 3D0JA 3NO8A 3V56A 2C6SA 4X8PA 1HW5A 5DAPA 1IKQA 2A7AA 1BBT2 1NE4A 5C9AA 2BERA 1YJKA 1W2UA 4Q1PA 5FK8A 1ULEA 2FD8A 3M3QA 4IE0A 5A8CA 4PVIA 1FV2A 3MICA 1O3QA 1RXFA 2FDJA 3KCXA 2RS13 1JOBA 1V6MA 1RUJ3 1ODNA 3O1SA 4F3JA 1SBEA 5FZ9A 2GC1A 2WSVA 5IW0A 2W91A 3QLQA 2IUWA 4AQSA 3D5YA 2Z2SB 4YW2A 4C91A 2RS11 5IUQA 1RB8G 5F2WA 3U37A 1X9PA 5D2AA 1DGRA 1QJY2 2XJSA 4NIGA 1QOTA 1WZXA 3MIEA 2W87A 4YZ4A 4YVSA 1PK6B 4AQ2A 5C8CB 2A71A 2E31A 4ES9A 1JOJA 4AHXA 3VHNA 3NWKA 4P9YA 1SDDB 2VBDA 5FCCA 2PQSA 3LF7A 1I5PA 5FMBA 4A6SA 1APNA 4IQPA 1S0JA 4XACA 5F6LB 1QJU3 2QQNA 1OA3A 4HK9A 4Q8LA 1OQ1A 1UKGA 4Q4Y3 3GCXA 1UZ0A 1M4WA 1HJGA 4PI2A 3WQ0A 3PIJA 5F3GA 2GH8A 1HQWA 1ODMA 3OCPA 5KXEA 2WABA 1B35B 4QX2A 5T5PA 3T2TA 1RGSA 1W9FA 2ORZA 2Z69A 3ILNA 3UL2A 3F95A 1CZVA 4AI9A 3WASA 1BKZA 5BNNC 1IPKA 1ENSA 1AXZA 2XWJB 2H0BA 4CTEA 1LJ7A 4IESA 5DUUA 4FI9A 1WMDA 2C4XA 2OXBA 1DZRA 1JODA 1WUVA 3H50A 4AI8A 5A70A 4KC7A 1WA4A 2VMFA 1FMD2 2Y60A 4LA3A 4NIIA 5FZ8A 4LO4B 4YPJA 5T3NA 4QPIB 3K77A 5FJHA 1NLRA 4DXSA 2WT2A 1GMMA 1LODA 3ZFEA 3K2OA 2ETEA 1V00A 1FT9A 1W8FA 5DXDA 3VZMA 5LEKA 4KC8A 2EA7A 3ZFGA 1A78A 1W6OB 4C90A 5BNPB 3N36A 1YYNA 2ATFA 3CNAA 3IIAA 2IXLA 4XFGA 4Y4YA 1BMV2 4WM7B 3OD0A 2KR2A 2ZABA 2WT0A 4LHNA 4M3CA 2WWJA 5FYHA 4J1WA 5A3PA 3FHAA 1DYPA 1ZBE1 5I93A 4IEXA 1S0BA 1U5XA 4EN6B 4QB6A 4YNIA 5EIYB 2VZOA 4KBBA 4K1ZA 5FMCA 3U11A 2QQIA 4Z8BA 1DLLA 1FNYA 1VBB1 4UW4A 4QQ2A 1JYCA 3I97A 5FY0A 2E7QA 3SH4A 4LLFA 1I3HA 4C0HA 5KXBA 3WMYA 1MEC2 3TN91 4NHLA 4GH4A 4KI5M 3GM8A 4KNCA 4S2GA 2R0FA 1SPPB 3APBA 1FPN3 1LU1A 1CR7A 4UDJA 4KU8A 2XPJA 4AVBA 4ZPIA 4A6OA 4QDQA 3A23A 3NNMA 5GZCA 3WUCA 5E89A 1C8M1 3H8OA 1CQ9A 2WO3A 2P34A 1FOD2 1K12A 4HXCA 4EWDA 2GP5A 3LSDA 2VUCA 3IKWA 3CJIC 4RQPA 2QQMA 5DZGA 2NQYA 4D7YA 5CAZA 4DQAA 1KS5A 1QJZA 4GWJA 5HI0A 1WKYA 5HPOA 1W9TA 4MUVA 4JTOA 5AC93 3W5NA 4Y3OA 2A6VA 1R1A2 5FPLA 2WQ8A 1DQ2A 1QF3A 4ZONA 3S6PA 5C3PA 1UZYA 3ZFFA 2C0ZA 2XLFA 3AZZA 4J6GA 4Z2WA 2OKXA 2VXRA 4FQ4A 1RUG3 1RUI1 4S2FA 2IVIB 4YFZA 4B4PA 4R9BA 4GMP1 3UKVA 4QPYA 1VAMA 3AZXA 4JZRA 3SCFA 3DXUA 5FZAA 4YWAA 5F3CA 1TG7A 1K3IA 4PQQA 1PGSA 1LTEA 1QXPA 2UY8A 4LBLA 4DY3A 2IXJA 5CG8A 2JICA 1D7PM 4N53B 3C7EA 4KGGA 5EFUA 3LDRA 2CGPA 1LOFC 2BGOA 3I2HA 3CU7A 3ZYJB 3TEZA 1F5FA 2Y6HA 2GN3A 4IEPA 3WHTA 5J37A 4LO5B 2BWCA 3ZYGA 1H2LA 1VAKA 4LKSA 4UW6A 3AC0A 1KXGA 4QWNA 1DQ1A 1BK1A 4DIQA 1URXA 3ZYIB 2ZX2A 3WCRA 2Q8OA 3BIWE 4LTAA 4Q4Y1 1S55A 1SZBA 4AHYA 1LGBA 4UF0B 4QX7A 4YZ3A 4ORFA 5A7OA 3G7DA 4PBOA 4EWEA 1TQ5A 3P3PA 5A1LA 5B4NA 3U07A 1RUH1 5C4WC 3BI3A 4JGZA 3CL1A 3IB3A 3OGSA 3RI9A 3ZSLA 4P9GA 5JI7A 1ULCA 2YBPA 1LOAA 4HKOA 1QIQA 1AR82 3Q8CA 4BJ0A 2OYZA 1PNFA 3UETA 3CJIA 3VBUA 1ASJ1 4AEJA 3LFIA 2WNUA 3TEXA 4D6RA 2OVUA 1W8WA 1WW5A 3A0KA 1B35A 2NZ9A 4DB5A 1HQNA 2C9AA 3VDCA 5FMDA 3LKJA 1K42A 3KD4A 1LHNA 4K9SA 3O0WA 1GQPA 2VOKA 2YFUA 3BPSA 3Q8AA 4I0BA 1EAH3 3LA2A 1W06A 1YI7A 1ASJ3 2QNKA 2VNVA 2GU9A 1G86A 4YGDA 3WAUA 2JDNA 2ZHMA 1DCSA 2ZGRA 5KHJA 4HZFA 4NAOA 4B4RA 2BGCA 3M4FA 1UY3A 2PMWB 1RL3A 3MW3A 3POEA 5FIXA 2JDYA 4TZDA 3N7LA 4H7MA 1UAIA 3OOXA 5GLWA 5T50A 1BMV1 3VSFA 2CYFA 2DF7A 1VRH2 3SITA 1O4YA 2W9XA 2WZR1 4HFSA 4COVA 1DF0A 3J8F2 1H1AA 3CHXA 4K40A 1ZM1A 1LOEA 5DUWA 3Q9OA 5F7UA 4B7EA 1EV12 4KWUA 3U75A 4NRQA 3AKIA 1KD7A 3H3LA 1AL22 4PIZA 1W8OA 2XLAA 1O5UA 2E7AA 3CBNA 3OBRA 3OY8A 4PLMA 3OYWB 4QPGB 1RUG2 5C8WA 3JU9A 5IVVA 5K0UC 4KCAA 1ZZ7A 2A6ZA 3GZEA 3FFQA 2D6NA 4AK3A 4CRQA 2Y0OA 2ZTNA 3LQCA 1AYM3 1PX3A 1TEIA 2YXSA 3I2FA 4YFWA 1WGPA 3T08A 3WDWA 4AOCA 1N3OA 1KITA 3AP5A 2CGOA 3PJQA 1RUF1 1WCSA 4A7KA 2D93A 5EYXA 5I91A 1RUOA 2K46A 2PHLA 4CSWA 1I5ZA 4LBQA 1WA6X 2Y64A 1QQP1 2Z5WA 4XHXA 4LHSA 3T4HB 1JOPA 5CB7A 4JKLA 5A6YA 1OVPA 1XXNA 2VZQA 5HCBA 3GF6A 4Q4V1 3DF0A 4CCCA 4MXVA 2LTNA 2DCYA 3VBSA 4UXAA 4ASMB 4E2QA 2V09A 5FZOB 4CDWA 5A6XA 4GWNA 2RS12 2WKKA 4BQ5A 5AC91 4C0BA 2ZA9A 4XJ8A 4AFBA 5GLQA 4UWDA 1AR63 3ZDSA 5L73A 1UIJA 4CP0A 3KV9A 5EJ1B 3KLSA 2J1EA 3NJYA 1OLRA 2EAAA 3K1UA 4MXWB 3SISA 4W6YA 3WD5A 1AR93 4WVMA 2O8QA 1IS3A 1DGLA 2P1BA 3LEKA 3SHRA 4KH9A 5C6CA 1LECA 1LU2A 4OHZA 3DKWA 4WM8B 4BLIA 2WJSA 1VAVA 3LPGA 4YLZA 1YFUA 2JJ6A 3O14A 1RJ8A 5FPXA 2ZZQA 4XURA 2VM9A 1YQ2A 4PBPA 4RGGA 2SLIA 1UYPA 2K9ZA 1J58A 1IQDC 1YQ6A 4HOOA 4EYUA 2DFBA 4PVAA 1F15A 2GH2A 4J1XA 3AB0A 2RMU1 3B9CA 1DIWA 2R6QA 2ET7A 5FY4A 4ASLA 3RWNA 4BA6A 1EV13 3CIHA 1UY2A 5A3OA 3VKLA 4XTPA 4A2UA 1WBLA 2VCBA 3KGLA 4GWIA 3K4DA 2EICA 5IVFA 4Q4Y2 1BEV1 3JD72 2OS2A 4YARA 1Y7BA 4Q4X1 4YVWC 4XILA 3FBYA 1KJRA 4CEWA 2B46X 2G4IA 1XNCA 1UX6A 3GYDA 4HONA 2VE1A 5FBZA 3KS7A 2CSGA 2E51A 1R1A3 3NNFA 3V65A 2ILMA 1D4M1 4UF0A 2VCCA 4NIDA 4IEUA 3VDDC 1RHI3 4GKYA 3C8XA 4RR3A 2KD7A 2W3JA 3ETPA 5A7QA 5IWFA 2OUHA 1UU6A 3RZZA 3W59A 2B9VA 1SCRA 4O61A 1YQ8A 2D7FA 2VAUA 4EE2A 1PIV2 3M2MA 2R0HA 3BYJA 2FCTA 3WF0A 2HLEA 1FOD3 4XMAA 2BYVE 1RUI2 1OH4A 1MS1A 1OLMA 4D7TA 3VSZA 4YM2A 1QQP3 3LEGA 2JDUA 3MYXA 1VB4A 2FMDA 4XFHA 2H0VA 3SCHA 3BPZA 2QQPA 2YBKA 3LEMA 1RXGA 4DRRA 2BWAA 1LR5A 1QOSA 2RM23 4I01A 3DL3A 4O9EA 2JWPA 2K0GA 5F5CA 3ZM8A 5FK7A 3Q8EA 1AJKA 3FUQA 4JKKA 2VZTA 1PZ8A 1OI6A 4L97A 3NAPC 5GLUA 1H30A 5F8PA 3ACHA 5BNNA 2MPFA 4YW4A 5EJ3A 4E27A 3S7EA 1ZYBA 4AG4A 1AL21 2YC2A 4I3PA 4CCOA 1UXXX 2QQJA 2HWF2 3B9IA 2D6MA 3NJZA 3R4DB 4YW5A 1GNZA 4GB33 1ZRFA 5T5OA 1HB4A 3SEEA 4ZU4A 3AKPA 3I3DA 3DPRA 4RHV3 5FMOS 4ONZA 2J42A 4PF1A 4EZHA 2IXHA 2GSYA 2VZRA 3NVCA 4HLTA 1AR83 3N9LA 4OUMA 2P3IA 2WNEA 4BQ2A 3O1TA 3QC2A 1MEC1 4IE4A 4NO4A 4Z1VA 1JYNA 3O0XA 3SH3A 3WN2A 1JXNA 1RUJ1 4W6XA 4SLIA 1WCQA 4UAPA 3PUIA 1KQRA 2A6XA 3ASIA 3N35A 4H14A 4XZUG 1UOGA 5K8SA 2XGXA 4OHVA 2Q30A 5FYMA 4R4ZA 4M0HA 2QJVA 2RM22 1D2QA 3NNGA 1JW6A 4AGVA 4R52A 3ORJA 5EQUA 2D5HA 3VT2A 4GB31 1O4ZA 4BLJA 3TNPB 3D60A 1L3JA 1QGLA 3AKRA 5JI9A 4W4ZA 3GNEA 3UJQA 4Q4W2 3H3UA 3IDAA 2MEV1 2WS91 3I2JA 1AVBA 2WNUB 1NA1B 5CIRA 5K4LA 2RG4A 4LO6B 3VZJA 4CU7A 2UWAA 4M3CB 4X6RB 5CKMA 1NA1C 3EBRA 3ZMOA 2I07B 4L92A 3WDTA 1OOPA 3HIFA 1FATA 4NRPA 1IQAA 1F2NA 1VBA1 2FHRA 4IGOA 3H8RA 2EAKA 4G9SB 2X53S 4HETA 3ZXKA 3FLPA 2W68A 4LBQD 3O1VA 3FWEA 4CDXC 1GQHA 4BQ3A 1S2KA 4YZ2A 2WNVB 4NWVA 1Z0HA 3VBSC 5CKNA 2Q4SA 2C9KA 3O1OA 2VW2A 4ZS3A 2Y38A 1PT2A 3UGHA 2O0OA 1W8UA 3AZWA 1W2NA 2WZ8A 4JHTA 5C70A 5F3IA 4YG0A 5L7OC 3FN9A 5FPUA 3HQRA 2GN7A 3E6BA 2D43A 5L7OB 1HV0A 2Y6GA 1AR72 4TXWA 1MR5A 5DZEA 1YO8A 3ZN4A 1OQDA 1UF2C 5A33B 1R092 4S2DA 4PDWC 3TN92 3O1PA 1REEA 3ZYPA 5A8DA 2YZ4A 3GJBA 3HBKA 3KV4A 4CXWA 4PQ9A 3KT7A 4XFAA 1RTVA 1VBC1 4FPJA 1RUD1 1K45A 5LRSA 3AZYA 3USUB 1VR3A 5JOXA 1CONA 3J7MA 4V2WA 5GZGA 3AKHA 2VVFA 2WAOA 1Q8VA 2VY0A 1JBCA 3RYPA 4TYSA 3W58A 5FYZA 5C5TA 1YCIA 1X8EA 2R16A 4P9WA 3NKTA 4M0NA 5DAXA 4CDUB 1EV11 1PK6A 5GKAC 5BNPC 5DDJ2 4W50A 4JKMA 1UZWA 3I3BA 1IS4A 2DTYA 4A3ZA 1YFWA 4FPYA 4P5HA 4RN5A 3OPWA 5DG2A 1LOGA 3PIGA 4XMIA 1W3VA 5FPVA 3N3HA 4LEJA 3C7FA 1LHUA 1DGWA 2AACA 3WATA 3SLIA 3K4ZA 5G05L 4H3WA 2BNNA 3I59B 3DEMA 3TBDA 4RFT0 1VBE2 4FOWA 1QJU2 1R082 4LBMA 3AFGA 1OT5A 3TN93 4FFGA 3H0OA 3IPVB 2PYTA 1MPXA 1N1VA 3R05A 1TMF3 1HXS1 3ZXFA 3TEWA 3PVBB 1N3QA 3VDDB 3NQHA 2XL7A 4NE9A 2ZGOA 3LWCA 2RDQA 4NRMA 3PDQA 1W6MB 5FY9A 1G7YA 4FFIA 2WFPA 4MGIE 5A3UA 5A7PA 1JU4A 3K4AA 4QPIA 1O6UA 2ET1A 3CEWA 1VBD3 4F7ZA 5LY1A 3WOGA 4N2ZA 2OW4A 1HQLA 2G9FA 3AMNA 3H7YA 3K75B 4QHOA 5A32B 4A42A 1GZCA 3J9SA 2WZEA 3CJIB 3GZAA 4Q0UA 4JQRA 3GJAA 4HVQA 1V6NA 1NCRA 3WUDA 4DPNA 2JX9A 2QQUA 1VMFA 3PUSA 4CPBD 3QBQA 5E1RA 1REDA 3T4VA 4NOTA 3BGAA 1IS6A 5EXOA 1CX1A 4Q0PA 5C3RA 4D7SA 4QDRA 3D3AA 2JDMA 1BBT3 3EYPA 3RI8A 3IBMA 4AEDA 2XMLA 4L9BA 1W9SA 4LE3A 4AZZA 4UDIA 3CO2A 1N47A 1JU3A 2AUYA 3PU8A 4QGMA 1AX2A 1Z7S3 3VDAA 2DBIA 1ND3C 1VBD2 1QMJA 2CGNA 1TL2A 4MLOA 2D44A 2FDIA 3AX4A 4W65A 5D1IA 4KWLA 3WVJA 2VZ3A 3L2YA 4P5YA 1UCXA 1UL9A 3BU7A 5C3OA 3MF9A 4NUBA 2QDRA 1ZA4A 3GZTB 1RMU1 1CAXA 4CCEA 2UY9A 4BE3A 4N53C 4IW3A 2HEYF 2J1TA 5A3WA 4BXFA 2J1UA 2JB4A 5APAA 2WO2A 4YW7A 4Y4RA 3GDBA 2MHFA 1TNRA 1WMFA 1S1AA 2VH9A 4ET7A 4L8QA 5F5AA 4IEOA 1QNWA 4FSJA 4QPGA 4ISRA 4BZ4A 1N1TA 2OQ7A 3B5LB 4MVTA 5FMOL 3DYPA 1GV9A 3O1RA 4C1WA 3LIHA 2WZR2 3BOPA 4LK7A 5AYEA 3HBZA 4CVUA 3H1MA 5C4WB 1RUD3 2DVAA 2ZEXA 4JGYB 1NYWA 2E6VA 1BCXA 4YYOA 4AQ6A 1FMD3 2GALA 2ARCA 4UFIA 3T0BA 3KZ4C 2BOIA 2WYSA 3A21A 5C2MA 2JKBA 3CQOA 4AE2A 5IJRA 3VKMA 2W1QA 4OHXA 3BKZA 4QT6A 2J1RA 5J48A 2VBBA 1J3PA 4P00B 1C28A 1DYOA 1PX4A 3AMMA 4N43B 2PHDA 4E2GA 2FDGA 1L7LA 3T0DA 4GMP0 2WYFA 2XJVA 5DQ0A 1WBFA 2IWGB 1RYYA 3MPBA 3N7KA 1QQP2 3R4UA 1PVC1 4N7UA 4XDOA 5BNOA 4XUPA 2WRAA 3ZKYA 4HSLA 3WNPA 4PDWB 5CFDC 4EN0A 3WXPA 1UXZA 4BQ1A 1PO13 2TNFA 1ZREA 2WL1A 3CKHA 3ZXGA 3HMYA 5L9BA 1YC61 5ABJB 1H2KA 3USUA 3WMZA 2HWD1 2MEV2 2WS92 4D6SA 3SCGA 1O4TA 4OYUA 1EPZA 1GWMA 4XFBA 3PTRB 1POV3 2F4PA 3B7MA 2LM3A 2GNTA 2R1BA 3MIFA 3LOIA 2B4KA 4Z92B 1HRI1 4EZ4A 4IE6A 3GGLA 2B9UA 2BFUS 2XJQA 1GNYA 1W6QB 5I0UA 4XZPA 2H6CA 5DMYA 5GJ6A 2HEVF 3ZXJA 4AR2A 3ACGA 1D0HA 3VZNA 1NOVA 2TUNA 4URTA 1WLCA 2PTMA 2AC1A 3SXWA 5A80A 2VOWA 1VRBA 2YU1A 2ZZJA 1PNGA 2VNOA 1BVVA 1RUJ2 2W39A 4MYEA 2FZ1A 2WIIB 4Y1ZA 5A7NA 3MPPG 3OUJA 3VBFA 2VOVA 3J8F3 1H6YA 2WFF3 4UOJA 2E7TA 5BNOB 1DYKA 1D4M3 1FMD1 2XOMA 2WDBA 4E8DA 5FZ3A 2HWB3 4OQ9A 1JHNA 1JZ5A 4LA2A 1Q8QA 1ULFA 4OZXA 3O1UA 5FR3A 4ASKA 3MLLA 3LAGA 1R64A 3WW1A 1UY4A 3VKNA 3BU0A 3SQOA 1PO23 4KQ7A 4O8OA 3PVNA 5KXCA 3OM7A 5LWBA 1NZCA 5I8SA 4M3CE 4Y1XA 4AEMA 2WO7A 3FL7A 1AHSA 4EV0A 1C1FA 3HNYM 5FP7A 2I45A 2A1XA 2QDNA 4AVCA 5EZWA 3WNXA 3VKFC 3FMGA 1C8M3 4ZS2A 2XXZA 4M3CF 4XAEA 1OD5A 2PA7A 1T6GC 5T54A 2HWC3 2GP3A 3H3ZA 5DUXA 1DG6A 2W92A 1I9RA 4OFGA 3RMXA 5LA9A 3VBHA 4MGYE 5LBFA 3D5ZA 1IPJA 3ZPOA 4NAMA 1XNDA 2VL4A 4IGPA 4XF1A 2VXJA 5FUIA 5FYSA 1W0NA 4Y20B 3UGGA 5B2GB 1IOAA 2VQUA 5DDJ1 1MS9A 1JYWA 2Y6FA 2DBNA 4AHZA 1OA4A 1NLSA 3ATGA 2WZPP 2KXLA 4MH0E 4XF0A 2WFF2 2HYXA 3LSEA 2J1VA 2JG9C 4TLGA 5LATA 1ENRA 1WWYA 1ALYA 1CAWA 3I3QA 1K5MA 2YFSA 3ROUA 4ZY9A 3U4SA 2EIGA 3MV01 3H1WA 4BMEA 2ARXA 2ZAHA 3DYOA 4LBQB 2ZCWA 2Z4FA 3I7DA 1YI9A 2F6BA 1AXYA 2YC0A 3LEIA 3M3CA 4AVVA 4DINB 5FAXA 5A3TA 3HNMA 5ACA2 4KMQA 3HAGA 2R7EB 3GHMA 1VE0A 2DFCA 5FV3A 1AYM2 1LHWA 1Q5OA 3RZJA 1XOYA 1D4VB 4XUNA 2YPJA 2Q1ZB 2AZ5A 3R67A 2VNGA 2ZGQA 4QXBA 1H2NA 1LOFA 5FYYA 1RUC3 2JENA 1R1A1 1UMZA 1CAUB 1ND2B 1QH7A 1GU3A 2D6LX 2VZSA 4V1PA 5A33A 5IVYA 4FOVA 5IFTA 5J36A 5ISLA 3DN7A 1ND3A 4HPKA 4PCRA 4WM7A 4BQ4A 3TEYA 3OY8B 2DURA 4UW3A 2YBSA 4JV4A 4PIXA 4BDVB 5FY8A 4XABA 1D0GA 5DAQA 4P9XA 1CPNA 3CZJA 4PLOA 2PHRA 2J1SA 4K21A 5GLLA 4OUSA 5ACA3 1U5ZA 5DPNA 3UKTA 3MLJA 3BTXA 1RJ7A 5FPBA 2VVEA 3ZFEC 4RS5C 5E88A 2D6OX 1G9DA 1GWKA 5FLWA 2VPVA 2PLV2 1LENA 2NN8A 1CPMA 5L36A 1LAJA 2BQPA 1C5IA 1QJU1 1XU1A 3VBUC 3Q8BA 5JOZA 1XB9A 3WN1A 1JTZX 2R063 3HQXA 3T2OA 4C1XA 4IDZA 5FWEA 1RUD2 1VBE3 4E2SA 3AJZA 4XXPA 4PT6A 4QX8A 3VD5A 1SFNA 1W9YA 3LFMA 1GBGA 3WDXA 2JG9A 2LALA 4IEWA 1RINA 4E4SA 4EROA 1COV3 1H8TA 2P3KA 3BB6A 1ND3B 4HPKB 5IK4A 3BALA 5F32A 3INAA 3ZSJA 5KC6A 2X8SA 4MX3A 1QWRA 5AY9A 1W2TA 3VBRB 1EAH1 1FI2A 1MEC3 3AYDA 3KHBA 2Q1MA 3GHNA 2VJXA 5GLTA 4ARYA 2CY6A 3MV11 1F9KA 4ITCA 4XBNA 5FZHA 1R1ZA 3VZLA 4A44A 1RUE2 3S57A 4CUGA 1V6LA 3UK9A 1G9CA 4QM8A 2P2KA 3LGRA 5AVAA 4E8CA 5JXIA 1EUTA 3B94A 3E5UA 3D6EA 4I3GA 3RZLA 1ND2C 4PF5A 1F8VA 4CCJA 4AAPA 1SLTA 3AKTA 5JXGA 1MS0A 1PK6C 1YEWA 5FXWA 1RITA 4ZU5A 5A7VA 3ZSMA 3C2UA 4FPHA 4LK6A 2DU0A 1R093 1U0AA 4FOYA 1Y3TA 4FVVA 2QQVA 1RMU2 2Y0IA 2W0XA 2HWD3 4AEKA 1QJY1 4QU2A 1OOPB 4AVTA 5C9AC 5B6SA 3DPRC 1AYM1 5F5IA 3PJYA 1UMIA 1H8VA 2BV4A 2W1WA 1SBFA 3VBRA 1O59A 3RZGA 1V6KA 5JMCA 2EXJA 3WNOA 3GBGA 1DQ4A 4P9IA 4QU1A 1US3A 4NJ4A 5LZ6A 2JD9A 1BHGA 2XVLA 4B8EA 2JKXA 4QKNA 4A7YA 1ASJ2 2IZWA 5GZFA 2H6BA 3E1F1 3WW4A 1WCKA 3ITQA 4ZXKA 3RPQA 3WF2A 4DEQA 1S0FA 3VBOA 3JCIA 3OUHA 2ZMKA 2XL9A 2ZX0A 2VNRA 4FP2A 4HL0A 1NXD1 4MGSA 4QQHA 2X10A 3AXEA 1GOHA 1YIFA 3AL5A 3MIGA 2XH6A 3UGFA 3OM2A 2E53A 3USSA 4QX1A 1GP5A 1H4HA 2JDZA 4DUXA 3U0ZA 2XKPA 4XUOA 2YG0A 4OCTA 2XBO2 5IVCA 3JB8A 3CDZB 3KMHA 1FPN2 3F2ZA 1K5MB 1OQEA 4YM0A 1CZSA 1K5JA 1GYEB 3C7HA 3ZVXA 5CNAA 1IZ3A 1VBE1 2D3SA 2G9GA 3I8TA 2RHPA 2HJIA 2G9ZA 2XVGA 1UYXA 4RFRB 3VD3A 4A3XA 1HIXA 5B6TA 2NYYA 2YMZA 3LA7A 4GAZA 4XUQA 1VBC2 4FXGB 4XFCA 4Q0SA 2P6CA 4XHBA 4XJWA 4XIKA 3KVBA 2NMNA 3V0BB 4XF4A 2JDKA 3CZUA 1CAUA 1G9AA 1XJAA 1JH5A 5EWSA 1TE1B 1SACA 2QFEA 3EJKA 3J7HA 3ZFGB 1K5MC 1W6OA 2CDPA 4H55A 5C71A 4IEYA 5CFCC 4QHZA 3KSCA 3WX5A 1QKQA 2VZVA 4PDWA 1AR91 1W04A 3WZ1A 3ZFGC 3S5QA 3ZIXA 3AVRA 3TAWA 3VLBB 5IATA 1KDMA 1LCLA 4NPMA 3VHOA 3ES1A 4BH9A 1RUC1 1XYOA 4Q4V2 1EP0A 1T6BX 3NNLA 5FP4A 5FYUA 3OM5A 2RDSA 4XE9A 3VDDA 1GOFA 3ABZA 1RUE3 3WV6A 4AQTA 4CDQA 2E9QA 5C0PA 4EN9B 2XONA 4RR3B 1KRIA 1VIWB 3NRUA 3I3EA 2BJSA 4HBNA 5FRAA 2CWSA 1C57A 4GMP3 1WMEA 4Q4X2 5FDBA 5JWPA 5GLNA 3OGVA 1NY72 2R043 2UU8A 5BNPA 2DUPA 2YROA 5FZDA 3N7JA 4XF9A 5TSWA 3OPTA 2ERFA 2B45X 3ES4A 3D0SA 2JG9B 2XUEA 1GP4A 1W8TA 3MFCA 2ZGLA 3P5BA 4YM3A 1RUF3 1ZRIA 2FQPA 4FPOB 3K48A 5K7PA 4XDQA 4CCKA 2XQXA 3O5SA 1RUE1 2XB6C 1E5HA 2ZHNA 1L7RA 4BOWA 3N9NA 1Q8OA 4RS5A 3NSTA 4NOVA 3ACIA 3C7OA 1POV0 1W99A 3GXUA 4FBFA 1NAEA 1OPMA 5FZGA 1AF9A 2JDAA 4I2OA 1HDKA 4GH4B 1JUHA 3IN9A 4LITA 4DXZA 2X8TA 4WVVA 2NPIA 1QJY3 1CVNA 3MO4A 5FXVA 2CWMA 3O0VA 5FO8B 5J3UA 1V6IA 1IKPA 4I09A 3ZR6A 4YVSB 4JAAA 2RJLA 2XG3A 4MLGA 1FPN1 1MACA 2TEPA 4U36A 1A6CA 2DTWA 2RDNA 3E6CC 1V6OA 3U78A 5CFCA 1QJFA 1QXRA 2HH9A 2ZHKA 4Q5OA 2Y8KA 1LKNA 1YWKA 1LGNA 2PLV1 1MZFA 2EIDA 4NN0A 3VV1A 3WEZA 4YRDA 4CP2A 1VBB3 5FZ6A 5ABJA 5I8TA 3RZMA 3KSTA 2F4LA 2OT7A 1UV4A 2ZMNA 2HWB1 4O8PA 1HN0A 1VRH1 1SEFA 2QTWB 4AVAA 1YFYA 1WLWA 2B39A 5AYDA 1C8M2 1ZBA2 1LEMA 4JGYA 5JCTA 5KBFA 5FKCA 5F2SA 5GLKA 3ZLIA 1TME3 5FXXA 4JCKA 1J83A 1E5IA 5K9YA 1A34A 1ZNPA 1HJFA 1PIV1 3GBWA 2ZMLA 2QQWA 2D6PA 4Y22B 4HN0A 2QQKA 4DZGA 2WR9A 3LDKA 3R4ZA 4BIFA 5C33A 4CE8A 1NE6A 1G8WA 1PHMA 5A7WB 2DVGA 1SBDA 1WLDA 4H7LA 4OVEA 1GQGA 4OZOA 1NA1A 4UFJA 3AJYA 1W6NB 2CAVA 2RE9A 3WNMA 3WPVA 1DQ6A 3PUQA 4I30A 3E97A 2ZS6B 5F3EA 2HWF3 3KCYA 3VBHC 5DAVA 1NCQC 1IG3A 1U5IA 4FPKA 3ACLA 3BUCA 2W2IA 5F39A 2RR13 4RL7A 1VB2A 1DLCA 1Q43A 1VP6A 1WLTA 2GNBA 2VG9A 3AMHA 1JUIA 4YGCA 5IFPA 2WNUC 3A0NA 2RR11 2VGDA 4LBJA 1KDKA 2I74A 3LZZA 2IC1A 2UYAA 3RQ0A 4IEZA 5B4XA 1OMIA 1B35C 1ZZCA 1SQ4A 3ZSKA 2HWF1 5FP9A 5EHDA 1AJOA 1SHWB 2BVVA 1Q56A 3DUIA 3IMNA 5T5LA 2YPDA 5HXMA 5BNNB 2BUKA 2D98A 4EN8B 1CAXB 5H9RA 3TB0A 1FYUA 3D82A 1V0AA 2LW8A 2X29A 1OLME 1Q8SA 3KF5A 4ARXA 1RUI3 4Y20A 5FY5A 4AL9A 5ABJC 1BVP1 4BHPA 4A41A 2XHKA 5JOYA 1PGL1 1PIV3 2X5IA 3CU9A 2ARAA 2RDRA 2RS33 3MDPA 3NV1A 3MUY1 1Q8PA 5EYYA 5FZ7A 1YQ5A 3WG4A 3DKQA 4DMIA 1I1EA 2NM1A 3WN0A 4PHZA 1SLLA 2JIJA 2ZXQA 1QOOA 2D6KA 1JZ8A 1UYYA 3SKVA 5HXVA 3N7MA 5JXHA 2YGMA 3AFKA 4YG3A 2VMEA 3HEIA 5T55A 2E32A 4GQ7A 4CUAA 2OQ6A 5FYVA 2ZX1A 3WPZA 1OFNA 3S5AA 1W6PA 3ZYBA 1GP6A 2GMMA 4P9LA 4MGQA 4MADA 4MHUA 4NPLA 5L9RA 5LRRA 4OLLA 1LRHA 3WDYA 5JUVA 1UY1A 1OURA 4JDMA 1TMF2 4BWOA 4COZA 3S0MA 5C9AB 4AI2A 1NZIA 3N9MA 3T3YA 5FUPA 1EUUA 1R083 2R073 2XR4A 3AMPA 4MOAA 2ZOEB 4NHMA 1JYXA 4FPCA 1HB3A 1X82A 4CDWC 1L7QA 2VD7A 4QX3A 5FLIA 5F5QA 4Y24A 5FPAA 1AR73 1AXKA 3OM6A 2HWC2 1PZ9A 2ADDA 2ZBJA 4MHRA 3OGGA 3D61A 5JPNB 2VCAA 4MZUA 2PHTA 4MV2A 2WA3A 2A70A 3MW2A 1F31A 3HOBA 1H8TC 3RGBA 4AGGA 4BQWA 1XPWA 2D40A 2VTXA 3HT2A 3E5XA 4QPIC 4UFKA 2NLRA 4MO3M 2DCKA 4MGKE 4IV1A 3PHMA 3VSSA 5LY2A 4K1YA 4OULA 2HWE3 4GKXA 5LW9A 2P5BA 4XFIA 4CPBA 4KL1A 3KT4A 2R041 5L9VA 4HVOA 2PXJA 1UNBA 4N43A 1SPPA 2IVJA 1V9U2 4NWWA 3ZOIA 4RYDA 4AVSA 2P17A 5T5JA 1BK0A 5SV5A 5CFCB 2YU2A 2HWE1 2JDPA 1MZ5A 1BXHA 2AREA 1VJ2A 1ND2A 1I6XA 2ZGTA 3T1MA 4OQ8A 4A7ZA 1QU0A 1HRV2 3PUHA 1C4RA 4LOTA 4CXXA 3VDBA 1JYIA 2D3RA 3D4KA 4JC1A 1W18A 4CXYA 4U6DA 2DWRA 3L9JT 2XUMA 3WF3A 1DBNA 5FXZA 2P3YA 4IERA 3IT8A 4WM8A 4X8NA 3WLUA 1N1YA 3WP5A 1LHVA 1XE7A 4XF3A 4QQOA 5FYCA 4AK5A 1TVGA 1V6JA 1Z78A 1OA2A 3VUOA 1RVF2 4CZSA 2R071 3LA3A 2VZPA 4LXLA 3C7GA 1WW6A 1XNKA 2PHUA 3MLKA 2G1MA 2YUEA 2WO1A 3WG2A 1XNBA 1RUNA 1PO12 4HVRA 1JYVA 4OUEA 4RSUA 4TTGA 4URAA 1UZZA 1W6NA 2XLGA 3KM5A 2W46A 3OGJA 1RUC2 1D2SA 1YUDA 5J96B 2X8FA 2RJ2A 4JX0A 2SBAA 1HB1A 4P14A 3I2GA 2BBVA 4GJZA 1AUYA 2FCVA 2QZ2A 1H8TB 2WINB 1LOBA 3D8CA 4GB32 3UKNA 4AYUA 4UFMA 4CCMA 4YVWB 2VZUA 3QH6A 1WMXA 4E9KA 2VR4A 4K3UA 4R9AA 1W05A 3WNNA 5LK5A 5JZGC 2DCZA 4AFMA 3I2KA 1E57A 4BU2A 4IV3B 5DABA 3R0RA 1S4CA 1COV1 4AW7A 3E6DA 4P9JA 1XQNA 5BV6A 4COTA 1Y9QA 3O1MA 3URFA 3VGIA 3JB4C 3RG0A 2O1QA 2E33A 4NPRA 3H7JA 2WNVC 3VBHB 4FCAA 1TZOA 3NAPA 3Q8FA 4I02A 1NCRB 3VKOA 2IXIA 3KV5A 3BCWA 2DV9A 5FJKA 4D47A 1UO9A 1G9FA 3OBTA 3POIA 4BISA 4COWA 4DNYA 3W5MA 4R9CA 1VBA3 1VALA 2JG8C 3QCWA 3CMGA 1HRI3 3OG2A 3I54A 4HK8A 5FQ0A 3LE0A 3LB9A 3VSRA 2J1AA 4D8MA 4MGZE 5LB6A 4DS0A 3NKGA 4QB2A 1ZZ8A 1RHI2 1Z7S1 3OBZA 3N9QA 2QE3A 1UOBA 3WP6A 1AYN1 5KXDA 3VN4A 2DVBA 5M0TA 3QEFA 2RMU2 1PVXA 1R081 5FYIA 1R091 3AYEA 1BZWA 1PO22 3N9OA 2PAMA 2BVBA 1C8NA 3P6BA 4FO9A 4Q0QA 3SC7X 4CEYC 1H1IA 1W2AX 5SV8A 1G9BA 2PN5A 5F1RA 2YB7A 3OEAA 1YNAA 2ZEZA 4XW3A 3BYKA 4CDQC 1GUIA 2AH2A 4XYXA 4XUTA 3RS6A 3W9AA 1QY4A 1X7NA 2P37A 2ZEYA 1GSLA 5DG1A 4WVWA 4O65A 3HPNA 1OF4A 5FZCA 4B3NA 4OHYA 2I2SA 2WLQA 3WT3A 4N9IA 4COUA 4OI1A 2ZEWA 4E4DX 4NIAA 4AXOA 3OSDA 2O8OA 1P8JA 1RVF3 2D5FA 2WT1A 3H1YA 4UT5A 4N90A 4CEYB 2EVXA 4PI0A 4F83A 4QDSA 1ULPA 2CTVA 2PHFA 4IV1B 1Y43B 2WNVA 2E26A 2VUAA 4WVZA 5FLHA 5C5UA 3VZKA 4CEWC 1ST8A 4GULA 1QXJA 3C3VA 3QEDA 4PLNA 1YHFA 4EN7B 2RR12 2W1SA 5A1FA 5ANNA 1IGOA 1W03A 3AM2A 2QBXA 1ZZ6A 2VC9A 2Y33A 2V4VA 4HMZA 1W0OA 2JG8A 4K20A 4N2RA 3MIDA 2RM21 4QQSA 4UW5A 5L7OA 4AAXA 2VBPA 1A3KA 1RC6A 1GR3A 2WWSA 3VBOC 2DVDA 2Q8EA 4LUKA 2VW0A 4MGTA 4DEVA 2PHWA 4IV1C 4UBGA 2RS51 1FNZA 2VOTA 2WA4A 1JMUB 3T09A 4IXLA 3WNLA 2QCSB 5LCWL 1HV1A 5JSPA 1JZ7A 2UURA 3AXDA 3WG1A 3FFZA 5LA1A 4BIOA 1DQ0A 5GM0A 3ALQA 5EPAA 4DXTA 1QDOA 2CL2A 3B69A 4KWJA 3RFRA 1UD1A 4XETA 2WBKA 4QX5A 1FX5A 2VUDA 4KCBA 2HBUA 1UZVA 5CFDA 3S7IA 4ZZ5A 1W90A 4WM7C 4F8AA 3ENRA 5FZ1A 1A8MA 3KVAA 4XOGA 1OFSA 1AZDA 3AVSA 1VBD1 4UYBA 5FP8A 3FBMA 1ZVFA 4RHV2 3IWZA 1O8PA 2VO5A 1PMHX 3AZVA 3WW2A 1YIPA 5FZ0A 3PLQA 4L11A 3MW4A 3SMHA 4DRVA 2VMGA 4SBVA 5J09A 1FV3A 1AR71 1S0GA 1YRZA 4Q27A 4AWDA 3U10A 4Z07A 3TRSB 4CEWB 5AFEA 1TMF1 3ZR5A 1GYDB 2PLV3 4IL7A 3RSJA 5E6HA 1UQXA 5JZGB 1HRV1 3B3QE 3IM0A 1MQTA 3KCCA 4FPFA 1O3SA 4GIQA 1XE8A 2PAEA 3QOPA 1OPOA 4OI2A 2XVKA 2RVAA 3JZVA 4CDWB 1NLQA 4A4AA 2NP0A 3WQ1A 1OF3A 2HWC1 1YLLA 4QAWA 4B29A 1ZA7A 4FTEA 2GC3A 3RWKX 4AFDA 2ENRA 5LBCA 4QGNA 3WDUA 2ORXA 4QKBA 2D97A 2B7YA 4BM8A 1SLIA 2ZX4A 5FO9B 1NT0A 2AR6A 4Y1VA 5IK5A 2ARBA 3D5OA 3VBUB 2VQ0A 1ZBE3 3J4UH 3OYWA 5BPXA 2W52A 1EPWA 1AR61 1GKBA 2IXKA 4CU9A 1LESA 3L2HA 3IAQA 4D3WA 3V0AA 5ERLA 1H4GA 1PVC2 1SLAA 2Z79A 3GALA 3EXUA 4XBLA 1W39A 2AENA 2WUHA 3FZ3A 1S2BA 2R30A 4CDXA 4Q4V3 4CP1A 2VUJA 5CBLA 2W5FA 3H42B 1NX9A 2QVSB 3OB8A 4L99A 3VBSB 2D3PA 3H9AA 4IETA 3DXTA 4IUGA 4WZFA 2XJPA 2Y6LA 5CYYA 1JZ4A 4OI0A 1OHFA 5AFBA 3I49A 4FPGA 1W8NA 3POSA 5LK7B 5CG9A 1ENXA 1O3RA 3OM4A 4AI1A 5JIAA 4BQYA 1STMA 1CJPA 2KA3A 3ACFA 4LORA 3MUZ1 4LO7A 2FBEA 1O8SA 4AF9A 4AEDB 1CESA 2C5DA 2YC4A 2YFZA 4R8HA 2JE7A 4YVWA 1SLCA 2GZWA 2R072 1DP0A 1WW4A 3MFAA 2Q8DA 2BOJA 1CAVA 3R6SA 4XCBA 1CJDA 4K8FA 4QPGC 2LRPA 1AYN3 1H9WA 2QUOA 4CCLA 4CCDA 4CEYA 3M8LA 2WSUA 4LQRA 3O7OA 1UYZA 3RYRA 1BBT1 1KS4A 2WLPA 3POJA 4M01A 5FZKA 1UX7A 2A3WA 4LBKA 4BYYA 5IHRA 2OZ6A 2Y26A 3JQWA 4N8MA 1PVC3 3BIEA 3WPYA 4LULA 5FP3A 1QNYA 4OMDA 1BEV2 3JD71 1ACCA 1CIWA 1J1LA 2OIIA 2WN3A 5FUNA 5D8AA 3DYMA 4UI9L 3GCWA 3M3OA 5GLZA 1HXS2 1TME1 3EB7A 3PMSA 5C3SA 5K0UA 2BGPA 2PAKA 4P02B 1NKGA 1OC1A 2VMDA 3S30A 4R4XA 4RA0A 2VOXA 1D4M2 3IDCB 4FFFA 2W47A 3WQ7A 4CUCA 4Q8KA 2FMYA 2EXIA 4LBNA 3HWJA 1VRH3 2JECA 3AMQA 1UKRA 3HN1A 3LDBA 1Y9GA 3FHQA 3WP3A 1WCDJ 5I0DA 1IS5A 3U4XA 1PGW1 5FZBA 1OSGA 1XNAA 1CN1A 1UW8A 4O7XA 1TNFA 5BNOC 5GLVA 1NCQA 1LHOA 3PURA 3UNPA 1KJLA 4Q4X3 1BJQA 3HQUA 2Q5TA 5ANQA 2A6WA 2QQLA 5J1XA 1PGL2 4QM9A 4IV3A 2HYKA 4KG0A 1RUH3 3AP9A 4LR4A 4WM8C 4YW6A 4QKDA 1VMHA 1XU2A 1ULGA 2Q8CA 2XBO1 5FZOA 4O9GA 5A7WA 5FPZA 5DN2A 4CU6A 1NG0A 2WC2A 1N1SA 2EALA 2VTFA 4JDOA 1POQA 1RUF2 3ETQA 4NVPA 3RMYA 1RMU3 3ZXLA 1W2OA 2ZJCA 4B1LA 1AL23 3IDEA 5A7VB 4EWAA 1WD4A 3AK0A 4ZZ8A 1FAYA 4AK6A 3NV3A 3ZN6B 2XWBB 3A7QA 3WF1A 5ACA1 5HV0A 4Q26A 4GJYA 4EJRA 5BYNA 2Y34A 5FZFA 1BLZA 3DCQA 4UFLA 5GLMA 1MVEA 1YJLA 2LS6A 3AL6A 1QJX1 4IGQA 1UOJA 4D94A 3POFA 4HKLA 4FPEA 3POYA 4GALA 4W6WA 3WCSA 3ZIWA 4CDUC 2HBTA 3DGTA 4CDQB 5A3NA 5KC5A 1MS4A 2OUJA 3ILFA 2W94A 5LBBA 4QKFA 2ZGNA 5D8AC 5L19A 4B7KA 4QQPA 2IFRA 2A75A 2RS52 2DUQA 5HCAA 2VMHA 1M06G 2VU9A 4Y1UA 4FOQA 5IAVA 4BK4A 3ZXEA 1LEDA 2N7GA 2PELA 2XDVA 4FAHA 1CD3G 1XNTA 3ZKUA 4ZU7A 5JXJA 5F37A 3VT0A 1MZ6A 3BYLA 1AR62 4FTBA 1HRI2 4H2AA 5DAWA 3W20A 3ZFEB 4QX0A 2EIEA 5C3QA 1S0DA 1UIKA 3G6JB 4KU7A 3ST7A 3HNBM 2EXKA 1OUXA 2VMIA 3IMMA 3M1HA 3WW3A 1GFF2 5AYCA 1J3QA 4LOSA 4LJHA 4CA9A 5FREA 4K8RB 1UN1A 1SCSA 2OZJA 2V5YA 3KV6A 1LGCA 3SH5A 1J1TA 4Q4W1 1OXCA 2Y6KA 2GMPA 3J7LA 5FQ0B 3RZKA 4KWKA 3VT1A 2CAUA 2BZDA 4KGQA 4LO8A 3ZYFA 3TYJA 3B02A 4LE4A 3I2OA 3BN6A 1H0BA 1VPHA 1W6MA 4FPLA 3P1IA 4ZXEA 5A7SA 1W0PA 2BRTA 1CX4A 2R061 1LB2A 5JOWA 3NAPB 2VULA 3U1XA 2MEV3 2WS93 3KQ4B 3O12A 4LKDA 4KMIA 5A32A 3FE5A 3PNAA 3LOBA 4YZ1A 5IVBA 5J98B 1QJEA 2YHJA 4XFFA 3ZDVA 4DO0A 5KWRA 3UESA 1OKOA 4YW3A 3FLTA 3WDVA 1JN2P 1OVSA 4KBZA 3QACA 1W28A 1AX0A 5I0RA 1QH6A 4AI0A 3ZPYA 4JTNA 5CU1A 5BNQA 3AYCA 2BP6A 2CHHA 3QD6A 4R9DA 3RNSA 3OJBA 4BPZA 2BFUL 4RQPC 1NQDA 5I0TA 2FDHA 4FAGA 1OUSA 1XRUA 3M3IA 3PMEA 2WFF1 3KF3A 3UT0A 3ZXAC 5H9QA 4LUMA 2VQTA 1JZ6A 3HT1A 1BYHA 2AYHA 5EV7A 2ID4A 1OKQA 3DECA 2VZ1A 2RS31 1GYKA 2P6HA 3HJRA 4GD4A 2B8MA 3VZOA 2CNAA 2JDHA 2DCTA 1PM4A 2W95A 3NL1A 2FCUA 3AKGA 5CADA 4XBQA 1GICA 4D6QA 2CV6A 2YFTA 1W3XA 4CP9A 4NROA 5KR7A 1ZX5A 4Y5TA 4YGEA 1H2MA 2JEMA 3WNKA 3N9PA 4RGAA 3ZYRA 1E5SA 5IK7A 1Y4WA 4Q2FA 4BXSV 3BTZA 2XJUA 4XPVA 4ATFA 3LD8A 2UYBA 5EP9A 3B00A 4YZ5A 3VL8A 2VVDA 4IEQA 4U2AA 4AGRA 1AX1A 1NUKA 5DDJ3 5D21A 3M70A 2X05A 3RYKA 5GZEA 4CDXB 5I0SA 1WW7A 2GC0A 4XQWA 2ZKNA 1AR92 4BB3A 5JZGA 1C3HA 2DUOA 3J26N 4E4ZA 2VDTA 5A3LA 1ZBA3 2ADEA 1JI6A 1H1MA 2JG8B 3PUAA 1GLHA 2WZR3 1J3RA 3ME2A 4W8JA 3WSOA 4JGZB 2JXAA 2OPKA 1QDCA 1XSRA 2HWB2 2J22A 1MS5A 3VD7A 3BTYA 4ISQA 1RHI1 4JGZC 2JIGA 1W8HA 2R49A 3FLRA 3SNMA 5KHKA 2YYOA 4OI4A 3KHCA 2L9LA 3M7AA 3OTFA 5FY1A 4PIYA 4ATEA 5CISA 4TSVA 5FBJA 1GWLA 1OLQA 2HEWF 5LEJA 4NHYA 1BEV3 4JRAA 4Y26A 4DFSA 1F4AA 4AFAA 1CAWB 4XDPA 4GXLA 1ENQA 3WF4A 3K3NA 3UV9A 1LNSA 2VTXJ 1XE0A 2QQOA 1CIYA 3N4MA 3U14A 2J7MA 5IVJA 3A22A 5FY7A 5D8AB 3HVDA 1S0EA 1YFXA 3OEBA 4OHWA 3JBG2 3AP7A 1SG3A 5K0UB 4Q1RA 3VBFB 4ONUA 3ZMNA 3TOJA 5BXXA 3EHKA 5A6QA 4HG6B 5CEHA 5JSOA 3KGZA 4RR3C 4LHLA 5F9TA 4XJAA 1VKDA 4JHZA 3THPA 1ULOA 1X50A 2XQRA 5FTTC 3OUIA 4JGYC 2OA2A 3NNJA 3THTA 1O3TA 4LPLA 2X8KA 1YQCA 2X09A 3ECQA 3OBAA 5DZFA 4LNVA 1WD3A 1NY71 3LIGA 4XCAA 1HX6A 3OD4A 1EY2A 1JZ3A 5HCFA 3IPVA 3K51A 4KG8A 1T2XA 4N7IA 1DGRN 5FZ4A 1XBFA 4N1IA 1UMHA 1TME2 2V4AA 3AKSA 1CZTA 3ZFFB 4XVHA 1O7FA 3NV4A 4GZ9A 5FOBB 3VBOB 2RJKA 1QJX2 2AEZA 1HN1A 3IAPA 4RD7A 3QZ4A 1VBA2 1UPIA 3KQRA 5FFOC 4LIUA 5C8CA 1DFQA 4Y5Z0 2W1UA 3HN3A 4Z82A 3I59A 2A3YA 3JXSA 5JAXA 4NIHA 3PL0A 3P2NA 4ZKTB 5FWJA 5FYBA 3W21A 3KB5A 3BOWA 1B09A 4J25A 2C26A 4XQDA 4AHWA 4DOUA 3CF6E 3GZUC 2CDOA 1QJX3 1SFYA 5JPMB 3OGRA 4C8DA 4E4HA 5J7MA 3T30A 5JSRA 2ZGPA 3UYJA 1QEXA 1UOFA 3AP6A 3ON7A 2RS53 1QHDA 4UBHA 5IT6A 3ELNA 3ZFFC 2C1FA 2BBAA 2ES3A 2PHXA 1NXMA 4WVMB 3ZX7A 1PZ7A 2O14A 5H9SA 2JD4A 2CU5A 1HKDA 3R4SA 1MQTB 4RGKA 1HLCA 1IHMA 3B93A 1ZRCA 4QXCA 5HCHA 4Z2AA 1GZWB 4DUVA 2GNMA 1O5LA 3IZOA 3TWIA 4BK5A 4DUWA 5LBEA 3EMRA 5KHIA 1Y9MA 2VMCA 1YXWA 2WAAA 1ZRRA 3FUOA 4QXHA 3ZYHA 4ES8A 3RZHA 4CP9B 1A8DA 4LT5A 4O8NA 1X9TA 2WN2A 3CLPA 3LV4A 4Q4W3 4P08A 2FZ2A 1REFA 3NW4A 2A3XA 1LULA 3JQXA 1ULDA 4AFCA 1IPSA 2XHNA 1SDWA 1HB2A 3I2IA 3I2DA 2ZACA 1JZ2A 1DQ5A 1OOPC 1PMIA 1GANA 4QMAA 5FZLA 1XC6A 2JB8A 5C4WA 4B4QA 4QHBA 3EO6A 3VBRC 2F17A 4K6BA 2HWE2 5I8YA 1W6QA 4M00A 2FDFA 1IG0A 4FTSA 3KWVA 3FHIB 1OBNA 4HKWA 3NMBA 3WG3A 2DDUA 2DU1A 2WNOA 3FX3A 2A5ZA 3ILRA 3MGUA 1V70A 5FZEA 2EIBA 3NJXA 3P3NA 2P4EA 3IIIA 4IV3C 1WCUA 4G4FA 4MSVA 1PMJX 2AEYA 1GZ9A 2VW1A 2HWD2 2BTVC 5JDBA 4WZCA 4LKEA 1GOGA 2GMEA 4UDKA 5FLJA 2OX0A 4XJ9A 2ZGMA 4CUBA 3AKFA 2A6YA 1HXS3 4V2VA 2FDKA 3QH7A 1FXZA 2YY1A 3RJ2X 3E5QA 3ZN6A 4A45A 4AK7A 5E8AA 2XJRA 5A3MA 2Q0AA 4U6BA 3AYAA 4GH4C 4FP3A 1JHJA 4Y33A 3T1LA 3OF1A 4XQ4A 1X33A 2ZX3A 1CGPA 1UY0A 4N43C 4TN7A 4INDA 2P3JA 4BQXA 1PGW2 4N9HA 4GWMA 5IK8A 1U5YA 2GC2A 1MS8A 3BTAA 3HD8B 4I0AA 4UDKE 4DXRA 2XBO3 2GAUA 3FJSA 3AP4A 1Z7S2 2AGSA 1KFUL 2XKOA 4JRLA 4XAAA 3WR0A 4YG6A 1SMVA 2PQQA 5JMOA 5T52A 1PO21 4UDGA 5GLRA 3T2QA 3WPUA 3PTYA 4RQPB 2ZGUA 4GA9A 5JLVA 1XYPA 4NHXA 1DZQA 2RS32 5JR2A 4MG2A 4OMCA 1VBC3 2R062 2GNDA 5FOJB 3H8XA 3JBG3 3J8F1 2R1DA 3RRDA 1AL0G 3VL9A 1NCQB 4LMFA 4JQTA 1SFPA 3I3MA 2V5DA 3QEEA 3KT1A 4G3YC 2KM2A 3DV8A 2EF6A 5HBAA 4IE5A 4XEZA 1DHKB 2R32A 3VBFC 4FT8A 3VD4A 4XC9A 3POWA 4DY5A 1E5RA 1ZBA1 4QD2A 3JD73 2B5HA 2ZGSA 3PU3A 5EJZB 2YFRA 4XJUA 2BPA2 3VB9A 1H9PA 5IAXA 1ZBE2 3ZXDA 2IXCA 2PFWA 5IVEA 1CWPA 5BUVA 3OPZA 2X5IB 1U12A 2XJTA 2WQZC 4Q0VA 1KFXL 1OD3A 5GALA 2Y6JA 3IDBB 2LROA 4META 1DU3D 1PO11 2TBVA 2X5IC 2YDEA 3T2PA 4CU8A 2RV9A 4UFHA 3THDA 2A73B 3MIHA 2DVFA 1V9U3 2DCJA 4ZHNA 1MVQA 2Q1FA 4I0WB 2EXHA 4QQLA 4M4PA 4BCUA 1C5HA 3GBFA 1SLBA 4QPWA 3BYWA 1FOD1 1XSQA 2VECA 3ZO0B 4EQVA 4QXKA 4B1MA 5C8CC 5LA0A 5KHGA 3BYNA 4JVAA 3WHUA 1W9WA 1GZWA 1J59A 5H9PA 1W6PB 5AVPA 1KEXA 2G19A 5CFDB 4HSJA 5FKBA 1N3PA 1RUG1 4CYDA 2ZAAA 1COV2 1H6XA 3V0BA 5IYYA 2ZKLA 5FO7B 3K3OA 3MEPA 5C7GA 1UPSA 3DPRB 4N53A 3SKJE 4N4BA 1NQJA 3PVOA 2BNOA 3TNQA 3WQBA 1VBB2 1S0CA 3M3EA 2C24A 4WBBA 1OYGA 3PVEA
chains in the Genus database with same CATH topology
3QC2A 4QQSA 3S5QA 3TAWA 4UDKA 3ZXJA 5GLQA 3WN2A 4FFIA 2AC1A 3AKFA 4CCDA 3OM5A 4N2ZA 5JOWA 1WL7A 3U1XA 2X8SA 2X8FA 3K1UA 4KMIA 1VKDA 1W2TA 3KF5A 5AY9A 3NQHA 4AK7A 3WPYA 2XQRA 3LF7A 5FMBA 4U6BA 5C0PA 3C7EA 5JOYA 3LDRA 2QQUA 4UFMA 3CU9A 3VT2A 3LIGA 5GLNA 3D60A 3PIJA 4O8OA 3OM7A 3WN0A 4N1IA 4UDKE 4AZZA 2B4WA 1UYPA 4UDIA 3C7GA 4FFFA 4KCBA 4PVAA 4COTA 3WASA 2EXIA 5A7VA 3C2UA 1Y9GA 2AEZA 2OXBA 4KC7A 4UDGA 5GLRA 3WPZA 3D5ZA 3QZ4A 3KF3A 4NOVA 3ZXKA 2QQVA 3C7OA 4CCEA 3UGGA 5B6SA 4D47A 3LFIA 3P2NA 1YRZA 1Y7BA 2X8TA 1PT2A 3UGHA 3ZR5A 1GYDB 3AKGA 4JQTA 2EXJA 4KC8A 3ZR6A 3QEEA 4MLGA 5FMDA 2YFTA 3VSRA 4FFHA 5GLPA 3D5YA 3ZXLA 4B1LA 5A7VB 2YFSA 1YI7A 3OM6A 2ADDA 1Y4WA 3LIHA 3QEFA 3WAUA 3D61A 5AYEA 5A8DA 3HBKA 2YFRA 4AK6A 3RWKX 3KSTA 1UV4A 3SC7X 5FMCA 5FIXA 4UFIA 4UFKA 3BYJA 1YIFA 3R4YA 4O8PA 5GLMA 4UFLA 3VSFA 3UGFA 5JOXA 3OM2A 3VSSA 3BYKA 3WMYA 1Y9MA 5AYDA 3AKHA 3VSZA 5FKCA 2VDTA 3R67A 5GLKA 2ADEA 5GLOA 4UFHA 4O8NA 3WPUA 3U75A 3LEMA 3AKIA 4UDJA 3H3LA 3LV4A 1GYEB 2EXHA 2QQWA 3C7HA 3LDKA 3R4ZA 4KCAA 5FK7A 1GYHA 4EQVA 3OSDA 4B1MA 3PIGA 3VT0A 4HXCA 3BYNA 4UFJA 3BYLA 5GLLA 3WPVA 3C7FA 1W18A 5B6TA 5FK8A 4U6DA 2EXKA 3WATA 3IMMA 3WMZA 5A8CA 4PVIA 5FKBA 5AYCA 5FLWA 1ST8A 3OM4A 2AEYA 3NMBA 4FFGA 3QEDA 4CCCA 4AK5A 5JOZA 3WN1A 4N4BA 4ONZA 5ANNA 3U14A 4N2RA 4QHZA 1OYGA 3VT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QC2 A;  4QQS A;  3S5Q A;  3TAW A;  4UDK A;  3ZXJ A;  5GLQ A;  3WN2 A;  4FFI A;  2AC1 A;  3AKF A;  4CCD A;  3OM5 A;  4N2Z A;  5JOW A;  1WL7 A;  3U1X A;  2X8S A;  2X8F A;  3K1U A;  4KMI A;  1VKD A;  1W2T A;  3KF5 A;  5AY9 A;  3NQH A;  4AK7 A;  3WPY A;  2XQR A;  3LF7 A;  5FMB A;  4U6B A;  5C0P A;  3C7E A;  5JOY A;  3LDR A;  2QQU A;  4UFM A;  3CU9 A;  3VT2 A;  3LIG A;  5GLN A;  3D60 A;  3PIJ A;  4O8O A;  3OM7 A;  3WN0 A;  4N1I A;  4UDK E;  4AZZ A;  2B4W A;  1UYP A;  4UDI A;  3C7G A;  4FFF A;  4KCB A;  4PVA A;  4COT A;  3WAS A;  2EXI A;  5A7V A;  3C2U A;  1Y9G A;  2AEZ A;  2OXB A;  4KC7 A;  4UDG A;  5GLR A;  3WPZ A;  3D5Z A;  3QZ4 A;  3KF3 A;  4NOV A;  3ZXK A;  2QQV A;  3C7O A;  4CCE A;  3UGG A;  5B6S A;  4D47 A;  3LFI A;  3P2N A;  1YRZ A;  1Y7B A;  2X8T A;  1PT2 A;  3UGH A;  3ZR5 A;  1GYD B;  3AKG A;  4JQT A;  2EXJ A;  4KC8 A;  3ZR6 A;  3QEE A;  4MLG A;  5FMD A;  2YFT A;  3VSR A;  4FFH A;  5GLP A;  3D5Y A;  3ZXL A;  4B1L A;  5A7V B;  2YFS A;  1YI7 A;  3OM6 A;  2ADD A;  1Y4W A;  3LIH A;  3QEF A;  3WAU A;  3D61 A;  5AYE A;  5A8D A;  3HBK A;  2YFR A;  4AK6 A;  3RWK X;  3KST A;  1UV4 A;  3SC7 X;  5FMC A;  5FIX A;  4UFI A;  4UFK A;  3BYJ A;  1YIF A;  3R4Y A;  4O8P A;  5GLM A;  4UFL A;  3VSF A;  3UGF A;  5JOX A;  3OM2 A;  3VSS A;  3BYK A;  3WMY A;  1Y9M A;  5AYD A;  3AKH A;  3VSZ A;  5FKC A;  2VDT A;  3R67 A;  5GLK A;  2ADE A;  5GLO A;  4UFH A;  4O8N A;  3WPU A;  3U75 A;  3LEM A;  3AKI A;  4UDJ A;  3H3L A;  3LV4 A;  1GYE B;  2EXH A;  2QQW A;  3C7H A;  3LDK A;  3R4Z A;  4KCA A;  5FK7 A;  1GYH A;  4EQV A;  3OSD A;  4B1M A;  3PIG A;  3VT0 A;  4HXC A;  3BYN A;  4UFJ A;  3BYL A;  5GLL A;  3WPV A;  3C7F A;  1W18 A;  5B6T A;  5FK8 A;  4U6D A;  2EXK A;  3WAT A;  3IMM A;  3WMZ A;  5A8C A;  4PVI A;  5FKB A;  5AYC A;  5FLW A;  1ST8 A;  3OM4 A;  2AEY A;  3NMB A;  4FFG A;  3QED A;  4CCC A;  4AK5 A;  5JOZ A;  3WN1 A;  4N4B A;  4ONZ A;  5ANN A;  3U14 A;  4N2R A;  4QHZ A;  1OYG A;  3VT1 A; 
#chains in the Genus database with same CATH topology
 3TAY A;  3LPF A;  3WIN E;  5GZD A;  3POB A;  4NHK A;  1ZRD A;  1AR8 1;  1MQT C;  2B42 B;  4QGL A;  2UWB A;  1ONA A;  4TLF A;  5CKQ A;  5CA6 A;  4S2H A;  4YW1 A;  1O91 A;  1X8M A;  4WV8 A;  5HV4 A;  4Y5S A;  2BU9 A;  1F5J A;  5LA2 A;  1XYN A;  1UU4 A;  1V9U 1;  2VCM A;  4RHV 1;  1OH3 A;  1WL7 A;  4LLO A;  3SEP A;  1JYT A;  5LAS A;  4K7J A;  4TWT A;  5AC9 2;  1F4H A;  4YGB A;  1VMJ A;  5JVV A;  3MI8 A;  2BNM A;  4HAN A;  1MS3 A;  4M4R A;  4CDU A;  1LOC A;  1ZZB A;  3BOD A;  2ZPX A;  2YV8 A;  3VHR A;  1GZT A;  1Q3E A;  4YM1 A;  2OPW A;  4L0P A;  2HKX A;  5BY5 A;  3EQE A;  4COY A;  2LUW A;  1HRV 3;  5DUV A;  1W8Z A;  2E63 A;  2QKD A;  2ZGK A;  4IEV A;  1DZT A;  5F6K A;  1DGW X;  3K46 A;  3RVH A;  3WP4 A;  4Y1Y A;  4D0Q A;  2B4W A;  5JR7 B;  4YSF A;  3LCP A;  1J84 A;  5A1A A;  3MIB A;  4HN1 A;  1RVF 1;  2UWC A;  3NJV A;  3VHP A;  3VD9 A;  4HT1 T;  3MHZ A;  5KHH A;  4XXA A;  3RJR A;  4CCN A;  3V0A B;  4RS5 B;  1RUH 2;  5CVR A;  1F35 A;  2BW8 A;  4NR1 A;  1UU5 A;  3V64 A;  4AI3 A;  5FZM A;  2DYC A;  4NMI A;  3JBG 1;  2ZHL A;  3RDI A;  1X36 A;  1KGY A;  3MBW A;  1UWW A;  4JDN A;  4D69 A;  3I4I A;  4XJZ A;  3A4U A;  2YGL A;  4LHK A;  4LBO A;  3MZH A;  3THC A;  3POG A;  1DDL A;  4XIO A;  5CZK A;  4Q29 A;  2WWU A;  4FFH A;  1VLN A;  4FXK B;  2BDR A;  2MNG A;  4X6Q B;  5FZI A;  5GLP A;  4YVS C;  3AKQ A;  1AYN 2;  4L2N A;  4IE7 A;  3B01 A;  5E16 A;  1MZE A;  1ZZ9 A;  1EYB A;  5JIU A;  1GNH A;  4LKF A;  3ZSE A;  3CJX A;  5FYT A;  3J7N A;  2QZ3 A;  2W08 A;  1G6N A;  2R04 2;  2K2S A;  4MXW A;  5A6Z A;  1NCR C;  2GDF A;  3NV2 A;  1BQP A;  2BEO A;  1CAV B;  2IFW A;  4QB1 A;  3R4Y A;  3H8U A;  4XTM A;  3HR9 A;  1JS9 A;  2V73 A;  1POV 1;  4LIV A;  5G04 L;  2JE9 A;  4PJY A;  4AED C;  5GLO A;  3MF6 A;  2RMU 3;  4FQZ A;  2NMO A;  2VQA A;  2Z42 A;  3WY6 A;  1PM7 A;  1RIR A;  1US2 A;  2WQ4 A;  3X29 B;  1EAH 2;  3ZN5 A;  3JUU A;  4Y22 A;  3FC0 A;  1C1L A;  4BMB A;  2JE8 A;  2V72 A;  3UJO A;  1S0I A;  1S2E A;  3T0A A;  1GYH A;  3BVC A;  3D0J A;  3NO8 A;  3V56 A;  2C6S A;  4X8P A;  1HW5 A;  5DAP A;  1IKQ A;  2A7A A;  1BBT 2;  1NE4 A;  5C9A A;  2BER A;  1YJK A;  1W2U A;  4Q1P A;  5FK8 A;  1ULE A;  2FD8 A;  3M3Q A;  4IE0 A;  5A8C A;  4PVI A;  1FV2 A;  3MIC A;  1O3Q A;  1RXF A;  2FDJ A;  3KCX A;  2RS1 3;  1JOB A;  1V6M A;  1RUJ 3;  1ODN A;  3O1S A;  4F3J A;  1SBE A;  5FZ9 A;  2GC1 A;  2WSV A;  5IW0 A;  2W91 A;  3QLQ A;  2IUW A;  4AQS A;  3D5Y A;  2Z2S B;  4YW2 A;  4C91 A;  2RS1 1;  5IUQ A;  1RB8 G;  5F2W A;  3U37 A;  1X9P A;  5D2A A;  1DGR A;  1QJY 2;  2XJS A;  4NIG A;  1QOT A;  1WZX A;  3MIE A;  2W87 A;  4YZ4 A;  4YVS A;  1PK6 B;  4AQ2 A;  5C8C B;  2A71 A;  2E31 A;  4ES9 A;  1JOJ A;  4AHX A;  3VHN A;  3NWK A;  4P9Y A;  1SDD B;  2VBD A;  5FCC A;  2PQS A;  3LF7 A;  1I5P A;  5FMB A;  4A6S A;  1APN A;  4IQP A;  1S0J A;  4XAC A;  5F6L B;  1QJU 3;  2QQN A;  1OA3 A;  4HK9 A;  4Q8L A;  1OQ1 A;  1UKG A;  4Q4Y 3;  3GCX A;  1UZ0 A;  1M4W A;  1HJG A;  4PI2 A;  3WQ0 A;  3PIJ A;  5F3G A;  2GH8 A;  1HQW A;  1ODM A;  3OCP A;  5KXE A;  2WAB A;  1B35 B;  4QX2 A;  5T5P A;  3T2T A;  1RGS A;  1W9F A;  2ORZ A;  2Z69 A;  3ILN A;  3UL2 A;  3F95 A;  1CZV A;  4AI9 A;  3WAS A;  1BKZ A;  5BNN C;  1IPK A;  1ENS A;  1AXZ A;  2XWJ B;  2H0B A;  4CTE A;  1LJ7 A;  4IES A;  5DUU A;  4FI9 A;  1WMD A;  2C4X A;  2OXB A;  1DZR A;  1JOD A;  1WUV A;  3H50 A;  4AI8 A;  5A70 A;  4KC7 A;  1WA4 A;  2VMF A;  1FMD 2;  2Y60 A;  4LA3 A;  4NII A;  5FZ8 A;  4LO4 B;  4YPJ A;  5T3N A;  4QPI B;  3K77 A;  5FJH A;  1NLR A;  4DXS A;  2WT2 A;  1GMM A;  1LOD A;  3ZFE A;  3K2O A;  2ETE A;  1V00 A;  1FT9 A;  1W8F A;  5DXD A;  3VZM A;  5LEK A;  4KC8 A;  2EA7 A;  3ZFG A;  1A78 A;  1W6O B;  4C90 A;  5BNP B;  3N36 A;  1YYN A;  2ATF A;  3CNA A;  3IIA A;  2IXL A;  4XFG A;  4Y4Y A;  1BMV 2;  4WM7 B;  3OD0 A;  2KR2 A;  2ZAB A;  2WT0 A;  4LHN A;  4M3C A;  2WWJ A;  5FYH A;  4J1W A;  5A3P A;  3FHA A;  1DYP A;  1ZBE 1;  5I93 A;  4IEX A;  1S0B A;  1U5X A;  4EN6 B;  4QB6 A;  4YNI A;  5EIY B;  2VZO A;  4KBB A;  4K1Z A;  5FMC A;  3U11 A;  2QQI A;  4Z8B A;  1DLL A;  1FNY A;  1VBB 1;  4UW4 A;  4QQ2 A;  1JYC A;  3I97 A;  5FY0 A;  2E7Q A;  3SH4 A;  4LLF A;  1I3H A;  4C0H A;  5KXB A;  3WMY A;  1MEC 2;  3TN9 1;  4NHL A;  4GH4 A;  4KI5 M;  3GM8 A;  4KNC A;  4S2G A;  2R0F A;  1SPP B;  3APB A;  1FPN 3;  1LU1 A;  1CR7 A;  4UDJ A;  4KU8 A;  2XPJ A;  4AVB A;  4ZPI A;  4A6O A;  4QDQ A;  3A23 A;  3NNM A;  5GZC A;  3WUC A;  5E89 A;  1C8M 1;  3H8O A;  1CQ9 A;  2WO3 A;  2P34 A;  1FOD 2;  1K12 A;  4HXC A;  4EWD A;  2GP5 A;  3LSD A;  2VUC A;  3IKW A;  3CJI C;  4RQP A;  2QQM A;  5DZG A;  2NQY A;  4D7Y A;  5CAZ A;  4DQA A;  1KS5 A;  1QJZ A;  4GWJ A;  5HI0 A;  1WKY A;  5HPO A;  1W9T A;  4MUV A;  4JTO A;  5AC9 3;  3W5N A;  4Y3O A;  2A6V A;  1R1A 2;  5FPL A;  2WQ8 A;  1DQ2 A;  1QF3 A;  4ZON A;  3S6P A;  5C3P A;  1UZY A;  3ZFF A;  2C0Z A;  2XLF A;  3AZZ A;  4J6G A;  4Z2W A;  2OKX A;  2VXR A;  4FQ4 A;  1RUG 3;  1RUI 1;  4S2F A;  2IVI B;  4YFZ A;  4B4P A;  4R9B A;  4GMP 1;  3UKV A;  4QPY A;  1VAM A;  3AZX A;  4JZR A;  3SCF A;  3DXU A;  5FZA A;  4YWA A;  5F3C A;  1TG7 A;  1K3I A;  4PQQ A;  1PGS A;  1LTE A;  1QXP A;  2UY8 A;  4LBL A;  4DY3 A;  2IXJ A;  5CG8 A;  2JIC A;  1D7P M;  4N53 B;  3C7E A;  4KGG A;  5EFU A;  3LDR A;  2CGP A;  1LOF C;  2BGO A;  3I2H A;  3CU7 A;  3ZYJ B;  3TEZ A;  1F5F A;  2Y6H A;  2GN3 A;  4IEP A;  3WHT A;  5J37 A;  4LO5 B;  2BWC A;  3ZYG A;  1H2L A;  1VAK A;  4LKS A;  4UW6 A;  3AC0 A;  1KXG A;  4QWN A;  1DQ1 A;  1BK1 A;  4DIQ A;  1URX A;  3ZYI B;  2ZX2 A;  3WCR A;  2Q8O A;  3BIW E;  4LTA A;  4Q4Y 1;  1S55 A;  1SZB A;  4AHY A;  1LGB A;  4UF0 B;  4QX7 A;  4YZ3 A;  4ORF A;  5A7O A;  3G7D A;  4PBO A;  4EWE A;  1TQ5 A;  3P3P A;  5A1L A;  5B4N A;  3U07 A;  1RUH 1;  5C4W C;  3BI3 A;  4JGZ A;  3CL1 A;  3IB3 A;  3OGS A;  3RI9 A;  3ZSL A;  4P9G A;  5JI7 A;  1ULC A;  2YBP A;  1LOA A;  4HKO A;  1QIQ A;  1AR8 2;  3Q8C A;  4BJ0 A;  2OYZ A;  1PNF A;  3UET A;  3CJI A;  3VBU A;  1ASJ 1;  4AEJ A;  3LFI A;  2WNU A;  3TEX A;  4D6R A;  2OVU A;  1W8W A;  1WW5 A;  3A0K A;  1B35 A;  2NZ9 A;  4DB5 A;  1HQN A;  2C9A A;  3VDC A;  5FMD A;  3LKJ A;  1K42 A;  3KD4 A;  1LHN A;  4K9S A;  3O0W A;  1GQP A;  2VOK A;  2YFU A;  3BPS A;  3Q8A A;  4I0B A;  1EAH 3;  3LA2 A;  1W06 A;  1YI7 A;  1ASJ 3;  2QNK A;  2VNV A;  2GU9 A;  1G86 A;  4YGD A;  3WAU A;  2JDN A;  2ZHM A;  1DCS A;  2ZGR A;  5KHJ A;  4HZF A;  4NAO A;  4B4R A;  2BGC A;  3M4F A;  1UY3 A;  2PMW B;  1RL3 A;  3MW3 A;  3POE A;  5FIX A;  2JDY A;  4TZD A;  3N7L A;  4H7M A;  1UAI A;  3OOX A;  5GLW A;  5T50 A;  1BMV 1;  3VSF A;  2CYF A;  2DF7 A;  1VRH 2;  3SIT A;  1O4Y A;  2W9X A;  2WZR 1;  4HFS A;  4COV A;  1DF0 A;  3J8F 2;  1H1A A;  3CHX A;  4K40 A;  1ZM1 A;  1LOE A;  5DUW A;  3Q9O A;  5F7U A;  4B7E A;  1EV1 2;  4KWU A;  3U75 A;  4NRQ A;  3AKI A;  1KD7 A;  3H3L A;  1AL2 2;  4PIZ A;  1W8O A;  2XLA A;  1O5U A;  2E7A A;  3CBN A;  3OBR A;  3OY8 A;  4PLM A;  3OYW B;  4QPG B;  1RUG 2;  5C8W A;  3JU9 A;  5IVV A;  5K0U C;  4KCA A;  1ZZ7 A;  2A6Z A;  3GZE A;  3FFQ A;  2D6N A;  4AK3 A;  4CRQ A;  2Y0O A;  2ZTN A;  3LQC A;  1AYM 3;  1PX3 A;  1TEI A;  2YXS A;  3I2F A;  4YFW A;  1WGP A;  3T08 A;  3WDW A;  4AOC A;  1N3O A;  1KIT A;  3AP5 A;  2CGO A;  3PJQ A;  1RUF 1;  1WCS A;  4A7K A;  2D93 A;  5EYX A;  5I91 A;  1RUO A;  2K46 A;  2PHL A;  4CSW A;  1I5Z A;  4LBQ A;  1WA6 X;  2Y64 A;  1QQP 1;  2Z5W A;  4XHX A;  4LHS A;  3T4H B;  1JOP A;  5CB7 A;  4JKL A;  5A6Y A;  1OVP A;  1XXN A;  2VZQ A;  5HCB A;  3GF6 A;  4Q4V 1;  3DF0 A;  4CCC A;  4MXV A;  2LTN A;  2DCY A;  3VBS A;  4UXA A;  4ASM B;  4E2Q A;  2V09 A;  5FZO B;  4CDW A;  5A6X A;  4GWN A;  2RS1 2;  2WKK A;  4BQ5 A;  5AC9 1;  4C0B A;  2ZA9 A;  4XJ8 A;  4AFB A;  5GLQ A;  4UWD A;  1AR6 3;  3ZDS A;  5L73 A;  1UIJ A;  4CP0 A;  3KV9 A;  5EJ1 B;  3KLS A;  2J1E A;  3NJY A;  1OLR A;  2EAA A;  3K1U A;  4MXW B;  3SIS A;  4W6Y A;  3WD5 A;  1AR9 3;  4WVM A;  2O8Q A;  1IS3 A;  1DGL A;  2P1B A;  3LEK A;  3SHR A;  4KH9 A;  5C6C A;  1LEC A;  1LU2 A;  4OHZ A;  3DKW A;  4WM8 B;  4BLI A;  2WJS A;  1VAV A;  3LPG A;  4YLZ A;  1YFU A;  2JJ6 A;  3O14 A;  1RJ8 A;  5FPX A;  2ZZQ A;  4XUR A;  2VM9 A;  1YQ2 A;  4PBP A;  4RGG A;  2SLI A;  1UYP A;  2K9Z A;  1J58 A;  1IQD C;  1YQ6 A;  4HOO A;  4EYU A;  2DFB A;  4PVA A;  1F15 A;  2GH2 A;  4J1X A;  3AB0 A;  2RMU 1;  3B9C A;  1DIW A;  2R6Q A;  2ET7 A;  5FY4 A;  4ASL A;  3RWN A;  4BA6 A;  1EV1 3;  3CIH A;  1UY2 A;  5A3O A;  3VKL A;  4XTP A;  4A2U A;  1WBL A;  2VCB A;  3KGL A;  4GWI A;  3K4D A;  2EIC A;  5IVF A;  4Q4Y 2;  1BEV 1;  3JD7 2;  2OS2 A;  4YAR A;  1Y7B A;  4Q4X 1;  4YVW C;  4XIL A;  3FBY A;  1KJR A;  4CEW A;  2B46 X;  2G4I A;  1XNC A;  1UX6 A;  3GYD A;  4HON A;  2VE1 A;  5FBZ A;  3KS7 A;  2CSG A;  2E51 A;  1R1A 3;  3NNF A;  3V65 A;  2ILM A;  1D4M 1;  4UF0 A;  2VCC A;  4NID A;  4IEU A;  3VDD C;  1RHI 3;  4GKY A;  3C8X A;  4RR3 A;  2KD7 A;  2W3J A;  3ETP A;  5A7Q A;  5IWF A;  2OUH A;  1UU6 A;  3RZZ A;  3W59 A;  2B9V A;  1SCR A;  4O61 A;  1YQ8 A;  2D7F A;  2VAU A;  4EE2 A;  1PIV 2;  3M2M A;  2R0H A;  3BYJ A;  2FCT A;  3WF0 A;  2HLE A;  1FOD 3;  4XMA A;  2BYV E;  1RUI 2;  1OH4 A;  1MS1 A;  1OLM A;  4D7T A;  3VSZ A;  4YM2 A;  1QQP 3;  3LEG A;  2JDU A;  3MYX A;  1VB4 A;  2FMD A;  4XFH A;  2H0V A;  3SCH A;  3BPZ A;  2QQP A;  2YBK A;  3LEM A;  1RXG A;  4DRR A;  2BWA A;  1LR5 A;  1QOS A;  2RM2 3;  4I01 A;  3DL3 A;  4O9E A;  2JWP A;  2K0G A;  5F5C A;  3ZM8 A;  5FK7 A;  3Q8E A;  1AJK A;  3FUQ A;  4JKK A;  2VZT A;  1PZ8 A;  1OI6 A;  4L97 A;  3NAP C;  5GLU A;  1H30 A;  5F8P A;  3ACH A;  5BNN A;  2MPF A;  4YW4 A;  5EJ3 A;  4E27 A;  3S7E A;  1ZYB A;  4AG4 A;  1AL2 1;  2YC2 A;  4I3P A;  4CCO A;  1UXX X;  2QQJ A;  2HWF 2;  3B9I A;  2D6M A;  3NJZ A;  3R4D B;  4YW5 A;  1GNZ A;  4GB3 3;  1ZRF A;  5T5O A;  1HB4 A;  3SEE A;  4ZU4 A;  3AKP A;  3I3D A;  3DPR A;  4RHV 3;  5FMO S;  4ONZ A;  2J42 A;  4PF1 A;  4EZH A;  2IXH A;  2GSY A;  2VZR A;  3NVC A;  4HLT A;  1AR8 3;  3N9L A;  4OUM A;  2P3I A;  2WNE A;  4BQ2 A;  3O1T A;  3QC2 A;  1MEC 1;  4IE4 A;  4NO4 A;  4Z1V A;  1JYN A;  3O0X A;  3SH3 A;  3WN2 A;  1JXN A;  1RUJ 1;  4W6X A;  4SLI A;  1WCQ A;  4UAP A;  3PUI A;  1KQR A;  2A6X A;  3ASI A;  3N35 A;  4H14 A;  4XZU G;  1UOG A;  5K8S A;  2XGX A;  4OHV A;  2Q30 A;  5FYM A;  4R4Z A;  4M0H A;  2QJV A;  2RM2 2;  1D2Q A;  3NNG A;  1JW6 A;  4AGV A;  4R52 A;  3ORJ A;  5EQU A;  2D5H A;  3VT2 A;  4GB3 1;  1O4Z A;  4BLJ A;  3TNP B;  3D60 A;  1L3J A;  1QGL A;  3AKR A;  5JI9 A;  4W4Z A;  3GNE A;  3UJQ A;  4Q4W 2;  3H3U A;  3IDA A;  2MEV 1;  2WS9 1;  3I2J A;  1AVB A;  2WNU B;  1NA1 B;  5CIR A;  5K4L A;  2RG4 A;  4LO6 B;  3VZJ A;  4CU7 A;  2UWA A;  4M3C B;  4X6R B;  5CKM A;  1NA1 C;  3EBR A;  3ZMO A;  2I07 B;  4L92 A;  3WDT A;  1OOP A;  3HIF A;  1FAT A;  4NRP A;  1IQA A;  1F2N A;  1VBA 1;  2FHR A;  4IGO A;  3H8R A;  2EAK A;  4G9S B;  2X53 S;  4HET A;  3ZXK A;  3FLP A;  2W68 A;  4LBQ D;  3O1V A;  3FWE A;  4CDX C;  1GQH A;  4BQ3 A;  1S2K A;  4YZ2 A;  2WNV B;  4NWV A;  1Z0H A;  3VBS C;  5CKN A;  2Q4S A;  2C9K A;  3O1O A;  2VW2 A;  4ZS3 A;  2Y38 A;  1PT2 A;  3UGH A;  2O0O A;  1W8U A;  3AZW A;  1W2N A;  2WZ8 A;  4JHT A;  5C70 A;  5F3I A;  4YG0 A;  5L7O C;  3FN9 A;  5FPU A;  3HQR A;  2GN7 A;  3E6B A;  2D43 A;  5L7O B;  1HV0 A;  2Y6G A;  1AR7 2;  4TXW A;  1MR5 A;  5DZE A;  1YO8 A;  3ZN4 A;  1OQD A;  1UF2 C;  5A33 B;  1R09 2;  4S2D A;  4PDW C;  3TN9 2;  3O1P A;  1REE A;  3ZYP A;  5A8D A;  2YZ4 A;  3GJB A;  3HBK A;  3KV4 A;  4CXW A;  4PQ9 A;  3KT7 A;  4XFA A;  1RTV A;  1VBC 1;  4FPJ A;  1RUD 1;  1K45 A;  5LRS A;  3AZY A;  3USU B;  1VR3 A;  5JOX A;  1CON A;  3J7M A;  4V2W A;  5GZG A;  3AKH A;  2VVF A;  2WAO A;  1Q8V A;  2VY0 A;  1JBC A;  3RYP A;  4TYS A;  3W58 A;  5FYZ A;  5C5T A;  1YCI A;  1X8E A;  2R16 A;  4P9W A;  3NKT A;  4M0N A;  5DAX A;  4CDU B;  1EV1 1;  1PK6 A;  5GKA C;  5BNP C;  5DDJ 2;  4W50 A;  4JKM A;  1UZW A;  3I3B A;  1IS4 A;  2DTY A;  4A3Z A;  1YFW A;  4FPY A;  4P5H A;  4RN5 A;  3OPW A;  5DG2 A;  1LOG A;  3PIG A;  4XMI A;  1W3V A;  5FPV A;  3N3H A;  4LEJ A;  3C7F A;  1LHU A;  1DGW A;  2AAC A;  3WAT A;  3SLI A;  3K4Z A;  5G05 L;  4H3W A;  2BNN A;  3I59 B;  3DEM A;  3TBD A;  4RFT 0;  1VBE 2;  4FOW A;  1QJU 2;  1R08 2;  4LBM A;  3AFG A;  1OT5 A;  3TN9 3;  4FFG A;  3H0O A;  3IPV B;  2PYT A;  1MPX A;  1N1V A;  3R05 A;  1TMF 3;  1HXS 1;  3ZXF A;  3TEW A;  3PVB B;  1N3Q A;  3VDD B;  3NQH A;  2XL7 A;  4NE9 A;  2ZGO A;  3LWC A;  2RDQ A;  4NRM A;  3PDQ A;  1W6M B;  5FY9 A;  1G7Y A;  4FFI A;  2WFP A;  4MGI E;  5A3U A;  5A7P A;  1JU4 A;  3K4A A;  4QPI A;  1O6U A;  2ET1 A;  3CEW A;  1VBD 3;  4F7Z A;  5LY1 A;  3WOG A;  4N2Z A;  2OW4 A;  1HQL A;  2G9F A;  3AMN A;  3H7Y A;  3K75 B;  4QHO A;  5A32 B;  4A42 A;  1GZC A;  3J9S A;  2WZE A;  3CJI B;  3GZA A;  4Q0U A;  4JQR A;  3GJA A;  4HVQ A;  1V6N A;  1NCR A;  3WUD A;  4DPN A;  2JX9 A;  2QQU A;  1VMF A;  3PUS A;  4CPB D;  3QBQ A;  5E1R A;  1RED A;  3T4V A;  4NOT A;  3BGA A;  1IS6 A;  5EXO A;  1CX1 A;  4Q0P A;  5C3R A;  4D7S A;  4QDR A;  3D3A A;  2JDM A;  1BBT 3;  3EYP A;  3RI8 A;  3IBM A;  4AED A;  2XML A;  4L9B A;  1W9S A;  4LE3 A;  4AZZ A;  4UDI A;  3CO2 A;  1N47 A;  1JU3 A;  2AUY A;  3PU8 A;  4QGM A;  1AX2 A;  1Z7S 3;  3VDA A;  2DBI A;  1ND3 C;  1VBD 2;  1QMJ A;  2CGN A;  1TL2 A;  4MLO A;  2D44 A;  2FDI A;  3AX4 A;  4W65 A;  5D1I A;  4KWL A;  3WVJ A;  2VZ3 A;  3L2Y A;  4P5Y A;  1UCX A;  1UL9 A;  3BU7 A;  5C3O A;  3MF9 A;  4NUB A;  2QDR A;  1ZA4 A;  3GZT B;  1RMU 1;  1CAX A;  4CCE A;  2UY9 A;  4BE3 A;  4N53 C;  4IW3 A;  2HEY F;  2J1T A;  5A3W A;  4BXF A;  2J1U A;  2JB4 A;  5APA A;  2WO2 A;  4YW7 A;  4Y4R A;  3GDB A;  2MHF A;  1TNR A;  1WMF A;  1S1A A;  2VH9 A;  4ET7 A;  4L8Q A;  5F5A A;  4IEO A;  1QNW A;  4FSJ A;  4QPG A;  4ISR A;  4BZ4 A;  1N1T A;  2OQ7 A;  3B5L B;  4MVT A;  5FMO L;  3DYP A;  1GV9 A;  3O1R A;  4C1W A;  3LIH A;  2WZR 2;  3BOP A;  4LK7 A;  5AYE A;  3HBZ A;  4CVU A;  3H1M A;  5C4W B;  1RUD 3;  2DVA A;  2ZEX A;  4JGY B;  1NYW A;  2E6V A;  1BCX A;  4YYO A;  4AQ6 A;  1FMD 3;  2GAL A;  2ARC A;  4UFI A;  3T0B A;  3KZ4 C;  2BOI A;  2WYS A;  3A21 A;  5C2M A;  2JKB A;  3CQO A;  4AE2 A;  5IJR A;  3VKM A;  2W1Q A;  4OHX A;  3BKZ A;  4QT6 A;  2J1R A;  5J48 A;  2VBB A;  1J3P A;  4P00 B;  1C28 A;  1DYO A;  1PX4 A;  3AMM A;  4N43 B;  2PHD A;  4E2G A;  2FDG A;  1L7L A;  3T0D A;  4GMP 0;  2WYF A;  2XJV A;  5DQ0 A;  1WBF A;  2IWG B;  1RYY A;  3MPB A;  3N7K A;  1QQP 2;  3R4U A;  1PVC 1;  4N7U A;  4XDO A;  5BNO A;  4XUP A;  2WRA A;  3ZKY A;  4HSL A;  3WNP A;  4PDW B;  5CFD C;  4EN0 A;  3WXP A;  1UXZ A;  4BQ1 A;  1PO1 3;  2TNF A;  1ZRE A;  2WL1 A;  3CKH A;  3ZXG A;  3HMY A;  5L9B A;  1YC6 1;  5ABJ B;  1H2K A;  3USU A;  3WMZ A;  2HWD 1;  2MEV 2;  2WS9 2;  4D6S A;  3SCG A;  1O4T A;  4OYU A;  1EPZ A;  1GWM A;  4XFB A;  3PTR B;  1POV 3;  2F4P A;  3B7M A;  2LM3 A;  2GNT A;  2R1B A;  3MIF A;  3LOI A;  2B4K A;  4Z92 B;  1HRI 1;  4EZ4 A;  4IE6 A;  3GGL A;  2B9U A;  2BFU S;  2XJQ A;  1GNY A;  1W6Q B;  5I0U A;  4XZP A;  2H6C A;  5DMY A;  5GJ6 A;  2HEV F;  3ZXJ A;  4AR2 A;  3ACG A;  1D0H A;  3VZN A;  1NOV A;  2TUN A;  4URT A;  1WLC A;  2PTM A;  2AC1 A;  3SXW A;  5A80 A;  2VOW A;  1VRB A;  2YU1 A;  2ZZJ A;  1PNG A;  2VNO A;  1BVV A;  1RUJ 2;  2W39 A;  4MYE A;  2FZ1 A;  2WII B;  4Y1Z A;  5A7N A;  3MPP G;  3OUJ A;  3VBF A;  2VOV A;  3J8F 3;  1H6Y A;  2WFF 3;  4UOJ A;  2E7T A;  5BNO B;  1DYK A;  1D4M 3;  1FMD 1;  2XOM A;  2WDB A;  4E8D A;  5FZ3 A;  2HWB 3;  4OQ9 A;  1JHN A;  1JZ5 A;  4LA2 A;  1Q8Q A;  1ULF A;  4OZX A;  3O1U A;  5FR3 A;  4ASK A;  3MLL A;  3LAG A;  1R64 A;  3WW1 A;  1UY4 A;  3VKN A;  3BU0 A;  3SQO A;  1PO2 3;  4KQ7 A;  4O8O A;  3PVN A;  5KXC A;  3OM7 A;  5LWB A;  1NZC A;  5I8S A;  4M3C E;  4Y1X A;  4AEM A;  2WO7 A;  3FL7 A;  1AHS A;  4EV0 A;  1C1F A;  3HNY M;  5FP7 A;  2I45 A;  2A1X A;  2QDN A;  4AVC A;  5EZW A;  3WNX A;  3VKF C;  3FMG A;  1C8M 3;  4ZS2 A;  2XXZ A;  4M3C F;  4XAE A;  1OD5 A;  2PA7 A;  1T6G C;  5T54 A;  2HWC 3;  2GP3 A;  3H3Z A;  5DUX A;  1DG6 A;  2W92 A;  1I9R A;  4OFG A;  3RMX A;  5LA9 A;  3VBH A;  4MGY E;  5LBF A;  3D5Z A;  1IPJ A;  3ZPO A;  4NAM A;  1XND A;  2VL4 A;  4IGP A;  4XF1 A;  2VXJ A;  5FUI A;  5FYS A;  1W0N A;  4Y20 B;  3UGG A;  5B2G B;  1IOA A;  2VQU A;  5DDJ 1;  1MS9 A;  1JYW A;  2Y6F A;  2DBN A;  4AHZ A;  1OA4 A;  1NLS A;  3ATG A;  2WZP P;  2KXL A;  4MH0 E;  4XF0 A;  2WFF 2;  2HYX A;  3LSE A;  2J1V A;  2JG9 C;  4TLG A;  5LAT A;  1ENR A;  1WWY A;  1ALY A;  1CAW A;  3I3Q A;  1K5M A;  2YFS A;  3ROU A;  4ZY9 A;  3U4S A;  2EIG A;  3MV0 1;  3H1W A;  4BME A;  2ARX A;  2ZAH A;  3DYO A;  4LBQ B;  2ZCW A;  2Z4F A;  3I7D A;  1YI9 A;  2F6B A;  1AXY A;  2YC0 A;  3LEI A;  3M3C A;  4AVV A;  4DIN B;  5FAX A;  5A3T A;  3HNM A;  5ACA 2;  4KMQ A;  3HAG A;  2R7E B;  3GHM A;  1VE0 A;  2DFC A;  5FV3 A;  1AYM 2;  1LHW A;  1Q5O A;  3RZJ A;  1XOY A;  1D4V B;  4XUN A;  2YPJ A;  2Q1Z B;  2AZ5 A;  3R67 A;  2VNG A;  2ZGQ A;  4QXB A;  1H2N A;  1LOF A;  5FYY A;  1RUC 3;  2JEN A;  1R1A 1;  1UMZ A;  1CAU B;  1ND2 B;  1QH7 A;  1GU3 A;  2D6L X;  2VZS A;  4V1P A;  5A33 A;  5IVY A;  4FOV A;  5IFT A;  5J36 A;  5ISL A;  3DN7 A;  1ND3 A;  4HPK A;  4PCR A;  4WM7 A;  4BQ4 A;  3TEY A;  3OY8 B;  2DUR A;  4UW3 A;  2YBS A;  4JV4 A;  4PIX A;  4BDV B;  5FY8 A;  4XAB A;  1D0G A;  5DAQ A;  4P9X A;  1CPN A;  3CZJ A;  4PLO A;  2PHR A;  2J1S A;  4K21 A;  5GLL A;  4OUS A;  5ACA 3;  1U5Z A;  5DPN A;  3UKT A;  3MLJ A;  3BTX A;  1RJ7 A;  5FPB A;  2VVE A;  3ZFE C;  4RS5 C;  5E88 A;  2D6O X;  1G9D A;  1GWK A;  5FLW A;  2VPV A;  2PLV 2;  1LEN A;  2NN8 A;  1CPM A;  5L36 A;  1LAJ A;  2BQP A;  1C5I A;  1QJU 1;  1XU1 A;  3VBU C;  3Q8B A;  5JOZ A;  1XB9 A;  3WN1 A;  1JTZ X;  2R06 3;  3HQX A;  3T2O A;  4C1X A;  4IDZ A;  5FWE A;  1RUD 2;  1VBE 3;  4E2S A;  3AJZ A;  4XXP A;  4PT6 A;  4QX8 A;  3VD5 A;  1SFN A;  1W9Y A;  3LFM A;  1GBG A;  3WDX A;  2JG9 A;  2LAL A;  4IEW A;  1RIN A;  4E4S A;  4ERO A;  1COV 3;  1H8T A;  2P3K A;  3BB6 A;  1ND3 B;  4HPK B;  5IK4 A;  3BAL A;  5F32 A;  3INA A;  3ZSJ A;  5KC6 A;  2X8S A;  4MX3 A;  1QWR A;  5AY9 A;  1W2T A;  3VBR B;  1EAH 1;  1FI2 A;  1MEC 3;  3AYD A;  3KHB A;  2Q1M A;  3GHN A;  2VJX A;  5GLT A;  4ARY A;  2CY6 A;  3MV1 1;  1F9K A;  4ITC A;  4XBN A;  5FZH A;  1R1Z A;  3VZL A;  4A44 A;  1RUE 2;  3S57 A;  4CUG A;  1V6L A;  3UK9 A;  1G9C A;  4QM8 A;  2P2K A;  3LGR A;  5AVA A;  4E8C A;  5JXI A;  1EUT A;  3B94 A;  3E5U A;  3D6E A;  4I3G A;  3RZL A;  1ND2 C;  4PF5 A;  1F8V A;  4CCJ A;  4AAP A;  1SLT A;  3AKT A;  5JXG A;  1MS0 A;  1PK6 C;  1YEW A;  5FXW A;  1RIT A;  4ZU5 A;  5A7V A;  3ZSM A;  3C2U A;  4FPH A;  4LK6 A;  2DU0 A;  1R09 3;  1U0A A;  4FOY A;  1Y3T A;  4FVV A;  2QQV A;  1RMU 2;  2Y0I A;  2W0X A;  2HWD 3;  4AEK A;  1QJY 1;  4QU2 A;  1OOP B;  4AVT A;  5C9A C;  5B6S A;  3DPR C;  1AYM 1;  5F5I A;  3PJY A;  1UMI A;  1H8V A;  2BV4 A;  2W1W A;  1SBF A;  3VBR A;  1O59 A;  3RZG A;  1V6K A;  5JMC A;  2EXJ A;  3WNO A;  3GBG A;  1DQ4 A;  4P9I A;  4QU1 A;  1US3 A;  4NJ4 A;  5LZ6 A;  2JD9 A;  1BHG A;  2XVL A;  4B8E A;  2JKX A;  4QKN A;  4A7Y A;  1ASJ 2;  2IZW A;  5GZF A;  2H6B A;  3E1F 1;  3WW4 A;  1WCK A;  3ITQ A;  4ZXK A;  3RPQ A;  3WF2 A;  4DEQ A;  1S0F A;  3VBO A;  3JCI A;  3OUH A;  2ZMK A;  2XL9 A;  2ZX0 A;  2VNR A;  4FP2 A;  4HL0 A;  1NXD 1;  4MGS A;  4QQH A;  2X10 A;  3AXE A;  1GOH A;  1YIF A;  3AL5 A;  3MIG A;  2XH6 A;  3UGF A;  3OM2 A;  2E53 A;  3USS A;  4QX1 A;  1GP5 A;  1H4H A;  2JDZ A;  4DUX A;  3U0Z A;  2XKP A;  4XUO A;  2YG0 A;  4OCT A;  2XBO 2;  5IVC A;  3JB8 A;  3CDZ B;  3KMH A;  1FPN 2;  3F2Z A;  1K5M B;  1OQE A;  4YM0 A;  1CZS A;  1K5J A;  1GYE B;  3C7H A;  3ZVX A;  5CNA A;  1IZ3 A;  1VBE 1;  2D3S A;  2G9G A;  3I8T A;  2RHP A;  2HJI A;  2G9Z A;  2XVG A;  1UYX A;  4RFR B;  3VD3 A;  4A3X A;  1HIX A;  5B6T A;  2NYY A;  2YMZ A;  3LA7 A;  4GAZ A;  4XUQ A;  1VBC 2;  4FXG B;  4XFC A;  4Q0S A;  2P6C A;  4XHB A;  4XJW A;  4XIK A;  3KVB A;  2NMN A;  3V0B B;  4XF4 A;  2JDK A;  3CZU A;  1CAU A;  1G9A A;  1XJA A;  1JH5 A;  5EWS A;  1TE1 B;  1SAC A;  2QFE A;  3EJK A;  3J7H A;  3ZFG B;  1K5M C;  1W6O A;  2CDP A;  4H55 A;  5C71 A;  4IEY A;  5CFC C;  4QHZ A;  3KSC A;  3WX5 A;  1QKQ A;  2VZV A;  4PDW A;  1AR9 1;  1W04 A;  3WZ1 A;  3ZFG C;  3S5Q A;  3ZIX A;  3AVR A;  3TAW A;  3VLB B;  5IAT A;  1KDM A;  1LCL A;  4NPM A;  3VHO A;  3ES1 A;  4BH9 A;  1RUC 1;  1XYO A;  4Q4V 2;  1EP0 A;  1T6B X;  3NNL A;  5FP4 A;  5FYU A;  3OM5 A;  2RDS A;  4XE9 A;  3VDD A;  1GOF A;  3ABZ A;  1RUE 3;  3WV6 A;  4AQT A;  4CDQ A;  2E9Q A;  5C0P A;  4EN9 B;  2XON A;  4RR3 B;  1KRI A;  1VIW B;  3NRU A;  3I3E A;  2BJS A;  4HBN A;  5FRA A;  2CWS A;  1C57 A;  4GMP 3;  1WME A;  4Q4X 2;  5FDB A;  5JWP A;  5GLN A;  3OGV A;  1NY7 2;  2R04 3;  2UU8 A;  5BNP A;  2DUP A;  2YRO A;  5FZD A;  3N7J A;  4XF9 A;  5TSW A;  3OPT A;  2ERF A;  2B45 X;  3ES4 A;  3D0S A;  2JG9 B;  2XUE A;  1GP4 A;  1W8T A;  3MFC A;  2ZGL A;  3P5B A;  4YM3 A;  1RUF 3;  1ZRI A;  2FQP A;  4FPO B;  3K48 A;  5K7P A;  4XDQ A;  4CCK A;  2XQX A;  3O5S A;  1RUE 1;  2XB6 C;  1E5H A;  2ZHN A;  1L7R A;  4BOW A;  3N9N A;  1Q8O A;  4RS5 A;  3NST A;  4NOV A;  3ACI A;  3C7O A;  1POV 0;  1W99 A;  3GXU A;  4FBF A;  1NAE A;  1OPM A;  5FZG A;  1AF9 A;  2JDA A;  4I2O A;  1HDK A;  4GH4 B;  1JUH A;  3IN9 A;  4LIT A;  4DXZ A;  2X8T A;  4WVV A;  2NPI A;  1QJY 3;  1CVN A;  3MO4 A;  5FXV A;  2CWM A;  3O0V A;  5FO8 B;  5J3U A;  1V6I A;  1IKP A;  4I09 A;  3ZR6 A;  4YVS B;  4JAA A;  2RJL A;  2XG3 A;  4MLG A;  1FPN 1;  1MAC A;  2TEP A;  4U36 A;  1A6C A;  2DTW A;  2RDN A;  3E6C C;  1V6O A;  3U78 A;  5CFC A;  1QJF A;  1QXR A;  2HH9 A;  2ZHK A;  4Q5O A;  2Y8K A;  1LKN A;  1YWK A;  1LGN A;  2PLV 1;  1MZF A;  2EID A;  4NN0 A;  3VV1 A;  3WEZ A;  4YRD A;  4CP2 A;  1VBB 3;  5FZ6 A;  5ABJ A;  5I8T A;  3RZM A;  3KST A;  2F4L A;  2OT7 A;  1UV4 A;  2ZMN A;  2HWB 1;  4O8P A;  1HN0 A;  1VRH 1;  1SEF A;  2QTW B;  4AVA A;  1YFY A;  1WLW A;  2B39 A;  5AYD A;  1C8M 2;  1ZBA 2;  1LEM A;  4JGY A;  5JCT A;  5KBF A;  5FKC A;  5F2S A;  5GLK A;  3ZLI A;  1TME 3;  5FXX A;  4JCK A;  1J83 A;  1E5I A;  5K9Y A;  1A34 A;  1ZNP A;  1HJF A;  1PIV 1;  3GBW A;  2ZML A;  2QQW A;  2D6P A;  4Y22 B;  4HN0 A;  2QQK A;  4DZG A;  2WR9 A;  3LDK A;  3R4Z A;  4BIF A;  5C33 A;  4CE8 A;  1NE6 A;  1G8W A;  1PHM A;  5A7W B;  2DVG A;  1SBD A;  1WLD A;  4H7L A;  4OVE A;  1GQG A;  4OZO A;  1NA1 A;  4UFJ A;  3AJY A;  1W6N B;  2CAV A;  2RE9 A;  3WNM A;  3WPV A;  1DQ6 A;  3PUQ A;  4I30 A;  3E97 A;  2ZS6 B;  5F3E A;  2HWF 3;  3KCY A;  3VBH C;  5DAV A;  1NCQ C;  1IG3 A;  1U5I A;  4FPK A;  3ACL A;  3BUC A;  2W2I A;  5F39 A;  2RR1 3;  4RL7 A;  1VB2 A;  1DLC A;  1Q43 A;  1VP6 A;  1WLT A;  2GNB A;  2VG9 A;  3AMH A;  1JUI A;  4YGC A;  5IFP A;  2WNU C;  3A0N A;  2RR1 1;  2VGD A;  4LBJ A;  1KDK A;  2I74 A;  3LZZ A;  2IC1 A;  2UYA A;  3RQ0 A;  4IEZ A;  5B4X A;  1OMI A;  1B35 C;  1ZZC A;  1SQ4 A;  3ZSK A;  2HWF 1;  5FP9 A;  5EHD A;  1AJO A;  1SHW B;  2BVV A;  1Q56 A;  3DUI A;  3IMN A;  5T5L A;  2YPD A;  5HXM A;  5BNN B;  2BUK A;  2D98 A;  4EN8 B;  1CAX B;  5H9R A;  3TB0 A;  1FYU A;  3D82 A;  1V0A A;  2LW8 A;  2X29 A;  1OLM E;  1Q8S A;  3KF5 A;  4ARX A;  1RUI 3;  4Y20 A;  5FY5 A;  4AL9 A;  5ABJ C;  1BVP 1;  4BHP A;  4A41 A;  2XHK A;  5JOY A;  1PGL 1;  1PIV 3;  2X5I A;  3CU9 A;  2ARA A;  2RDR A;  2RS3 3;  3MDP A;  3NV1 A;  3MUY 1;  1Q8P A;  5EYY A;  5FZ7 A;  1YQ5 A;  3WG4 A;  3DKQ A;  4DMI A;  1I1E A;  2NM1 A;  3WN0 A;  4PHZ A;  1SLL A;  2JIJ A;  2ZXQ A;  1QOO A;  2D6K A;  1JZ8 A;  1UYY A;  3SKV A;  5HXV A;  3N7M A;  5JXH A;  2YGM A;  3AFK A;  4YG3 A;  2VME A;  3HEI A;  5T55 A;  2E32 A;  4GQ7 A;  4CUA A;  2OQ6 A;  5FYV A;  2ZX1 A;  3WPZ A;  1OFN A;  3S5A A;  1W6P A;  3ZYB A;  1GP6 A;  2GMM A;  4P9L A;  4MGQ A;  4MAD A;  4MHU A;  4NPL A;  5L9R A;  5LRR A;  4OLL A;  1LRH A;  3WDY A;  5JUV A;  1UY1 A;  1OUR A;  4JDM A;  1TMF 2;  4BWO A;  4COZ A;  3S0M A;  5C9A B;  4AI2 A;  1NZI A;  3N9M A;  3T3Y A;  5FUP A;  1EUU A;  1R08 3;  2R07 3;  2XR4 A;  3AMP A;  4MOA A;  2ZOE B;  4NHM A;  1JYX A;  4FPC A;  1HB3 A;  1X82 A;  4CDW C;  1L7Q A;  2VD7 A;  4QX3 A;  5FLI A;  5F5Q A;  4Y24 A;  5FPA A;  1AR7 3;  1AXK A;  3OM6 A;  2HWC 2;  1PZ9 A;  2ADD A;  2ZBJ A;  4MHR A;  3OGG A;  3D61 A;  5JPN B;  2VCA A;  4MZU A;  2PHT A;  4MV2 A;  2WA3 A;  2A70 A;  3MW2 A;  1F31 A;  3HOB A;  1H8T C;  3RGB A;  4AGG A;  4BQW A;  1XPW A;  2D40 A;  2VTX A;  3HT2 A;  3E5X A;  4QPI C;  4UFK A;  2NLR A;  4MO3 M;  2DCK A;  4MGK E;  4IV1 A;  3PHM A;  3VSS A;  5LY2 A;  4K1Y A;  4OUL A;  2HWE 3;  4GKX A;  5LW9 A;  2P5B A;  4XFI A;  4CPB A;  4KL1 A;  3KT4 A;  2R04 1;  5L9V A;  4HVO A;  2PXJ A;  1UNB A;  4N43 A;  1SPP A;  2IVJ A;  1V9U 2;  4NWW A;  3ZOI A;  4RYD A;  4AVS A;  2P17 A;  5T5J A;  1BK0 A;  5SV5 A;  5CFC B;  2YU2 A;  2HWE 1;  2JDP A;  1MZ5 A;  1BXH A;  2ARE A;  1VJ2 A;  1ND2 A;  1I6X A;  2ZGT A;  3T1M A;  4OQ8 A;  4A7Z A;  1QU0 A;  1HRV 2;  3PUH A;  1C4R A;  4LOT A;  4CXX A;  3VDB A;  1JYI A;  2D3R A;  3D4K A;  4JC1 A;  1W18 A;  4CXY A;  4U6D A;  2DWR A;  3L9J T;  2XUM A;  3WF3 A;  1DBN A;  5FXZ A;  2P3Y A;  4IER A;  3IT8 A;  4WM8 A;  4X8N A;  3WLU A;  1N1Y A;  3WP5 A;  1LHV A;  1XE7 A;  4XF3 A;  4QQO A;  5FYC A;  4AK5 A;  1TVG A;  1V6J A;  1Z78 A;  1OA2 A;  3VUO A;  1RVF 2;  4CZS A;  2R07 1;  3LA3 A;  2VZP A;  4LXL A;  3C7G A;  1WW6 A;  1XNK A;  2PHU A;  3MLK A;  2G1M A;  2YUE A;  2WO1 A;  3WG2 A;  1XNB A;  1RUN A;  1PO1 2;  4HVR A;  1JYV A;  4OUE A;  4RSU A;  4TTG A;  4URA A;  1UZZ A;  1W6N A;  2XLG A;  3KM5 A;  2W46 A;  3OGJ A;  1RUC 2;  1D2S A;  1YUD A;  5J96 B;  2X8F A;  2RJ2 A;  4JX0 A;  2SBA A;  1HB1 A;  4P14 A;  3I2G A;  2BBV A;  4GJZ A;  1AUY A;  2FCV A;  2QZ2 A;  1H8T B;  2WIN B;  1LOB A;  3D8C A;  4GB3 2;  3UKN A;  4AYU A;  4UFM A;  4CCM A;  4YVW B;  2VZU A;  3QH6 A;  1WMX A;  4E9K A;  2VR4 A;  4K3U A;  4R9A A;  1W05 A;  3WNN A;  5LK5 A;  5JZG C;  2DCZ A;  4AFM A;  3I2K A;  1E57 A;  4BU2 A;  4IV3 B;  5DAB A;  3R0R A;  1S4C A;  1COV 1;  4AW7 A;  3E6D A;  4P9J A;  1XQN A;  5BV6 A;  4COT A;  1Y9Q A;  3O1M A;  3URF A;  3VGI A;  3JB4 C;  3RG0 A;  2O1Q A;  2E33 A;  4NPR A;  3H7J A;  2WNV C;  3VBH B;  4FCA A;  1TZO A;  3NAP A;  3Q8F A;  4I02 A;  1NCR B;  3VKO A;  2IXI A;  3KV5 A;  3BCW A;  2DV9 A;  5FJK A;  4D47 A;  1UO9 A;  1G9F A;  3OBT A;  3POI A;  4BIS A;  4COW A;  4DNY A;  3W5M A;  4R9C A;  1VBA 3;  1VAL A;  2JG8 C;  3QCW A;  3CMG A;  1HRI 3;  3OG2 A;  3I54 A;  4HK8 A;  5FQ0 A;  3LE0 A;  3LB9 A;  3VSR A;  2J1A A;  4D8M A;  4MGZ E;  5LB6 A;  4DS0 A;  3NKG A;  4QB2 A;  1ZZ8 A;  1RHI 2;  1Z7S 1;  3OBZ A;  3N9Q A;  2QE3 A;  1UOB A;  3WP6 A;  1AYN 1;  5KXD A;  3VN4 A;  2DVB A;  5M0T A;  3QEF A;  2RMU 2;  1PVX A;  1R08 1;  5FYI A;  1R09 1;  3AYE A;  1BZW A;  1PO2 2;  3N9O A;  2PAM A;  2BVB A;  1C8N A;  3P6B A;  4FO9 A;  4Q0Q A;  3SC7 X;  4CEY C;  1H1I A;  1W2A X;  5SV8 A;  1G9B A;  2PN5 A;  5F1R A;  2YB7 A;  3OEA A;  1YNA A;  2ZEZ A;  4XW3 A;  3BYK A;  4CDQ C;  1GUI A;  2AH2 A;  4XYX A;  4XUT A;  3RS6 A;  3W9A A;  1QY4 A;  1X7N A;  2P37 A;  2ZEY A;  1GSL A;  5DG1 A;  4WVW A;  4O65 A;  3HPN A;  1OF4 A;  5FZC A;  4B3N A;  4OHY A;  2I2S A;  2WLQ A;  3WT3 A;  4N9I A;  4COU A;  4OI1 A;  2ZEW A;  4E4D X;  4NIA A;  4AXO A;  3OSD A;  2O8O A;  1P8J A;  1RVF 3;  2D5F A;  2WT1 A;  3H1Y A;  4UT5 A;  4N90 A;  4CEY B;  2EVX A;  4PI0 A;  4F83 A;  4QDS A;  1ULP A;  2CTV A;  2PHF A;  4IV1 B;  1Y43 B;  2WNV A;  2E26 A;  2VUA A;  4WVZ A;  5FLH A;  5C5U A;  3VZK A;  4CEW C;  1ST8 A;  4GUL A;  1QXJ A;  3C3V A;  3QED A;  4PLN A;  1YHF A;  4EN7 B;  2RR1 2;  2W1S A;  5A1F A;  5ANN A;  1IGO A;  1W03 A;  3AM2 A;  2QBX A;  1ZZ6 A;  2VC9 A;  2Y33 A;  2V4V A;  4HMZ A;  1W0O A;  2JG8 A;  4K20 A;  4N2R A;  3MID A;  2RM2 1;  4QQS A;  4UW5 A;  5L7O A;  4AAX A;  2VBP A;  1A3K A;  1RC6 A;  1GR3 A;  2WWS A;  3VBO C;  2DVD A;  2Q8E A;  4LUK A;  2VW0 A;  4MGT A;  4DEV A;  2PHW A;  4IV1 C;  4UBG A;  2RS5 1;  1FNZ A;  2VOT A;  2WA4 A;  1JMU B;  3T09 A;  4IXL A;  3WNL A;  2QCS B;  5LCW L;  1HV1 A;  5JSP A;  1JZ7 A;  2UUR A;  3AXD A;  3WG1 A;  3FFZ A;  5LA1 A;  4BIO A;  1DQ0 A;  5GM0 A;  3ALQ A;  5EPA A;  4DXT A;  1QDO A;  2CL2 A;  3B69 A;  4KWJ A;  3RFR A;  1UD1 A;  4XET A;  2WBK A;  4QX5 A;  1FX5 A;  2VUD A;  4KCB A;  2HBU A;  1UZV A;  5CFD A;  3S7I A;  4ZZ5 A;  1W90 A;  4WM7 C;  4F8A A;  3ENR A;  5FZ1 A;  1A8M A;  3KVA A;  4XOG A;  1OFS A;  1AZD A;  3AVS A;  1VBD 1;  4UYB A;  5FP8 A;  3FBM A;  1ZVF A;  4RHV 2;  3IWZ A;  1O8P A;  2VO5 A;  1PMH X;  3AZV A;  3WW2 A;  1YIP A;  5FZ0 A;  3PLQ A;  4L11 A;  3MW4 A;  3SMH A;  4DRV A;  2VMG A;  4SBV A;  5J09 A;  1FV3 A;  1AR7 1;  1S0G A;  1YRZ A;  4Q27 A;  4AWD A;  3U10 A;  4Z07 A;  3TRS B;  4CEW B;  5AFE A;  1TMF 1;  3ZR5 A;  1GYD B;  2PLV 3;  4IL7 A;  3RSJ A;  5E6H A;  1UQX A;  5JZG B;  1HRV 1;  3B3Q E;  3IM0 A;  1MQT A;  3KCC A;  4FPF A;  1O3S A;  4GIQ A;  1XE8 A;  2PAE A;  3QOP A;  1OPO A;  4OI2 A;  2XVK A;  2RVA A;  3JZV A;  4CDW B;  1NLQ A;  4A4A A;  2NP0 A;  3WQ1 A;  1OF3 A;  2HWC 1;  1YLL A;  4QAW A;  4B29 A;  1ZA7 A;  4FTE A;  2GC3 A;  3RWK X;  4AFD A;  2ENR A;  5LBC A;  4QGN A;  3WDU A;  2ORX A;  4QKB A;  2D97 A;  2B7Y A;  4BM8 A;  1SLI A;  2ZX4 A;  5FO9 B;  1NT0 A;  2AR6 A;  4Y1V A;  5IK5 A;  2ARB A;  3D5O A;  3VBU B;  2VQ0 A;  1ZBE 3;  3J4U H;  3OYW A;  5BPX A;  2W52 A;  1EPW A;  1AR6 1;  1GKB A;  2IXK A;  4CU9 A;  1LES A;  3L2H A;  3IAQ A;  4D3W A;  3V0A A;  5ERL A;  1H4G A;  1PVC 2;  1SLA A;  2Z79 A;  3GAL A;  3EXU A;  4XBL A;  1W39 A;  2AEN A;  2WUH A;  3FZ3 A;  1S2B A;  2R30 A;  4CDX A;  4Q4V 3;  4CP1 A;  2VUJ A;  5CBL A;  2W5F A;  3H42 B;  1NX9 A;  2QVS B;  3OB8 A;  4L99 A;  3VBS B;  2D3P A;  3H9A A;  4IET A;  3DXT A;  4IUG A;  4WZF A;  2XJP A;  2Y6L A;  5CYY A;  1JZ4 A;  4OI0 A;  1OHF A;  5AFB A;  3I49 A;  4FPG A;  1W8N A;  3POS A;  5LK7 B;  5CG9 A;  1ENX A;  1O3R A;  3OM4 A;  4AI1 A;  5JIA A;  4BQY A;  1STM A;  1CJP A;  2KA3 A;  3ACF A;  4LOR A;  3MUZ 1;  4LO7 A;  2FBE A;  1O8S A;  4AF9 A;  4AED B;  1CES A;  2C5D A;  2YC4 A;  2YFZ A;  4R8H A;  2JE7 A;  4YVW A;  1SLC A;  2GZW A;  2R07 2;  1DP0 A;  1WW4 A;  3MFA A;  2Q8D A;  2BOJ A;  1CAV A;  3R6S A;  4XCB A;  1CJD A;  4K8F A;  4QPG C;  2LRP A;  1AYN 3;  1H9W A;  2QUO A;  4CCL A;  4CCD A;  4CEY A;  3M8L A;  2WSU A;  4LQR A;  3O7O A;  1UYZ A;  3RYR A;  1BBT 1;  1KS4 A;  2WLP A;  3POJ A;  4M01 A;  5FZK A;  1UX7 A;  2A3W A;  4LBK A;  4BYY A;  5IHR A;  2OZ6 A;  2Y26 A;  3JQW A;  4N8M A;  1PVC 3;  3BIE A;  3WPY A;  4LUL A;  5FP3 A;  1QNY A;  4OMD A;  1BEV 2;  3JD7 1;  1ACC A;  1CIW A;  1J1L A;  2OII A;  2WN3 A;  5FUN A;  5D8A A;  3DYM A;  4UI9 L;  3GCW A;  3M3O A;  5GLZ A;  1HXS 2;  1TME 1;  3EB7 A;  3PMS A;  5C3S A;  5K0U A;  2BGP A;  2PAK A;  4P02 B;  1NKG A;  1OC1 A;  2VMD A;  3S30 A;  4R4X A;  4RA0 A;  2VOX A;  1D4M 2;  3IDC B;  4FFF A;  2W47 A;  3WQ7 A;  4CUC A;  4Q8K A;  2FMY A;  2EXI A;  4LBN A;  3HWJ A;  1VRH 3;  2JEC A;  3AMQ A;  1UKR A;  3HN1 A;  3LDB A;  1Y9G A;  3FHQ A;  3WP3 A;  1WCD J;  5I0D A;  1IS5 A;  3U4X A;  1PGW 1;  5FZB A;  1OSG A;  1XNA A;  1CN1 A;  1UW8 A;  4O7X A;  1TNF A;  5BNO C;  5GLV A;  1NCQ A;  1LHO A;  3PUR A;  3UNP A;  1KJL A;  4Q4X 3;  1BJQ A;  3HQU A;  2Q5T A;  5ANQ A;  2A6W A;  2QQL A;  5J1X A;  1PGL 2;  4QM9 A;  4IV3 A;  2HYK A;  4KG0 A;  1RUH 3;  3AP9 A;  4LR4 A;  4WM8 C;  4YW6 A;  4QKD A;  1VMH A;  1XU2 A;  1ULG A;  2Q8C A;  2XBO 1;  5FZO A;  4O9G A;  5A7W A;  5FPZ A;  5DN2 A;  4CU6 A;  1NG0 A;  2WC2 A;  1N1S A;  2EAL A;  2VTF A;  4JDO A;  1POQ A;  1RUF 2;  3ETQ A;  4NVP A;  3RMY A;  1RMU 3;  3ZXL A;  1W2O A;  2ZJC A;  4B1L A;  1AL2 3;  3IDE A;  5A7V B;  4EWA A;  1WD4 A;  3AK0 A;  4ZZ8 A;  1FAY A;  4AK6 A;  3NV3 A;  3ZN6 B;  2XWB B;  3A7Q A;  3WF1 A;  5ACA 1;  5HV0 A;  4Q26 A;  4GJY A;  4EJR A;  5BYN A;  2Y34 A;  5FZF A;  1BLZ A;  3DCQ A;  4UFL A;  5GLM A;  1MVE A;  1YJL A;  2LS6 A;  3AL6 A;  1QJX 1;  4IGQ A;  1UOJ A;  4D94 A;  3POF A;  4HKL A;  4FPE A;  3POY A;  4GAL A;  4W6W A;  3WCS A;  3ZIW A;  4CDU C;  2HBT A;  3DGT A;  4CDQ B;  5A3N A;  5KC5 A;  1MS4 A;  2OUJ A;  3ILF A;  2W94 A;  5LBB A;  4QKF A;  2ZGN A;  5D8A C;  5L19 A;  4B7K A;  4QQP A;  2IFR A;  2A75 A;  2RS5 2;  2DUQ A;  5HCA A;  2VMH A;  1M06 G;  2VU9 A;  4Y1U A;  4FOQ A;  5IAV A;  4BK4 A;  3ZXE A;  1LED A;  2N7G A;  2PEL A;  2XDV A;  4FAH A;  1CD3 G;  1XNT A;  3ZKU A;  4ZU7 A;  5JXJ A;  5F37 A;  3VT0 A;  1MZ6 A;  3BYL A;  1AR6 2;  4FTB A;  1HRI 2;  4H2A A;  5DAW A;  3W20 A;  3ZFE B;  4QX0 A;  2EIE A;  5C3Q A;  1S0D A;  1UIK A;  3G6J B;  4KU7 A;  3ST7 A;  3HNB M;  2EXK A;  1OUX A;  2VMI A;  3IMM A;  3M1H A;  3WW3 A;  1GFF 2;  5AYC A;  1J3Q A;  4LOS A;  4LJH A;  4CA9 A;  5FRE A;  4K8R B;  1UN1 A;  1SCS A;  2OZJ A;  2V5Y A;  3KV6 A;  1LGC A;  3SH5 A;  1J1T A;  4Q4W 1;  1OXC A;  2Y6K A;  2GMP A;  3J7L A;  5FQ0 B;  3RZK A;  4KWK A;  3VT1 A;  2CAU A;  2BZD A;  4KGQ A;  4LO8 A;  3ZYF A;  3TYJ A;  3B02 A;  4LE4 A;  3I2O A;  3BN6 A;  1H0B A;  1VPH A;  1W6M A;  4FPL A;  3P1I A;  4ZXE A;  5A7S A;  1W0P A;  2BRT A;  1CX4 A;  2R06 1;  1LB2 A;  5JOW A;  3NAP B;  2VUL A;  3U1X A;  2MEV 3;  2WS9 3;  3KQ4 B;  3O12 A;  4LKD A;  4KMI A;  5A32 A;  3FE5 A;  3PNA A;  3LOB A;  4YZ1 A;  5IVB A;  5J98 B;  1QJE A;  2YHJ A;  4XFF A;  3ZDV A;  4DO0 A;  5KWR A;  3UES A;  1OKO A;  4YW3 A;  3FLT A;  3WDV A;  1JN2 P;  1OVS A;  4KBZ A;  3QAC A;  1W28 A;  1AX0 A;  5I0R A;  1QH6 A;  4AI0 A;  3ZPY A;  4JTN A;  5CU1 A;  5BNQ A;  3AYC A;  2BP6 A;  2CHH A;  3QD6 A;  4R9D A;  3RNS A;  3OJB A;  4BPZ A;  2BFU L;  4RQP C;  1NQD A;  5I0T A;  2FDH A;  4FAG A;  1OUS A;  1XRU A;  3M3I A;  3PME A;  2WFF 1;  3KF3 A;  3UT0 A;  3ZXA C;  5H9Q A;  4LUM A;  2VQT A;  1JZ6 A;  3HT1 A;  1BYH A;  2AYH A;  5EV7 A;  2ID4 A;  1OKQ A;  3DEC A;  2VZ1 A;  2RS3 1;  1GYK A;  2P6H A;  3HJR A;  4GD4 A;  2B8M A;  3VZO A;  2CNA A;  2JDH A;  2DCT A;  1PM4 A;  2W95 A;  3NL1 A;  2FCU A;  3AKG A;  5CAD A;  4XBQ A;  1GIC A;  4D6Q A;  2CV6 A;  2YFT A;  1W3X A;  4CP9 A;  4NRO A;  5KR7 A;  1ZX5 A;  4Y5T A;  4YGE A;  1H2M A;  2JEM A;  3WNK A;  3N9P A;  4RGA A;  3ZYR A;  1E5S A;  5IK7 A;  1Y4W A;  4Q2F A;  4BXS V;  3BTZ A;  2XJU A;  4XPV A;  4ATF A;  3LD8 A;  2UYB A;  5EP9 A;  3B00 A;  4YZ5 A;  3VL8 A;  2VVD A;  4IEQ A;  4U2A A;  4AGR A;  1AX1 A;  1NUK A;  5DDJ 3;  5D21 A;  3M70 A;  2X05 A;  3RYK A;  5GZE A;  4CDX B;  5I0S A;  1WW7 A;  2GC0 A;  4XQW A;  2ZKN A;  1AR9 2;  4BB3 A;  5JZG A;  1C3H A;  2DUO A;  3J26 N;  4E4Z A;  2VDT A;  5A3L A;  1ZBA 3;  2ADE A;  1JI6 A;  1H1M A;  2JG8 B;  3PUA A;  1GLH A;  2WZR 3;  1J3R A;  3ME2 A;  4W8J A;  3WSO A;  4JGZ B;  2JXA A;  2OPK A;  1QDC A;  1XSR A;  2HWB 2;  2J22 A;  1MS5 A;  3VD7 A;  3BTY A;  4ISQ A;  1RHI 1;  4JGZ C;  2JIG A;  1W8H A;  2R49 A;  3FLR A;  3SNM A;  5KHK A;  2YYO A;  4OI4 A;  3KHC A;  2L9L A;  3M7A A;  3OTF A;  5FY1 A;  4PIY A;  4ATE A;  5CIS A;  4TSV A;  5FBJ A;  1GWL A;  1OLQ A;  2HEW F;  5LEJ A;  4NHY A;  1BEV 3;  4JRA A;  4Y26 A;  4DFS A;  1F4A A;  4AFA A;  1CAW B;  4XDP A;  4GXL A;  1ENQ A;  3WF4 A;  3K3N A;  3UV9 A;  1LNS A;  2VTX J;  1XE0 A;  2QQO A;  1CIY A;  3N4M A;  3U14 A;  2J7M A;  5IVJ A;  3A22 A;  5FY7 A;  5D8A B;  3HVD A;  1S0E A;  1YFX A;  3OEB A;  4OHW A;  3JBG 2;  3AP7 A;  1SG3 A;  5K0U B;  4Q1R A;  3VBF B;  4ONU A;  3ZMN A;  3TOJ A;  5BXX A;  3EHK A;  5A6Q A;  4HG6 B;  5CEH A;  5JSO A;  3KGZ A;  4RR3 C;  4LHL A;  5F9T A;  4XJA A;  1VKD A;  4JHZ A;  3THP A;  1ULO A;  1X50 A;  2XQR A;  5FTT C;  3OUI A;  4JGY C;  2OA2 A;  3NNJ A;  3THT A;  1O3T A;  4LPL A;  2X8K A;  1YQC A;  2X09 A;  3ECQ A;  3OBA A;  5DZF A;  4LNV A;  1WD3 A;  1NY7 1;  3LIG A;  4XCA A;  1HX6 A;  3OD4 A;  1EY2 A;  1JZ3 A;  5HCF A;  3IPV A;  3K51 A;  4KG8 A;  1T2X A;  4N7I A;  1DGR N;  5FZ4 A;  1XBF A;  4N1I A;  1UMH A;  1TME 2;  2V4A A;  3AKS A;  1CZT A;  3ZFF B;  4XVH A;  1O7F A;  3NV4 A;  4GZ9 A;  5FOB B;  3VBO B;  2RJK A;  1QJX 2;  2AEZ A;  1HN1 A;  3IAP A;  4RD7 A;  3QZ4 A;  1VBA 2;  1UPI A;  3KQR A;  5FFO C;  4LIU A;  5C8C A;  1DFQ A;  4Y5Z 0;  2W1U A;  3HN3 A;  4Z82 A;  3I59 A;  2A3Y A;  3JXS A;  5JAX A;  4NIH A;  3PL0 A;  3P2N A;  4ZKT B;  5FWJ A;  5FYB A;  3W21 A;  3KB5 A;  3BOW A;  1B09 A;  4J25 A;  2C26 A;  4XQD A;  4AHW A;  4DOU A;  3CF6 E;  3GZU C;  2CDO A;  1QJX 3;  1SFY A;  5JPM B;  3OGR A;  4C8D A;  4E4H A;  5J7M A;  3T30 A;  5JSR A;  2ZGP A;  3UYJ A;  1QEX A;  1UOF A;  3AP6 A;  3ON7 A;  2RS5 3;  1QHD A;  4UBH A;  5IT6 A;  3ELN A;  3ZFF C;  2C1F A;  2BBA A;  2ES3 A;  2PHX A;  1NXM A;  4WVM B;  3ZX7 A;  1PZ7 A;  2O14 A;  5H9S A;  2JD4 A;  2CU5 A;  1HKD A;  3R4S A;  1MQT B;  4RGK A;  1HLC A;  1IHM A;  3B93 A;  1ZRC A;  4QXC A;  5HCH A;  4Z2A A;  1GZW B;  4DUV A;  2GNM A;  1O5L A;  3IZO A;  3TWI A;  4BK5 A;  4DUW A;  5LBE A;  3EMR A;  5KHI A;  1Y9M A;  2VMC A;  1YXW A;  2WAA A;  1ZRR A;  3FUO A;  4QXH A;  3ZYH A;  4ES8 A;  3RZH A;  4CP9 B;  1A8D A;  4LT5 A;  4O8N A;  1X9T A;  2WN2 A;  3CLP A;  3LV4 A;  4Q4W 3;  4P08 A;  2FZ2 A;  1REF A;  3NW4 A;  2A3X A;  1LUL A;  3JQX A;  1ULD A;  4AFC A;  1IPS A;  2XHN A;  1SDW A;  1HB2 A;  3I2I A;  3I2D A;  2ZAC A;  1JZ2 A;  1DQ5 A;  1OOP C;  1PMI A;  1GAN A;  4QMA A;  5FZL A;  1XC6 A;  2JB8 A;  5C4W A;  4B4Q A;  4QHB A;  3EO6 A;  3VBR C;  2F17 A;  4K6B A;  2HWE 2;  5I8Y A;  1W6Q A;  4M00 A;  2FDF A;  1IG0 A;  4FTS A;  3KWV A;  3FHI B;  1OBN A;  4HKW A;  3NMB A;  3WG3 A;  2DDU A;  2DU1 A;  2WNO A;  3FX3 A;  2A5Z A;  3ILR A;  3MGU A;  1V70 A;  5FZE A;  2EIB A;  3NJX A;  3P3N A;  2P4E A;  3III A;  4IV3 C;  1WCU A;  4G4F A;  4MSV A;  1PMJ X;  2AEY A;  1GZ9 A;  2VW1 A;  2HWD 2;  2BTV C;  5JDB A;  4WZC A;  4LKE A;  1GOG A;  2GME A;  4UDK A;  5FLJ A;  2OX0 A;  4XJ9 A;  2ZGM A;  4CUB A;  3AKF A;  2A6Y A;  1HXS 3;  4V2V A;  2FDK A;  3QH7 A;  1FXZ A;  2YY1 A;  3RJ2 X;  3E5Q A;  3ZN6 A;  4A45 A;  4AK7 A;  5E8A A;  2XJR A;  5A3M A;  2Q0A A;  4U6B A;  3AYA A;  4GH4 C;  4FP3 A;  1JHJ A;  4Y33 A;  3T1L A;  3OF1 A;  4XQ4 A;  1X33 A;  2ZX3 A;  1CGP A;  1UY0 A;  4N43 C;  4TN7 A;  4IND A;  2P3J A;  4BQX A;  1PGW 2;  4N9H A;  4GWM A;  5IK8 A;  1U5Y A;  2GC2 A;  1MS8 A;  3BTA A;  3HD8 B;  4I0A A;  4UDK E;  4DXR A;  2XBO 3;  2GAU A;  3FJS A;  3AP4 A;  1Z7S 2;  2AGS A;  1KFU L;  2XKO A;  4JRL A;  4XAA A;  3WR0 A;  4YG6 A;  1SMV A;  2PQQ A;  5JMO A;  5T52 A;  1PO2 1;  4UDG A;  5GLR A;  3T2Q A;  3WPU A;  3PTY A;  4RQP B;  2ZGU A;  4GA9 A;  5JLV A;  1XYP A;  4NHX A;  1DZQ A;  2RS3 2;  5JR2 A;  4MG2 A;  4OMC A;  1VBC 3;  2R06 2;  2GND A;  5FOJ B;  3H8X A;  3JBG 3;  3J8F 1;  2R1D A;  3RRD A;  1AL0 G;  3VL9 A;  1NCQ B;  4LMF A;  4JQT A;  1SFP A;  3I3M A;  2V5D A;  3QEE A;  3KT1 A;  4G3Y C;  2KM2 A;  3DV8 A;  2EF6 A;  5HBA A;  4IE5 A;  4XEZ A;  1DHK B;  2R32 A;  3VBF C;  4FT8 A;  3VD4 A;  4XC9 A;  3POW A;  4DY5 A;  1E5R A;  1ZBA 1;  4QD2 A;  3JD7 3;  2B5H A;  2ZGS A;  3PU3 A;  5EJZ B;  2YFR A;  4XJU A;  2BPA 2;  3VB9 A;  1H9P A;  5IAX A;  1ZBE 2;  3ZXD A;  2IXC A;  2PFW A;  5IVE A;  1CWP A;  5BUV A;  3OPZ A;  2X5I B;  1U12 A;  2XJT A;  2WQZ C;  4Q0V A;  1KFX L;  1OD3 A;  5GAL A;  2Y6J A;  3IDB B;  2LRO A;  4MET A;  1DU3 D;  1PO1 1;  2TBV A;  2X5I C;  2YDE A;  3T2P A;  4CU8 A;  2RV9 A;  4UFH A;  3THD A;  2A73 B;  3MIH A;  2DVF A;  1V9U 3;  2DCJ A;  4ZHN A;  1MVQ A;  2Q1F A;  4I0W B;  2EXH A;  4QQL A;  4M4P A;  4BCU A;  1C5H A;  3GBF A;  1SLB A;  4QPW A;  3BYW A;  1FOD 1;  1XSQ A;  2VEC A;  3ZO0 B;  4EQV A;  4QXK A;  4B1M A;  5C8C C;  5LA0 A;  5KHG A;  3BYN A;  4JVA A;  3WHU A;  1W9W A;  1GZW A;  1J59 A;  5H9P A;  1W6P B;  5AVP A;  1KEX A;  2G19 A;  5CFD B;  4HSJ A;  5FKB A;  1N3P A;  1RUG 1;  4CYD A;  2ZAA A;  1COV 2;  1H6X A;  3V0B A;  5IYY A;  2ZKL A;  5FO7 B;  3K3O A;  3MEP A;  5C7G A;  1UPS A;  3DPR B;  4N53 A;  3SKJ E;  4N4B A;  1NQJ A;  3PVO A;  2BNO A;  3TNQ A;  3WQB A;  1VBB 2;  1S0C A;  3M3E A;  2C24 A;  4WBB A;  1OYG A;  3PVE A; 
#chains in the Genus database with same CATH homology
 3QC2 A;  4QQS A;  3S5Q A;  3TAW A;  4UDK A;  3ZXJ A;  5GLQ A;  3WN2 A;  4FFI A;  2AC1 A;  3AKF A;  4CCD A;  3OM5 A;  4N2Z A;  5JOW A;  1WL7 A;  3U1X A;  2X8S A;  2X8F A;  3K1U A;  4KMI A;  1VKD A;  1W2T A;  3KF5 A;  5AY9 A;  3NQH A;  4AK7 A;  3WPY A;  2XQR A;  3LF7 A;  5FMB A;  4U6B A;  5C0P A;  3C7E A;  5JOY A;  3LDR A;  2QQU A;  4UFM A;  3CU9 A;  3VT2 A;  3LIG A;  5GLN A;  3D60 A;  3PIJ A;  4O8O A;  3OM7 A;  3WN0 A;  4N1I A;  4UDK E;  4AZZ A;  2B4W A;  1UYP A;  4UDI A;  3C7G A;  4FFF A;  4KCB A;  4PVA A;  4COT A;  3WAS A;  2EXI A;  5A7V A;  3C2U A;  1Y9G A;  2AEZ A;  2OXB A;  4KC7 A;  4UDG A;  5GLR A;  3WPZ A;  3D5Z A;  3QZ4 A;  3KF3 A;  4NOV A;  3ZXK A;  2QQV A;  3C7O A;  4CCE A;  3UGG A;  5B6S A;  4D47 A;  3LFI A;  3P2N A;  1YRZ A;  1Y7B A;  2X8T A;  1PT2 A;  3UGH A;  3ZR5 A;  1GYD B;  3AKG A;  4JQT A;  2EXJ A;  4KC8 A;  3ZR6 A;  3QEE A;  4MLG A;  5FMD A;  2YFT A;  3VSR A;  4FFH A;  5GLP A;  3D5Y A;  3ZXL A;  4B1L A;  5A7V B;  2YFS A;  1YI7 A;  3OM6 A;  2ADD A;  1Y4W A;  3LIH A;  3QEF A;  3WAU A;  3D61 A;  5AYE A;  5A8D A;  3HBK A;  2YFR A;  4AK6 A;  3RWK X;  3KST A;  1UV4 A;  3SC7 X;  5FMC A;  5FIX A;  4UFI A;  4UFK A;  3BYJ A;  1YIF A;  3R4Y A;  4O8P A;  5GLM A;  4UFL A;  3VSF A;  3UGF A;  5JOX A;  3OM2 A;  3VSS A;  3BYK A;  3WMY A;  1Y9M A;  5AYD A;  3AKH A;  3VSZ A;  5FKC A;  2VDT A;  3R67 A;  5GLK A;  2ADE A;  5GLO A;  4UFH A;  4O8N A;  3WPU A;  3U75 A;  3LEM A;  3AKI A;  4UDJ A;  3H3L A;  3LV4 A;  1GYE B;  2EXH A;  2QQW A;  3C7H A;  3LDK A;  3R4Z A;  4KCA A;  5FK7 A;  1GYH A;  4EQV A;  3OSD A;  4B1M A;  3PIG A;  3VT0 A;  4HXC A;  3BYN A;  4UFJ A;  3BYL A;  5GLL A;  3WPV A;  3C7F A;  1W18 A;  5B6T A;  5FK8 A;  4U6D A;  2EXK A;  3WAT A;  3IMM A;  3WMZ A;  5A8C A;  4PVI A;  5FKB A;  5AYC A;  5FLW A;  1ST8 A;  3OM4 A;  2AEY A;  3NMB A;  4FFG A;  3QED A;  4CCC A;  4AK5 A;  5JOZ A;  3WN1 A;  4N4B A;  4ONZ A;  5ANN A;  3U14 A;  4N2R A;  4QHZ A;  1OYG A;  3VT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...