2AEYA

Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with 2,5 dideoxy-2,5-immino-d-mannitol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
537
structure length
537
Chain Sequence
b'QIEQPYRTGYHFQPPSNWMNDPNGPMLYQGVYHFFYQYNPYAATFGDVIIWGHAVSYDLVNWIHLDPAIYPTQEADSKSCWSGSATILPGNIPAMLYTGSDSKSRQVQDLAWPKNLSDPFLREWVKHPKNPLITPPEGVKDDCFRDPSTAWLGPDGVWRIVVGGDRDNNGMAFLYQSTDFVNWKRYDQPLSSADATGTWECPDFYPVPLNSTNGLDTSVYGGSVRHVMKAGFEGHDWYTIGTYSPDRENFLPQNGLSLTGSTLDLRYDYGQFYASKSFFDDAKNRRVLWAWVPETDSQADDIEKGWAGLQSFPRALWIDRNGKQLIQWPVEEIEELRQNQVNLQNKNLKPGSVLEIHGIAASQADVTISFKLEGLKEAEVLDTTLVDPQALCNERGASSRGALGPFGLLAMASKDLKEQSAIFFRVFQNQLGRYSVLMCSDLSRSTVRSNIDTTSYGAFVDIDPRSEEISLRNLIDHSIIESFGAGGKTCITSRIYPKFVNNEEAHLFVFNNGTQNVKISEMSAWSMKNAKFVVDQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords fructan 1-exohydrolase IIa
publication title Insights into the fine architecture of the active site of chicory fructan 1-exohydrolase: 1-kestose as substrate vs sucrose as inhibitor.
pubmed doi rcsb
source organism Cichorium intybus
molecule tags Hydrolase
total genus 128
structure length 537
sequence length 537
ec nomenclature ec 3.2.1.153: Fructan beta-(2,1)-fructosidase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 2aeyA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2aeyA01
3OM7A 3LIHA 5AYEA 5AY9A 3C7EA 3HBKA 3WPUA 3VSFA 4O8NA 5FLWA 3IMMA 3KF5A 4FFFA 5AYDA 3KF3A 4UFJA 4PVAA 5ANNA 3ZXJA 3LF7A 3VT1A 1YRZA 3WN2A 5JOYA 4HXCA 3VSSA 5FMCA 2YFTA 3AKGA 4UDIA 2ADDA 3ZR6A 2QQWA 3LDRA 3ZXKA 3BYKA 4CCEA 2X8FA 4N2ZA 5JOXA 5A7VA 3WMZA 5AYCA 1Y7BA 4B1MA 5B6TA 2X8SA 4UFHA 3D61A 3QEFA 3LEMA 4KCBA 5JOWA 4JQTA 1UV4A 3VT2A 1PT2A 5B6SA 5FIXA 3TAWA 4O8OA 4QQSA 2QQVA 4UDKA 4AK5A 1W2TA 5GLKA 5GLRA 3PIGA 1GYEB 4CCDA 5GLOA 3AKFA 3UGFA 3OM6A 3U1XA 1WL7A 5GLLA 2YFSA 4O8PA 3U14A 2QQUA 3LV4A 4UDKE 2YFRA 3D60A 2ADEA 3OM2A 4FFIA 3PIJA 5GLMA 2VDTA 3ZR5A 3C2UA 3WN1A 3NQHA 4EQVA 1Y9GA 3UGGA 3C7FA 2EXIA 4AK6A 2AEYA 3H3LA 1OYGA 4NOVA 3R4YA 3K1UA 3BYLA 2OXBA 3KSTA 3C7GA 2AEZA 4KCAA 1ST8A 5FK7A 3R4ZA 3D5ZA 4PVIA 3D5YA 1Y4WA 4COTA 3VSRA 3P2NA 5FMBA 4KMIA 3WAUA 4B1LA 4KC7A 3WPZA 3CU9A 5C0PA 3NMBA 4UFIA 2AC1A 3U75A 3C7HA 4FFHA 4ONZA 1UYPA 3OM4A 3OM5A 4N2RA 5FKCA 5GLPA 3QEDA 4AZZA 3BYJA 1VKDA 1YI7A 3WN0A 4UFKA 3VT0A 4U6BA 4CCCA 4U6DA 5FKBA 4MLGA 4D47A 5FMDA 4UFMA 3WASA 3WMYA 5JOZA 3WPVA 5A7VB 3SC7X 3AKIA 3ZXLA 5A8DA 3QZ4A 4UDGA 3LFIA 3LDKA 3QC2A 4UDJA 1GYDB 3C7OA 3WPYA 4AK7A 3VSZA 3WATA 3UGHA 3OSDA 3RWKX 2EXKA 4QHZA 3BYNA 3QEEA 4N4BA 1Y9MA 2B4WA 5FK8A 3LIGA 2XQRA 5GLQA 5GLNA 5A8CA 4KC8A 3AKHA 4FFGA 2EXHA 1GYHA 3S5QA 1W18A 2EXJA 3R67A 2X8TA 4N1IA 1YIFA 4UFLA
chains in the Genus database with same CATH superfamily
4IXLA 1TMF2 3VKNA 4QX3A 4W65A 3ZFGA 1ZBA3 4HSJA 2VXRA 4HL0A 5FUIA 1CD3G 5FZDA 2OZ6A 3NO8A 4D7YA 3DYOA 2WNVA 3UL2A 3P3NA 2RR11 3WDYA 1QKQA 1RVF3 5E16A 1TME2 3FFQA 4UDIA 1HJGA 3MGUA 4E4ZA 3AKRA 3CIHA 3WEZA 4I0BA 4XMAA 1RHI1 1GZWB 2A6YA 2VR4A 1YQ8A 2XQXA 4K40A 4XJ9A 3SEEA 3HVDA 1IQDC 2VH9A 1DHKB 4CDUB 5FOBB 4HN0A 2ZABA 1DGWX 2R1BA 3APBA 3N7JA 4Q0UA 5IUQA 2RM21 2VUCA 4AEDA 1VBC3 5F37A 4YW7A 4S2GA 4CUGA 4QKNA 2BERA 1H8TA 1X8EA 2QQVA 1W6OB 1A3KA 3AP9A 5GKAC 2VMCA 4CPBD 4N43A 4DRRA 1COV2 1XE8A 1S2BA 4EV0A 2HWC3 5IK4A 3AKFA 1AR61 2YGLA 1IOAA 1UF2C 5GZEA 5E88A 5BNOC 1C5HA 4QU2A 2GSYA 1IPSA 5AFEA 5FZ7A 1UNBA 1JYWA 3M4FA 3LV4A 2YG0A 3OUHA 3ES4A 1O3SA 1VB4A 3FLTA 4YG3A 4NVPA 4YZ4A 4ZONA 1YFUA 3B00A 4AAXA 3RZGA 3C7FA 2QTWB 4Y5TA 4DXRA 2JECA 1WBLA 3GCXA 3CHXA 1AR71 1K5MB 3AC0A 2K2SA 2PXJA 4ZXKA 3WD5A 4ET7A 1HJFA 4IW3A 4YM2A 4NWWA 5GLUA 1JYTA 3Q8EA 2C9AA 4X8NA 5DAWA 2V5DA 3GALA 4UAPA 1DQ1A 5J09A 4OI2A 4Q4V2 1QJX1 1O3TA 4MXWB 4IUGA 5A7NA 5APAA 3GBWA 1QIQA 5BY5A 5C5TA 1RUE2 2RS11 2BP6A 3S7EA 1AF9A 5J1XA 2WWSA 4K21A 3GCWA 4RS5A 4FO9A 5H9QA 5I0SA 1AXYA 1AYM3 2ZCWA 1DQ5A 5C8CA 4QDRA 4AI3A 1VBE1 2E31A 3DEMA 1DFQA 4MH0E 2ZGPA 2ZHLA 1W9SA 5JPNB 1QOOA 1DYOA 4LE3A 1GKBA 3H3ZA 2VULA 4LIVA 3WR0A 1H1MA 4DOUA 5JLVA 1VR3A 4FOWA 5B4NA 4HMZA 2WSVA 5L9VA 3JXSA 3OYWB 1BKZA 1HB3A 4ASLA 1EV13 3WPVA 5FJKA 3VBHA 2HJIA 4UI9L 1X33A 2P3YA 4CDWB 4FAHA 4FPYA 4MHUA 2XWBB 2GDFA 1W04A 2Y0OA 2R16A 4QXCA 5CA6A 3QBQA 2RS31 2W5FA 2LW8A 4JGYA 4OYUA 5I93A 4GJYA 1QMJA 2A6XA 4XURA 3W20A 2HWD2 1YFYA 1ASJ1 4MSVA 2WR9A 4XW3A 3VD9A 4M0NA 1VAMA 4AFAA 5BNPB 1D7PM 4A2UA 3AKHA 5T54A 3SKJE 4BQ5A 1O4YA 2ZPXA 4MV2A 3JQXA 5CFCA 2OIIA 4YYOA 4L92A 5ABJA 1REFA 2NQYA 5A3OA 4UFLA 5C71A 2HBTA 2JE8A 2FD8A 1M4WA 3C7EA 5J36A 2BW8A 3ACHA 5KC6A 2W3JA 5KHJA 1BJQA 4Q4X2 3WXPA 1JOJA 4RFT0 4OCTA 4RR3A 1QH7A 3I2JA 3IPVA 3KS7A 2X5IC 1JW6A 2Y8KA 5ANNA 1DGWA 3AZYA 2C6SA 3LSEA 3FUQA 1HRV1 4CCJA 4E2SA 1I9RA 4PIZA 4E2QA 4Q4W1 3ZR6A 2VTXA 3BCWA 2IFRA 4JKLA 4P9XA 4YARA 3V0AB 1SFPA 4NHLA 5FYHA 1UZZA 3O12A 3C3VA 3DGTA 4LEJA 1US3A 4IV1C 2QE3A 3E5QA 2AZ5A 3AXDA 4KCBA 3LEMA 3ZYGA 2JDPA 1ND3C 3CL1A 3R4UA 5CVRA 1NXD1 4Q4Y2 3RMXA 4EN6B 1MZFA 2K9ZA 4ES8A 4P02B 2JB8A 2UU8A 5DAXA 1N3OA 2XKPA 4JDOA 4LOSA 4QQSA 1FOD2 1OXCA 1YFWA 1RHI2 2B9UA 2DCYA 5GZGA 2RS52 5DDJ2 2AACA 1C8M1 2OZJA 3WOGA 5K0UB 3FFZA 5DAPA 4CCDA 1CR7A 2YHJA 2JDKA 3T1LA 2VUAA 3O1SA 4QB2A 2JG9C 5C3OA 4G9SB 2DU1A 2RM22 5CISA 2ZGLA 5DG1A 4YZ5A 4Z2AA 1R1A1 1LKNA 3MLKA 4G4FA 2D6NA 5FBZA 1OF3A 2XJUA 2R49A 3MF6A 3PVNA 3OM2A 2W52A 1MS9A 4AFDA 1NCQB 3X29B 1SACA 4DUVA 5GLMA 1MPXA 3MI8A 4KWLA 2WZR1 3OBAA 1UYZA 5GLWA 3WN1A 5LK5A 3HNYM 4EE2A 5JSRA 4JGZB 2QZ2A 4UF0B 1AR62 1G9AA 2PLV1 4B3NA 2VM9A 2P6CA 5A7PA 2RDSA 3WZ1A 4R9AA 1CAXB 1GZTA 1SHWB 1UQXA 3ZYIB 1DLCA 1PM7A 1QJY1 4KMIA 2WA3A 3E6BA 2IUWA 1REEA 1SDDB 1G8WA 1PZ8A 2R072 2W1QA 4MYEA 3VN4A 1BMV1 2BNMA 3TNQA 3E6DA 4IEVA 4QAWA 1GLHA 5H9SA 1X82A 3GZTB 1JOPA 2ZX4A 2VXJA 4OUMA 1MQTC 1CWPA 1G7YA 2BV4A 4SBVA 1IZ3A 2Y6FA 1JN2P 5GLPA 2XJQA 4OMCA 4CDQA 4YW1A 2R063 3S57A 5KXDA 1RMU2 1WCDJ 4Q27A 2E7AA 4HLTA 4CDXC 3ME2A 3WN0A 1EP0A 1UD1A 2P5BA 2JE9A 3AP6A 1WW4A 5JI7A 5C3RA 1N47A 4K1YA 3B94A 4Y1VA 4R8HA 1ULOA 1W8OA 3KHCA 1VBA2 1TG7A 3SC7X 4Y3OA 3H7YA 5CEHA 2DTWA 1IQAA 1S0IA 1SCRA 3DYMA 1VMFA 4QD2A 5KHKA 4AI9A 3AKPA 4XFCA 1HQLA 3WATA 3ZKYA 4I02A 3KQ4B 3ZPYA 2P3IA 3RWKX 2VVDA 4AF9A 3LFMA 1CONA 1IG3A 3K2OA 1BQPA 3KD4A 1MS8A 4Q0SA 4UXAA 2A3YA 4CEYB 1EUTA 3E97A 2R32A 4LK6A 2XJSA 3LIGA 5EYYA 2Z79A 4D6SA 5T55A 5FZ4A 4KBBA 1RUJ2 1O8PA 3I2DA 2JDMA 3R67A 4KG0A 1V6MA 5LWBA 2X8TA 4ZU5A 4BLJA 3R4DB 5FXWA 4QPGC 3TN93 2RS32 3M3OA 4Z07A 3I3MA 2RMU3 3MV01 1FPN3 4E4DX 1ASJ2 2PQSA 4NE9A 4XFBA 3UETA 1DCSA 1N1VA 1KJRA 3ZSEA 5A3LA 2R041 4GH4A 1MEC2 1R083 2P34A 3ACIA 3AKGA 3CF6E 3WW4A 3T3YA 1KFXL 3JBG3 3R4SA 4LLOA 2EF6A 1Q5OA 1VRH1 3MZHA 1SBEA 4QKDA 4PJYA 1WGPA 5CADA 2YUEA 3GDBA 3ZVXA 2FDFA 2PFWA 4LXLA 5BUVA 3ACLA 1JS9A 2QCSB 3WG3A 3ALQA 4Q4W2 2FDKA 4HKWA 3SH4A 1ULEA 3T0AA 3BKZA 1V9U2 5FBJA 2WBKA 4Y4RA 1GU3A 1GMMA 4U36A 3UT0A 1LOAA 4KGQA 1LB2A 3RZZA 4U6DA 2HKXA 1CAVB 1JUHA 4OI1A 3SCFA 3U1XA 4RYDA 1EUUA 1RUF3 1W6OA 4EN0A 3KWVA 2BVBA 2MPFA 5IW0A 4X6QB 4YVSB 2ZEYA 1JZ2A 4GKXA 2YFRA 1NXMA 3HIFA 1P8JA 4ITCA 1YQCA 5DZGA 4EQVA 2Y38A 4LBQD 3DN7A 5LEJA 3SXWA 2FMYA 3BYLA 2HYXA 4XJAA 3RQ0A 1Z7S1 4WM7B 3R4ZA 3AK0A 3TAYA 2DCKA 1R1A2 1D2SA 1JUIA 3P3PA 2A6ZA 1H1AA 2XL9A 2VPVA 3NMBA 3U4XA 3VBOA 4PLOA 3ZYFA 3ORJA 2IXCA 2WZR2 4K9SA 4W6XA 1K5MA 1A8MA 4AK3A 1SG3A 1QWRA 4COUA 4TSVA 4FPJA 4KL1A 3N36A 2RJ2A 4M00A 3N4MA 3JD71 4WBBA 4MXWA 3NNJA 3GZAA 4JQRA 1QJY2 2XKOA 4LQRA 1QJZA 3FL7A 1SZBA 3B02A 3HJRA 1CN1A 1D0HA 3M8LA 1HB2A 4CU9A 4E2GA 4FTSA 1BMV2 1PO21 4QQ2A 2Y6JA 2AGSA 3PUHA 1UX7A 2JE7A 3AKIA 1AX1A 2WS91 4YM3A 5HPOA 1UPIA 1W0NA 1W6MB 2W92A 3GYDA 4GULA 4TWTA 3WG4A 2JG8C 1A8DA 3LFIA 3LDKA 5EXOA 3OY8B 1ZA4A 4XE9A 5FZOA 4JCKA 1QDOA 3TWIA 3FHQA 3OYWA 3WQ7A 1AHSA 1QXPA 5FLIA 1FYUA 5A1AA 4FOVA 4NIIA 2E7TA 3I4IA 2PHLA 1SLCA 4F8AA 4LNVA 4QGMA 2XQRA 5CIRA 1AX0A 3GGLA 2LUWA 1DQ0A 1GQHA 2DWRA 4CDWA 2ZAAA 3WW2A 1B35B 2DUPA 2HWB3 4OHYA 2RG4A 5AYDA 3AYDA 2F17A 2Q8EA 2ILMA 2WNUC 3BYWA 1Q43A 1WW7A 1EAH1 4O65A 3ZN4A 4CZSA 4COZA 4U2AA 4YFZA 5BNPA 2WO1A 4H7MA 5FZIA 4WVZA 2NMNA 2VZ1A 2D98A 3J8F1 4ZS3A 3ITQA 2ZEXA 1BHGA 1L7QA 3RYKA 1WLDA 4D0QA 2EIEA 3GJAA 1W28A 1MVEA 5AYCA 2HWC1 4UWDA 4Y24A 3FMGA 3O5SA 2CAUA 5JXGA 4NIGA 3VBSA 2VAUA 4GKYA 5FZ3A 1Q8PA 1F9KA 2WJSA 1LCLA 1NCRA 4JQTA 2A3WA 4WVWA 2XJRA 5CG8A 1HXS3 1LODA 2IXLA 2JKBA 4XHBA 3AB0A 3T4HB 1YIPA 2X29A 1OQDA 4CE8A 3V0AA 3OJBA 2K0GA 1A6CA 2WWJA 1CX1A 4HG6B 2D3SA 3IDCB 2VMIA 4XC9A 1UY1A 5TSWA 3LPFA 4UDKA 3GHMA 4BXFA 2BNOA 3OEBA 4JRAA 4XVHA 5GJ6A 2BTVC 1ACCA 1OHFA 2WLPA 1WA6X 1OA3A 4QKBA 4JKKA 1W0OA 2HWF1 4AGRA 4CUCA 5FYCA 1JBCA 1OLRA 3R6SA 4LK7A 5IHRA 1KS4A 3I3QA 1BXHA 4L97A 1EPWA 1LHWA 3VBRB 1S0EA 2E53A 3NNLA 4LBNA 3RI9A 2HEVF 4KGGA 2PMWB 5F6LB 4MLOA 1IS6A 1NY71 3VBFC 2VJXA 4NOVA 3BTXA 3R4YA 1C3HA 2QQNA 1JU3A 1H9PA 2DF7A 4XJUA 2KM2A 1GZ9A 3POGA 1W8HA 1LGNA 1EV11 2HH9A 3V0BB 2LTNA 4OLLA 2WO7A 1C8NA 2ZGMA 5T5OA 2ARBA 3IIAA 4JGZA 5FZLA 2JD4A 2VBDA 3AMPA 4RL7A 3C7HA 1CJPA 4QB1A 1C1LA 1NQDA 3VBUC 2PHDA 2C5DA 1OURA 4GD4A 3W21A 3WF3A 5IVFA 4EZ4A 1CAXA 1N3PA 2JWPA 4OI0A 4GB33 1NE6A 4QPIA 3NJXA 4XFHA 3WP4A 3OPZA 3GZEA 2R30A 4E9KA 5CFDC 5F3EA 3WHUA 4WVMB 1GYKA 2CAVA 4JHZA 3T4VA 1D4M1 2D93A 1OOPA 1EYBA 1W3VA 2CSGA 3BVCA 2WDBA 2O8OA 3ECQA 5D8AC 4L11A 2UWBA 3IDAA 5CKMA 3GF6A 4KQ7A 5JAXA 5A7VB 2B9VA 3NAPB 4XHXA 1LHNA 3AKSA 4YGCA 2VCBA 1NKGA 3AFKA 2H6CA 3ZFFA 1POV3 3SITA 5A8DA 1OBNA 4XUNA 4PDWB 4CXXA 5J7MA 3NV3A 2YZ4A 4XBQA 1RTVA 2ARXA 2VVEA 5LBFA 4AAPA 5FO7B 5J37A 1NLQA 4QT6A 1IGOA 4LA3A 3IAPA 3KHBA 1X36A 4CCMA 4BDVB 1N1TA 2K46A 5FO9B 3O1RA 1NA1B 1N1SA 3VZJA 1D2QA 2ES3A 2WS92 2A6VA 3UJOA 4MUVA 4NPLA 4XYXA 4EJRA 1E5RA 1ULDA 1XE0A 1CZTA 4BJ0A 1ZBA2 1V6NA 4PF5A 4AQ6A 1OA4A 1Y43B 3FWEA 4YM1A 4Z8BA 4M0HA 1T2XA 3JQWA 4CEYA 1WMFA 4KG8A 5F32A 3C8XA 3DPRB 2BJSA 1RVF2 2WFF1 3A0NA 4FFFA 3ZFGC 1LOFA 4D8MA 2W08A 4NRQA 2IVJA 2ORZA 2G9GA 2JD9A 3CMGA 4RA0A 5FPZA 4ARYA 5JOYA 2WNVC 2GC0A 4K3UA 4MGZE 3ZDSA 4C0HA 1VJ2A 5FMCA 2YFTA 4FQ4A 1ZZ8A 2ADDA 1GANA 3EYPA 3LDRA 2GMMA 1TMF1 2QVSB 4Y4YA 5CU1A 5FQ0B 2G1MA 4CCEA 4CTEA 3BYKA 1VBD3 2J42A 2ARAA 4I30A 1XNDA 3HD8B 1NOVA 4A42A 3N7MA 1ONAA 3FE5A 4B1MA 1UMHA 4BK5A 1VBC2 5EP9A 2P2KA 4META 4M4RA 4RN5A 1W9YA 1YNAA 4X8PA 3K3NA 3J8F2 1VALA 3EMRA 2XMLA 3OBTA 4IV3B 4AEDC 4HVQA 4O8OA 2GU9A 2HWC2 4CP0A 5IK7A 1YC61 4CCLA 1CIYA 4AVVA 2A3XA 4MXVA 4RQPA 3IT8A 1H8TC 2IXJA 2VBBA 2FMDA 2ZGNA 2ZGQA 4G3YC 1NYWA 1DBNA 3ZYBA 5JZGB 1SBDA 3NNMA 4BQ4A 1VRBA 3DV8A 4DZGA 1JH5A 1WCQA 3I49A 4QXBA 4XQWA 3URFA 1JHNA 1CX4A 3QCWA 3QH6A 5FDBA 4TTGA 1AZDA 4DXSA 5JXIA 3ATGA 4YVWA 1ZBE3 4GWNA 4XJZA 5L73A 3C2UA 1MS4A 3B3QE 2YY1A 2Q1FA 1CAVA 3G7DA 2E32A 3PVEA 4DIQA 3MW4A 1LGCA 5FWJA 3I2GA 3RPQA 4CU8A 5IK8A 3CJXA 3FN9A 1F4AA 2X05A 1FI2A 4KWJA 5F39A 3D0SA 3GBFA 5A70A 2XBO1 1AYM2 1DF0A 5E1RA 3NV2A 4P9GA 1T6GC 1W03A 5BNNB 5F7UA 3T08A 2JEMA 3VDDB 4CYDA 1RUG1 3P6BA 1AR81 1NY72 3LQCA 4RS5C 4WM7A 1IG0A 4IGQA 1LOCA 1QJFA 3FC0A 5C8CC 4HANA 4AZZA 4Q4V1 3AYEA 2Z4FA 1KDMA 4I2OA 1EV12 1XNTA 4J25A 4UFMA 1S0DA 5F5IA 3KVBA 2YPJA 5JOZA 5KC5A 1RC6A 4CCNA 1N3QA 1AXKA 1QF3A 3ABZA 3MIHA 1U12A 4K1ZA 2IXKA 1HQNA 5JCTA 4XQDA 3VBHC 3VHOA 1GBGA 2RMU1 4P9JA 3O0VA 2XJVA 3J26N 5A7QA 3NRUA 5I8YA 1PO11 1WWYA 4LR4A 1MS1A 1GUIA 4JGYC 5FYVA 1GR3A 4XEZA 1AL23 5FZFA 1A34A 1UU6A 2EXHA 3N7LA 4FFGA 3SKVA 4W4ZA 3AKQA 3WINE 2VMHA 3JBG1 4I0AA 1RXGA 2ZGOA 2LS6A 1GP5A 1AYN1 2YC2A 5C9AB 1UZ0A 3LIHA 1S2KA 5CFCC 5ABJC 1BVP1 4XF0A 1JYXA 3UKVA 3M3IA 1LULA 4CA9A 2HWD1 3AYCA 3VSFA 3IN9A 4D6RA 2GZWA 2QNKA 3R0RA 3NW4A 3LSDA 4RR3C 4C1XA 2QQWA 2C9KA 2WL1A 2VZTA 2KR2A 3BODA 4XFFA 1PX4A 3OBZA 1SPPB 4IQPA 4LKEA 3T1MA 5LCWL 1US2A 3WUCA 4H7LA 4OZXA 2HWE3 5FPAA 5JOWA 4IGPA 2CGNA 2KXLA 2RHPA 4QDSA 4QX0A 5FTTC 1FNZA 2Z2SB 1H0BA 3LZZA 1AUYA 2CTVA 1Z78A 1HQWA 5A33B 1ND2A 2C1FA 4I01A 4BH9A 4CUAA 3RWNA 1CVNA 1OFNA 2AR6A 2BFUL 3ZN6B 1PIV3 3HBZA 3B93A 1W2TA 2E7QA 3KV9A 3ASIA 2ZX0A 5GZDA 2Q8OA 3T0BA 3A4UA 4UT5A 5LBBA 4J1XA 5GLOA 1CZSA 4Q4Y1 3KMHA 4XAAA 4FCAA 3HT2A 1HRI3 2D7FA 4NR1A 3RI8A 4PBOA 5F5AA 3MFAA 2JDHA 1FOD1 1FMD3 2QQLA 3HN3A 1W6PB 2ATFA 4NMIA 2RS51 5DDJ1 5H9PA 5A3TA 3BIWE 1IPJA 1QNYA 3PURA 2V73A 2B7YA 1EY2A 4XFGA 2VU9A 1HLCA 2QJVA 2VMFA 4E27A 5J3UA 3H3LA 5A1LA 4Q26A 5FWEA 1IS5A 4JDMA 1LEMA 1WW6A 2BNNA 1J1TA 4WM8B 1YWKA 5L9RA 1GP4A 1SLTA 2CWSA 4HKLA 4M3CB 3B9IA 3H8RA 5FMBA 3VSRA 5IJRA 3VBRA 3LPGA 4JKMA 4BB3A 3OTFA 3AXEA 5FY5A 3D4KA 2FCTA 2B8MA 2HLEA 1Q3EA 2W1WA 3IZOA 4GWJA 4AYUA 1S2EA 2R062 2Y60A 3UNPA 1NX9A 3KB5A 1F8VA 3AVRA 2XB6C 3MF9A 1ODNA 3JUUA 5HV0A 4CP9B 3V0BA 2W46A 2R071 4MOAA 3K51A 2FDHA 3VT0A 2XBO2 5IVEA 1ZRDA 4IGOA 2OX0A 5FKBA 3GXUA 1RUH3 5SV8A 2HWB1 4IV1B 5IFTA 2YGMA 3GNEA 5JXJA 1RUG2 3UESA 5F1RA 2Q30A 1G9DA 3ZXLA 1AR82 4NOTA 1DGRA 2ZGRA 2Y26A 1JODA 5AVPA 1RMU1 5FP9A 2J1SA 1SFYA 1W2OA 4WVMA 4AGGA 3C7OA 2WYSA 5F3IA 5EIYB 1IPKA 2P17A 1O59A 3T0DA 2A1XA 2VZRA 4HOOA 2FQPA 3CJIA 5K7PA 2EXKA 1E5IA 2VQUA 3VDAA 3OD4A 3FBMA 4XFAA 1OLME 3SCGA 2LRPA 1YLLA 1VBA1 4N4BA 1UIKA 5KXBA 3POJA 2PAMA 5FK8A 3IB3A 1URXA 2EAKA 2FCUA 3S5QA 4LKFA 2R6QA 3TN92 5K9YA 1YIFA 2QBXA 1S4CA 1H9WA 2RMU2 1WLTA 4IL7A 1C4RA 2V4VA 1FPN2 1MR5A 2OPKA 4FPGA 4TLFA 2DVBA 5EFUA 5AY9A 1PO12 2E51A 5IT6A 4Q8KA 2EIDA 1QJU3 1QEXA 2B4KA 2GN3A 1NLRA 2MEV3 2Q4SA 4NAMA 2XHNA 1E57A 5D2AA 3USSA 3Q8FA 1RUJ1 4BQYA 3O1UA 1J59A 2PTMA 5CBLA 2YU1A 4HZFA 5DN2A 1V6LA 3KV5A 4XQ4A 1GNZA 3JBG2 1OH4A 2JDAA 4GH4C 4MGIE 1AYN2 3EB7A 5FLHA 2RVAA 2X8FA 4AEJA 3DPRA 3MW3A 2L9LA 4K20A 1ALYA 1W99A 1FAYA 1CAWA 4HN1A 4A6OA 5B6TA 2Q5TA 2XONA 1VAKA 3AMMA 3ZXEA 1MEC1 2WQZC 3OGVA 4QB6A 1ZZ6A 3VB9A 3TEZA 1O91A 4A7YA 4L8QA 4YWAA 2CL2A 3EXUA 4CU7A 1TQ5A 5M0TA 2JKXA 5KR7A 4O7XA 5FYZA 3M3CA 4RGAA 5IAXA 5HCFA 1OUSA 1GOFA 5C70A 1AJKA 2ZKLA 2TEPA 4IE5A 4QGLA 4CDXB 4AK5A 1IS3A 3HT1A 1DU3D 1H4GA 2OUHA 2DURA 1YHFA 3ENRA 3HN1A 1GYEB 4TLGA 3H7JA 3EJKA 3PVOA 4DUWA 1MACA 2HEWF 4AWDA 3LGRA 5HCAA 2XVKA 4MGKE 3WDUA 4XILA 4LJHA 4PHZA 5FYBA 4K8FA 3CNAA 3PU3A 1SCSA 1U0AA 5T3NA 1PVXA 4LLFA 3KVAA 2CV6A 2JIJA 4BA6A 4MG2A 1WCSA 1V9U1 3PLQA 3PIJA 1SLBA 4PI0A 1UOJA 4PQQA 5JZGA 1VIWB 3U4SA 1XXNA 2F4PA 4OUEA 5FZ8A 5KHIA 4FOYA 2EXIA 1PMJX 1Q8QA 2Y6HA 2ZMKA 3F2ZA 2UURA 3HMYA 3INAA 4FP2A 5LY2A 3E5UA 3J7HA 3JB4C 3C7GA 4GWMA 1SDWA 5CB7A 3WV6A 1Y4WA 2PAKA 5C33A 3P2NA 2GN7A 4JAAA 4QPGB 5FY7A 1U5YA 3DXUA 2GH2A 4ORFA 3HEIA 2CU5A 3BOPA 4MGSA 5A32B 1FX5A 3VV1A 2BBAA 1POV1 5EZWA 5KHGA 2HYKA 3VBOC 3WG1A 4CU6A 1GQGA 4RD7A 2DVAA 1K5MC 5FUNA 3WY6A 5A6XA 2DCTA 4CVUA 2Y6GA 1MZEA 1BEV3 1GNYA 2DFCA 1XNKA 2FZ1A 2VMGA 2E9QA 3KCYA 2VO5A 3N9NA 4EN8B 1KGYA 1UU5A 3H42B 2W1SA 4Q8LA 1KFUL 1RUD3 2C26A 2CDPA 3SISA 5BNNA 4FPKA 4WZFA 3VDDA 1XE7A 2A6WA 1WLWA 4LTAA 5BNQA 5C6CA 5L7OA 4OULA 1C57A 3WMYA 1VMJA 4QMAA 3MFCA 3ZSJA 2AH2A 5FO8B 2J1EA 5G04L 3F95A 3MHZA 5BV6A 4FPEA 1OMIA 4FBFA 4UDGA 3S30A 3N7KA 4KI5M 4XPVA 2PHRA 5B2GB 1WA4A 5IYYA 3POSA 2DVDA 2KA3A 5I91A 2E63A 1W90A 3ZLIA 2YBKA 2D5FA 3H1MA 5FZBA 1XYOA 2D5HA 3VZMA 3SCHA 3K48A 2HWB2 1Y9MA 2B4WA 5LY1A 2XG3A 2Z42A 4XCAA 4YM0A 1G9FA 1C5IA 1UO9A 5A8CA 1GYHA 3N9OA 4OHXA 4IEXA 4QHOA 5FZ0A 4UBGA 4CDWC 3D82A 4NRPA 1YQ2A 5F9TA 3I7DA 5ACA3 5I0DA 2W2IA 3WDWA 4PF1A 5FLWA 3M7AA 3KF5A 4M3CE 3ZFEB 4KBZA 4INDA 3KF3A 2OA2A 5AC93 1LR5A 4LUMA 5HCHA 2ZX3A 3GM8A 5FZ9A 4LOTA 4LBJA 5BNPC 5FYSA 1OQ1A 2C4XA 5C9AA 1BBT3 1LHOA 3NV4A 5GLTA 1COV3 3OPTA 4SLIA 3USUB 5JOXA 1M06G 2GNTA 3QOPA 4GMP1 3SH3A 1Q8OA 1W6NA 2QQOA 3H8UA 1HXS2 3AMNA 3UK9A 4LITA 5FCCA 4QQHA 3NSTA 4QX7A 3AZWA 4YW4A 5FZMA 4B4RA 3NWKA 1XPWA 4XUQA 3VBSC 2XL7A 4M3CF 3S6PA 1NCRC 4XETA 4ATFA 4ASMB 2Y64A 4LO4B 4AI0A 5JMOA 3V65A 1PNGA 2GC2A 1LRHA 4NAOA 1W8TA 1HV0A 4CRQA 4DS0A 2B39A 2VNOA 4I0WB 3FJSA 3M3QA 1GOGA 3THDA 1GP6A 1XOYA 4BWOA 4DINB 4Z82A 4XZPA 2YFZA 1RUE3 1JTZX 5A33A 3AZXA 4BQ2A 1G9CA 3U14A 3VL9A 3ZSKA 1AR93 2YXSA 2RDNA 5DZEA 2LROA 4A3ZA 1F35A 4GA9A 2UWCA 4AEKA 2JDNA 3WP6A 4DMIA 2VQ0A 3PUIA 2I2SA 3J7LA 5A7WB 1OYGA 4LIUA 2PHXA 5EYXA 2PHUA 4NHMA 3K1UA 4BMEA 4KNCA 4PBPA 1W6PA 1GZWA 3B01A 3D5YA 2A71A 2WKKA 5KXEA 5LA9A 4C90A 3BB6A 5FRAA 1UYXA 2WNUB 3ZXAC 4A4AA 4CDUA 1RJ8A 3WDTA 1K45A 4QKFA 1STMA 3KV4A 4LUKA 1H2KA 1HN1A 4HONA 3VLBB 4AHXA 3I54A 4GB32 4JGZC 4P9IA 2DYCA 2FHRA 4P9YA 1Z0HA 3OM5A 4WM8A 1RL3A 4BZ4A 3K77A 4M3CA 3SMHA 3WF4A 4DEQA 3IDEA 1RUC1 1UZWA 3QEDA 1OVSA 2WWUA 4LA2A 4P9LA 1WMEA 3IM0A 2ZGTA 3IIIA 3LWCA 4HK8A 4QPIC 2HBUA 2CGPA 2D6OX 3ZXGA 1AL21 2W47A 2V5YA 3I2HA 1OOPC 3K4DA 2YC4A 2WNEA 4NN0A 2VW2A 1LOEA 4D7SA 4COTA 1L7LA 4RHV1 5FY9A 4CP9A 1PX3A 3H1YA 1UIJA 3SQOA 2O8QA 4JZRA 4O9GA 3ZFFC 3VSZA 4YW3A 4XBNA 4AI2A 1PVC3 3PVBB 1KRIA 3VHRA 1W9TA 2Y33A 2NYYA 1W8ZA 3TBDA 3OB8A 2DCJA 5C4WB 1GSLA 1VPHA 5T52A 2EXJA 4A7KA 1XJAA 4BQ1A 2XPJA 4XXAA 5FZHA 3POBA 2WT0A 1W2UA 3WLUA 3O1OA 2RR13 3O1VA 1J3PA 2VNGA 4AVTA 5AYEA 4A41A 2GH8A 2VCCA 5T50A 2PAEA 2ENRA 2WLQA 1YYNA 4JV4A 4DFSA 1BLZA 3LKJA 4Y1XA 1XRUA 4X6RB 5EHDA 4E4SA 2F4LA 1LOFC 2W0XA 1ZBA1 1VBD2 5J48A 1I3HA 2Q1ZB 4EROA 4XDQA 2D6KA 2GP5A 2XVLA 3AMQA 5GLZA 1KDKA 5EJ1B 1RVF1 1OQEA 4PCRA 3ST7A 3MPBA 3MV11 2GMPA 1HRI1 3QEFA 3AP7A 3WCRA 2NM1A 4YZ3A 1JZ5A 1LOGA 2OKXA 1UV4A 5FYMA 5LA1A 1PT2A 1G9BA 3N9MA 4BM8A 2D6MA 3POEA 1AR63 5CFDB 4XJWA 2G19A 1V00A 3LA3A 2VTFA 3OF1A 3O0XA 4JRLA 3UKNA 5DG2A 5LATA 3ZX7A 2RDQA 2UY8A 1VBC1 2G4IA 2VZOA 4RGGA 1Q56A 2XLAA 4RQPC 1S0JA 1GZCA 1L3JA 2PA7A 2B45X 1W8UA 3AZVA 1LTEA 2QFEA 4XZUG 3UGFA 1O3RA 1AVBA 3K4ZA 2XGXA 2ZBJA 4Y20B 4O8PA 4IE4A 2QQJA 2DCZA 4Z1VA 4N8MA 4HSLA 1ZBE2 1AR73 4QX2A 3D60A 2LALA 4UW3A 1F15A 3CZJA 1CAUB 3VHPA 5BYNA 2XDVA 1QJX3 4CCKA 4YVWC 1KJLA 2JDYA 4AK6A 3DKWA 1TEIA 1OPMA 1W39A 2WABA 1QU0A 2F6BA 2RS13 4N53B 5FK7A 3D5ZA 1TE1B 2HEYF 4WVVA 1I5ZA 3WAUA 1OPOA 1RUH1 3AZZA 2CY6A 1R1ZA 4IESA 4B1LA 1DQ4A 1VBE3 1OSGA 1V70A 2UWAA 1OD5A 1XYNA 4FT8A 3KT1A 3TEWA 1UYPA 4LO7A 1J1LA 1O5UA 1WCUA 2ZHKA 2BGOA 5A6YA 5LA2A 1UYYA 2NLRA 2WNVB 2DDUA 3BPZA 1MVQA 1H30A 3A22A 3DUIA 4NPRA 4WM7C 5LB6A 1YI7A 3ZSMA 2FBEA 1AYM1 4QU1A 5K0UA 3I2IA 4CCCA 5A32A 4MLGA 2H0BA 4YSFA 4BU2A 3S0MA 4FTEA 4IDZA 3RVHA 3KCCA 3VD5A 4Y1UA 5FV3A 4HVOA 2RS33 5HXVA 3WP5A 5HBAA 2WQ8A 2BRTA 5CKQA 4R9CA 1O4TA 1RUC2 1NCQA 1UMZA 3ILRA 3S5AA 1ASJ3 4NRMA 5FMOL 3VL8A 5ERLA 2JDZA 3VDCA 1QJU1 4AEDB 1UZYA 3LOIA 4UF0A 1AL22 4Q0PA 1XNCA 2IZWA 3IKWA 4AE2A 2X09A 3BYNA 1DLLA 1H8TB 3M2MA 3MIFA 4Q1PA 3TRSB 3HQUA 4RHV2 3WNXA 4MADA 3LE0A 3THTA 3VZOA 1UXZA 2XVGA 2DV9A 4AQ2A 4BIOA 1HRV3 1UZVA 5F2WA 5FYIA 5T5LA 3VGIA 4EWEA 5FLJA 1IS4A 4YZ1A 1U5XA 3BTAA 3LF7A 4LHNA 1YRZA 4NHKA 2DBNA 1GQPA 1PK6B 3OD0A 2B5HA 1B09A 1O6UA 2ZX2A 1LU1A 2Z5WA 2VG9A 2WN2A 3JU9A 1E5HA 3D3AA 4LBMA 5FZ6A 5FZGA 3RZLA 2Y6KA 4NPMA 2HWE2 4AGVA 5LA0A 2X53S 5FP8A 2Z69A 5J98B 3W9AA 1UL9A 5BPXA 3ZFEA 1KXGA 5A3PA 5GZCA 2YC0A 4LBOA 4JVAA 3HQXA 1QQP3 4UFHA 4KU8A 1K42A 2A73B 2MHFA 1I5PA 1XSQA 1WKYA 4K6BA 1APNA 4BCUA 4RS5B 3RJ2X 1H6YA 1UOGA 1MS3A 4NHXA 1C8M3 3I2FA 5C8CB 3HNMA 1PIV2 4QQPA 2VOKA 1S0FA 4IEQA 3H8OA 4PLMA 5F5CA 2ZGUA 1ND2C 5E6HA 2EAAA 2WO2A 5FAXA 5LW9A 1HRI2 2OVUA 2BOJA 4AR2A 2CYFA 4FPLA 1JYVA 1FMD2 4I3PA 4YLZA 1W0PA 4YZ2A 5C7GA 2Q8CA 2PLV3 2ADEA 4BMBA 4W6WA 5EQUA 3A0KA 4OVEA 3AP5A 1UCXA 3WX5A 5DPNA 1QJY3 1BEV1 1UY2A 5DQ0A 4XACA 4QM8A 4BHPA 1TNRA 4EZHA 2DTYA 1UX6A 2R0HA 3NJYA 1RUD1 4TYSA 5IAVA 1XQNA 3THPA 4CPBA 4CXYA 3M1HA 4IETA 4OUSA 4QXHA 1VBB3 4AQSA 1HB1A 2VY0A 4LBQB 4IEPA 1K5JA 3MYXA 5ABJB 1NLSA 2VD7A 1DGLA 3JCIA 5E8AA 2GNMA 3NV1A 4N43C 2J1UA 2XWJB 4DY5A 4BPZA 4LBLA 1X8MA 2DUOA 3ZOIA 4XABA 4RR3B 3CKHA 4M01A 4GAZA 3IPVB 2VZPA 3ES1A 3ETQA 4R9BA 1RUH2 1CGPA 1V6OA 4FPHA 3KLSA 2BZDA 3DXTA 3A7QA 2EICA 3LEIA 2I74A 4P9WA 1R64A 4YRDA 4OQ9A 2YROA 2R061 2GNDA 3ZXFA 1JZ8A 3KT7A 5BXXA 4CEWB 4YW2A 1RB8G 5IVCA 1ZZBA 4YVSA 2EIBA 3K4AA 2VMEA 2VZUA 3TB0A 4MGQA 3O1MA 2XHKA 2W91A 1O4ZA 1PGSA 4IEOA 3E5XA 2OQ7A 5AC91 2VQTA 4FXKB 4ISRA 3EHKA 3CJIC 4FP3A 2JENA 5GLNA 1BBT1 2A75A 4AHWA 5C5UA 4QX1A 3LB9A 3WQBA 2D3PA 2Q1MA 3POIA 3KV6A 4B4QA 2XJPA 4XMIA 2R043 3SLIA 1QJU2 4MO3M 2MEV2 1S0CA 3OG2A 3WPUA 4A45A 3H0OA 3I59B 3ZYJB 1UXXX 5C4WA 5ANQA 2VUDA 2ZEZA 2OQ6A 2V4AA 3EBRA 3DYPA 4V2WA 4NUBA 3TEYA 5K8SA 3TN91 2R7EB 1VRH3 1SLAA 4HXCA 4P00B 3H8XA 3TYJA 3JZVA 4YNIA 1PMHX 1ZZ9A 5IATA 2W39A 1FPN1 4Y22B 4S2HA 5LRRA 4P14A 4W6YA 5IFPA 5A3WA 4CP1A 1R081 4LO5B 1XYPA 4NIDA 1W6MA 2VOVA 4IEZA 1ULGA 3DPRC 5FFOC 1JU4A 4JDNA 2W68A 1RUI3 3W5NA 3OY8A 1ENQA 5BNOB 2NPIA 1AR91 2D43A 3MLJA 4N7IA 3ZIWA 4B7EA 2BBVA 5FP3A 3KT4A 5JMCA 3L2HA 1GICA 3WF1A 2ZA9A 1J83A 2W94A 2OPWA 1Q8VA 5KWRA 2WFPA 2E6VA 5JXHA 4AHZA 5HI0A 2RV9A 3I2KA 1S1AA 3KM5A 1B35A 3PTYA 2VCAA 1QH6A 4UW6A 1K3IA 5E89A 3V64A 1OD3A 4Y5Z0 4CP2A 2BWAA 3CZUA 4BQ3A 1ZNPA 4YPJA 2E33A 3OEAA 4B7KA 2YFSA 1E5SA 3R05A 2QQUA 3PJYA 4Q5OA 1CJDA 1IKPA 3PL0A 2DUQA 3ETPA 1J58A 2CHHA 1ODMA 2JX9A 1O7FA 1Z7S3 4S2DA 5DUXA 1Y9GA 1RUF1 1PM4A 3I3BA 1YUDA 5JZGC 3P1IA 4LKSA 4GZ9A 2AEYA 2JJ6A 1JOBA 3MIDA 3A21A 4QX5A 4KCAA 4J1WA 4OHZA 4NIHA 3KGLA 4AVCA 3HWJA 4HVRA 5DMYA 4KC7A 4AQTA 4PLNA 3Q8CA 2BGCA 4LKDA 2ZJCA 5FPLA 3JD73 1NT0A 4P5HA 1OF4A 2WN3A 1V6IA 5J96B 1O8SA 1U5IA 2D3RA 1BEV2 2XUEA 3RFRA 4JC1A 3POFA 4N53A 3WW3A 3AFGA 1QXRA 1SBFA 1RUD2 2B46X 2W87A 1PO23 4XIKA 4GH4B 4R4ZA 3WF2A 2WS93 2WAAA 5FY4A 1OFSA 3U11A 3WHTA 5FMDA 5BNNC 1QGLA 2WT1A 4LHLA 4LO6B 3VDDC 5L7OC 1H2NA 1CPNA 5JWPA 4ISQA 3PDQA 5FZAA 1GV9A 3RYRA 2PQQA 3POWA 1HIXA 3NKGA 4UDJA 4AK7A 2PN5A 3UJQA 4B8EA 5LZ6A 2ET1A 1QHDA 2GP3A 3AP4A 4Y1ZA 4BQXA 1OLQA 2WQ4A 1W8WA 1UOFA 2TUNA 3FUOA 5ISLA 3QEEA 2O1QA 3WCSA 2X5IB 3WVJA 4UW5A 5F2SA 5I8SA 4ASKA 5HCBA 4URTA 1EAH3 2ETEA 3CBNA 4PIXA 2FZ2A 4UYBA 5ACA2 4BE3A 1DP0A 3AM2A 4CDQC 1PGL2 3N9PA 2X8KA 2CWMA 5AC92 3WT3A 2VCMA 3J8F3 3BTYA 4FXGB 3AJYA 4PVAA 4QWNA 1BBT2 1ND3B 1UMIA 5FY8A 1W9FA 3FX3A 3B5LB 5LRSA 2ZHMA 3VD3A 4IEWA 4V1PA 5FPVA 3ACGA 1UW8A 4DO0A 3TNPB 1ULFA 2DVGA 2I07B 3OGRA 3MW2A 5C9AC 1FV3A 5A7VA 1QOTA 3NAPA 3DCQA 3WDVA 4XDPA 5FUPA 2W9XA 1FT9A 4FPCA 2X8SA 1PK6A 4PDWA 1WD3A 4WV8A 1LAJA 4MVTA 2JG9B 4XF9A 3VBOB 4CSWA 4XFIA 4U6BA 3LCPA 2P1BA 1W3XA 1UOBA 3ZPOA 4OQ8A 2YFUA 2D97A 5FIXA 3K75B 2ZACA 4DB5A 1I1EA 2ZEWA 3U78A 4H55A 4I3GA 1NA1A 1ENXA 2HWF3 2XOMA 1R082 1HXS1 2BGPA 3RYPA 1XU1A 5A7OA 3MPPG 5I0RA 2O0OA 1C28A 4BXSV 4BISA 2ZS6B 2BWCA 5GLKA 1XBFA 3ACFA 3PNAA 1AR92 1F4HA 5DXDA 3VD7A 4ARXA 3MLLA 1UAIA 4EYUA 4M4PA 2WNOA 3RRDA 5JIAA 1DYPA 4L9BA 2XLFA 5EPAA 3ILNA 5FZOB 4N7UA 5HXMA 1AX2A 3HNBM 1MQTB 5DABA 5FQ0A 1D0GA 5CG9A 3CU7A 4I09A 3THCA 1QJEA 2AEZA 1MZ5A 4F83A 4HT1T 2EALA 5DUVA 2D40A 3QH7A 2VGDA 1KEXA 1PGW1 2ZAHA 3CU9A 2W1UA 4FI9A 3BI3A 1W2AX 2J1VA 5JUVA 4QQLA 2C24A 4CDUC 1RUF2 1YO8A 3D0JA 1JHJA 3OUIA 1POQA 3WNLA 4RSUA 1D4M3 4IV3A 5A3MA 1XSRA 2MNGA 3M70A 5DUWA 1QDCA 2IXHA 4LULA 3BYJA 4LBQA 4WM8C 1VKDA 4OFGA 3NNGA 3VKLA 3WNMA 2ZZQA 4LMFA 1S0BA 1WBFA 2QQKA 2XXZA 5F8PA 1DZQA 2EVXA 4N90A 4GB31 4H2AA 2BU9A 1K12A 4ZZ8A 3MO4A 4A6SA 3MUY1 4N9IA 1OLMA 2J22A 2ZMNA 2P3JA 3LA2A 4W50A 3BGAA 3ZMOA 1AXZA 3FLRA 5KXCA 3DECA 5C2MA 1PVC2 3VBSB 1PZ7A 3NNFA 1NCRB 2YDEA 4N9HA 3U37A 2VECA 3OSDA 3VZNA 3RZMA 4QHZA 3ILFA 4CEWA 5FYTA 1G6NA 3GJBA 1W06A 3O1TA 4L99A 3NVCA 1R093 2RR12 4L2NA 1BK0A 3AYAA 2Y6LA 1GWMA 5AFBA 2WFF3 4RGKA 4KWUA 2VQAA 4XTPA 2BFUS 5D1IA 4A3XA 1D4VB 4UW4A 3JB8A 1LENA 1ZZCA 3AVSA 4YFWA 5IVBA 1L7RA 1QQP1 3CLPA 3HBKA 3BN6A 4O8NA 1LJ7A 3WQ0A 5IVJA 1W8FA 3AMHA 1TMF3 1ZA7A 4UFJA 5JIUA 1VB2A 1J3RA 2XJTA 3CEWA 3VT1A 3WN2A 1RUNA 1GWLA 1A78A 3MIGA 4OMDA 2ORXA 5DAVA 3WDXA 2I45A 4AVBA 2J1RA 4DRVA 3ZXKA 4W8JA 2QKDA 1PMIA 1TME3 4QM9A 3I59A 3WMZA 1GNHA 3J7NA 3W59A 4DNYA 5GLLA 2DVFA 5KHHA 4ONUA 1SFNA 1WCKA 3LAGA 4EN9B 3PUAA 3K46A 1VBD1 2WSUA 4Y22A 3BOWA 4XDOA 1ZRIA 3O7OA 3RSJA 1UY4A 1VE0A 2JDUA 4R4XA 3TAWA 1CESA 4HBNA 2D44A 4LT5A 4QPIB 3T2TA 1DZRA 3NKTA 4NROA 4Z2WA 1SQ4A 3VKOA 5BNOA 3RGBA 1OOPB 3RZKA 1NG0A 1YQ5A 1VBB1 1AR72 3OBRA 3NJVA 3PMSA 4E8CA 5FREA 1W6QB 3AJZA 3OOXA 3OM6A 1LHVA 1YQ6A 3UYJA 1WZXA 2QQIA 5A3UA 2FDGA 4FTBA 3ZFFB 2V09A 3W58A 4DUXA 4LHKA 3OUJA 1QJX2 3PTRB 4HPKB 3FLPA 4Y1YA 2TBVA 5B4XA 1W2NA 1GOHA 2RS12 2ZGSA 3OPWA 5IVYA 3T30A 2XBO3 1OA2A 2A5ZA 1QOSA 1VBE2 4P5YA 3ZIXA 1ZBE1 3OGGA 4CUBA 4XF1A 4NWVA 1SPPA 1RUG3 4PT6A 4IE7A 3EQEA 1AR83 1ULPA 2A70A 5C0PA 5A6ZA 2VNRA 4Q4V3 3ZXDA 4AFCA 4UFIA 3U75A 2Q8DA 4OZOA 4ZU4A 1O5LA 4B4PA 1I6XA 5FP4A 3TEXA 2VUJA 3AKTA 3I3EA 3BIEA 2DFBA 2JG8B 3IWZA 2UYBA 5FKCA 3J4UH 3ZN6A 5FOJB 2WO3A 3DKQA 3QD6A 4UFKA 1H6XA 4QHBA 2H6BA 3S7IA 1PGW2 4AI8A 1XU2A 4FOQA 2H0VA 1WW5A 1BCXA 2P3KA 5K0UC 4Y5SA 1RJ7A 1OC1A 3VKMA 3VZKA 2CNAA 3J7MA 5JR2A 4S2FA 2AENA 1JYNA 4GIQA 1FXZA 3ZO0B 3K3OA 1PO13 1S0GA 4GALA 1ENRA 4YW5A 1GYDB 3BUCA 1NCQC 1Y3TA 2BYVE 3CDZB 3WNPA 3WNNA 1NE4A 1QXJA 5C3PA 1UY3A 1V6JA 5CYYA 1AYN3 4YW6A 4IERA 5JI9A 2WC2A 4Y26A 3O14A 2VOXA 4EWAA 1OKQA 4RQPB 3WQ1A 1TL2A 1V0AA 2HWD3 2VZSA 4GXLA 4LHSA 4Y33A 1MS5A 5FY1A 1HRV2 2VVFA 1RUOA 3OM7A 1X9PA 5JSOA 1Y9QA 4PQ9A 1RUI1 2WA4A 5A7SA 2V72A 5F3GA 2X5IA 5IK5A 4URAA 3ZM8A 3BU7A 3IMMA 2AREA 2IC1A 3ZXJA 2Y34A 4HKOA 4FPOB 1H8VA 3AX4A 4UBHA 4YVWB 5EWSA 4Q4X3 1JMUB 1ULCA 3MIEA 3LEGA 4D6QA 4COWA 2NMOA 1HDKA 1JYCA 2P6HA 4IV1A 4QPWA 3U10A 3LOBA 5A80A 5FR3A 1QQP2 1JZ6A 1MZ6A 4OI4A 3I8TA 2PHWA 4MX3A 1Y7BA 2G9ZA 4TN7A 1ND3A 3LDBA 4GQ7A 3ZFEC 2IVIB 3D61A 1C8M2 3VT2A 5FPXA 3IBMA 5FZCA 4PI2A 2WRAA 4YGDA 1YCIA 2HWE1 4Q2FA 4AW7A 3HAGA 4Q29A 4Q4Y3 4NIAA 3SEPA 2ZZJA 1ZZ7A 1C1FA 1ZRRA 4K7JA 4CEYC 5F3CA 1J3QA 1FOD3 1KS5A 2JG9A 1LHUA 5IVVA 4JX0A 1RHI3 2EIGA 1UN1A 3TOJA 2RJKA 2RS53 2JXAA 1N1YA 5DDJ3 3VBFB 5GLVA 2BEOA 1WL7A 1PIV1 2OUJA 2PLV2 2WUHA 1H2MA 1PHMA 2P37A 2YPDA 2BUKA 3KQRA 1DGRN 5LASA 1LU2A 4AOCA 4UDKE 2RM23 1OI6A 4H3WA 4FFIA 5EJ3A 3FHIB 5H9RA 3FHAA 2VDTA 3PJQA 4K8RB 3ZR5A 3LA7A 4KU7A 5EV7A 4ZU7A 3D6EA 5F5QA 3U0ZA 3UGGA 1FMD1 1F31A 3N9QA 3VBUB 3WG2A 5FPUA 5A3NA 1VBB2 2J7MA 2OXBA 1DZTA 3KSTA 1ST8A 2A7AA 5F6KA 5I8TA 4QDQA 4PVIA 1LOBA 1VAVA 4DY3A 2TNFA 2ID4A 2D6LX 2Y0IA 5D8AB 5FY0A 5FZEA 5GALA 1JI6A 4QGNA 1BVVA 2VMDA 1MQTA 2N7GA 3AL5A 2AC1A 3KSCA 4V2VA 4LO8A 2R073 4XF3A 4D69A 3OGSA 4A44A 3LD8A 1RITA 3Q8BA 4IEUA 1CQ9A 3OM4A 4OHWA 4ONZA 3PU8A 2WINB 4CDXA 2QUOA 1YI9A 2OS2A 1ZM1A 3U07A 4COVA 1SLIA 4HETA 2EA7A 4BLIA 4HK9A 2GC3A 2RDRA 1REDA 1CPMA 1RMU3 4Z92B 2OYZA 3D5OA 5JVVA 2E26A 1PZ9A 3IMNA 4PIYA 3WP3A 2WAOA 3RG0A 3O0WA 1AJOA 1VBA3 5K4LA 4YVSC 3ZN5A 3N3HA 4Q1RA 4XAEA 3T09A 4CXWA 3RMYA 3HOBA 1RYYA 2YV8A 4D7TA 4DEVA 3VHNA 4YGEA 4O61A 3H50A 1W8NA 1ND2B 2YBSA 3PMEA 3ZFGB 1NUKA 3CO2A 4KC8A 3BPSA 3ON7A 5CNAA 2R042 1FV2A 3RDIA 4AXOA 4QPGA 4N1IA 4FPFA 4R52A 2BOIA 1RUJ3 4C8DA 2SLIA 1BYHA 2NN8A 1KQRA 4XIOA 1YXWA 2VW0A 1X9TA 1VRH2 2VOWA 3B7MA 4J6GA 1NZCA 5I0TA 4AFMA 1ZRCA 4XF4A 2OT7A 1BZWA 4KH9A 4D94A 1LEDA 5C4WC 3VSSA 3B69A 1OKOA 2QDNA 3E6CC 4F7ZA 1JXNA 1MEC3 1WUVA 1UPSA 2MEV1 3W5MA 3KCXA 2YBPA 4P08A 4ZS2A 1Q8SA 1ZYBA 5DUUA 2BQPA 2VZVA 1H1IA 2B42B 1RUI2 4JHTA 4XOGA 3DF0A 1UY0A 2NZ9A 1LECA 4KMQA 2WZPP 3IAQA 5FXZA 3T2OA 4N43B 1YFXA 4AG4A 4ZKTB 4D3WA 2BPA2 3IDBB 4XUPA 3A23A 2VOTA 4XUOA 3PHMA 2LM3A 3VKFC 5A1FA 1S55A 4AL9A 3L2YA 5JSPA 5L19A 2YMZA 3BALA 3ROUA 1DG6A 1QY4A 1ZRFA 1FATA 1G86A 1SLLA 2VL4A 2AUYA 2GNBA 4Q4W3 3SHRA 4F3JA 1HX6A 1TZOA 4NHYA 3ZSLA 1B35C 3OGJA 1RXFA 1V9U3 2R1DA 5T5PA 4WZCA 4LORA 5FXVA 5JPMB 4ZPIA 3WF0A 3UKTA 2JIGA 1Z7S2 3ZKUA 3H3UA 2BDRA 2SBAA 1LESA 3HR9A 1F2NA 4AVSA 4EWDA 3CJIB 3KZ4C 1PNFA 1W6QA 3USUA 4E8DA 5CKNA 1O3QA 3AL6A 4YG0A 4H14A 4Q0QA 3WUDA 3BTZA 2VNVA 2J1AA 1VLNA 3JD72 5AVAA 3MEPA 3RZJA 4HPKA 5FZ1A 3WPZA 2P4EA 1R1A3 1RGSA 3HPNA 2IXIA 3FBYA 1X7NA 1CIWA 2YB7A 1PO22 5FJHA 4CCOA 5HV4A 3O1PA 2ZOEB 2WZR3 3VBHB 3NL1A 4O9EA 2J1TA 4TXWA 4BOWA 4NJ4A 4N53C 1WMXA 3WNOA 5C8WA 2QDRA 2ZTNA 3H9AA 2PELA 5FP7A 4DXTA 5T5JA 1ENSA 1CZVA 1R091 4JGYB 4XJ8A 3WSOA 2YYOA 2KD7A 3MICA 2JG8A 5FPBA 2DBIA 1CAWB 1OH3A 2XR4A 3FZ3A 4KWKA 2GMEA 2GC1A 3D8CA 3HQRA 3QC2A 2VBPA 2X10A 5IWFA 1XNBA 4E4HA 5CFCB 3UGHA 1F5FA 5C3QA 1HB4A 4GJZA 4ES9A 4AHYA 3VBRC 1UU4A 3QACA 2ARCA 1NAEA 3G6JB 5A7WA 1LGBA 1ZX5A 1EAH2 5CZKA 4AEMA 3L9JT 3T2PA 2QQMA 4FAGA 4COYA 2WT2A 3MDPA 4Q0VA 1TME1 5FYUA 1WD4A 5A6QA 1GWKA 2WNUA 2W95A 2FDJA 1V6KA 2WYFA 4AI1A 1ZREA 5L36A 2ET7A 3I97A 3OCPA 4A7ZA 3PUSA 4MGTA 3GHNA 1IKQA 2OW4A 5DZFA 4ZXEA 4QX8A 3ZYHA 4XBLA 3ELNA 2ZGKA 4QPYA 1XC6A 1DQ6A 1T6BX 2UY9A 1OT5A 4GMP3 4XUTA 4B29A 5ACA1 1POV0 4YGBA 3PUQA 5GM0A 2XH6A 3P5BA 1PGL1 4IE6A 4HFSA 5EJZB 2FDIA 4DQAA 2ERFA 4N2ZA 1RIRA 2GAUA 2CGOA 3POYA 3GBGA 3VZLA 4FQZA 3NAPC 1JYIA 3MUZ1 4FSJA 1COV1 1X50A 5G05L 4NO4A 3VD4A 1RINA 1KITA 5C3SA 5JDBA 5I0UA 3B9CA 4DXZA 1TNFA 2XLGA 1PK6C 4PDWC 2ZXQA 1VMHA 2HWF2 2BVVA 4IE0A 3J9SA 4DPNA 5B6SA 4ZY9A 4AFBA 1KD7A 4BYYA 1HV1A 1J84A 4R9DA 2UYAA 2WZEA 4QQOA 4GWIA 4MHRA 1W05A 2VTXJ 1NA1C 3MBWA 1UWWA 5GLRA 1WLCA 1XB9A 3NJZA 1GFF2 3I3DA 3PIGA 4C91A 3RNSA 5KBFA 2JB4A 5FXXA 5L7OB 3BU0A 4OHVA 3Q8AA 2VW1A 5FYYA 1FNYA 2ZX1A 1AL0G 1OUXA 1H2LA 5GZFA 1DYKA 2QZ3A 1EPZA 5CAZA 1OVPA 1WMDA 3VUOA 3ZYRA 2RJLA 2XUMA 1W9WA 2R0FA 2WIIB 1YJLA 2ZMLA 1RUE1 1YEWA 2D6PA 4FVVA 5LBEA 3RZHA 2NP0A 3NQHA 3VBFA 1JZ4A 1NZIA 4XCBA 4C1WA 1LNSA 2ZKNA 5FMOS 5D21A 3RS6A 3M3EA 3KGZA 1UKGA 2ZHNA 1YJKA 3N35A 4BQWA 5JR7B 4MZUA 4CDQB 3GZUC 4LPLA 1SMVA 3E1F1 4LE4A 5LBCA 2Q0AA 1HW5A 3Q9OA 1D4M2 1RUC3 3VBUA 1ZVFA 1QNWA 2IWGB 4ATEA 3QLQA 2AYHA 3ZDVA 4GMP0 1MS0A 3UV9A 2O14A 4FFHA 4EN7B 4IEYA 2VC9A 5DAQA 3RJRA 3DL3A 1UKRA 2G9FA 5CFDA 3WW1A 4N2RA 4LBKA 3T2QA 4IV3C 1F5JA 5D8AA 1NQJA 2GALA 3H1WA 4RFRB 4XTMA 4XXPA 2WZ8A 1VP6A 4RHV3 4D47A 3ZMNA 3WASA 3EO6A 3VDBA 1HN0A 2VE1A 4JTNA 4BIFA 4QXKA 4Y20A 5SV5A 3SH5A 4TZDA 1W6NB 4L0PA 3SNMA 3CQOA 5LK7B 2YU2A 2PHTA 2PYTA 1JZ3A 1TVGA 5L9BA 4ZHNA 3QZ4A 3N9LA 4JTOA 3LEKA 4MGYE 3WPYA 1DIWA 1H4HA 4YG6A 1CAUA 2PHFA 1DQ2A 3ZYPA 1DDLA 3I2OA 1HKDA 2QQPA 2DU0A 1R092 4Q4X1 4BK4A 5LEKA 2FCVA 5FZKA 4UOJA 3V56A 5GLQA 2VZQA 2WFF2 4C0BA 4CEWC 3WNKA 1PVC1 2JICA 1IHMA 4ZZ5A 2CDOA 2IFWA 1BK1A 1XNAA 2VZ3A 4AVAA 1SEFA 1JZ7A 2RE9A 1U5ZA 3MIBA 1W18A 2C0ZA
chains in the Genus database with same CATH topology
3OM7A 3LIHA 5AYEA 5AY9A 3C7EA 3HBKA 3WPUA 3VSFA 4O8NA 5FLWA 3IMMA 3KF5A 4FFFA 5AYDA 3KF3A 4UFJA 4PVAA 5ANNA 3ZXJA 3LF7A 3VT1A 1YRZA 3WN2A 5JOYA 4HXCA 3VSSA 5FMCA 2YFTA 3AKGA 4UDIA 2ADDA 3ZR6A 2QQWA 3LDRA 3ZXKA 3BYKA 4CCEA 2X8FA 4N2ZA 5JOXA 5A7VA 3WMZA 5AYCA 1Y7BA 4B1MA 5B6TA 2X8SA 4UFHA 3D61A 3QEFA 3LEMA 4KCBA 5JOWA 4JQTA 1UV4A 3VT2A 1PT2A 5B6SA 5FIXA 3TAWA 4O8OA 4QQSA 2QQVA 4UDKA 4AK5A 1W2TA 5GLKA 5GLRA 3PIGA 1GYEB 4CCDA 5GLOA 3AKFA 3UGFA 3OM6A 3U1XA 1WL7A 5GLLA 2YFSA 4O8PA 3U14A 2QQUA 3LV4A 4UDKE 2YFRA 3D60A 2ADEA 3OM2A 4FFIA 3PIJA 5GLMA 2VDTA 3ZR5A 3C2UA 3WN1A 3NQHA 4EQVA 1Y9GA 3UGGA 3C7FA 2EXIA 4AK6A 2AEYA 3H3LA 1OYGA 4NOVA 3R4YA 3K1UA 3BYLA 2OXBA 3KSTA 3C7GA 2AEZA 4KCAA 1ST8A 5FK7A 3R4ZA 3D5ZA 4PVIA 3D5YA 1Y4WA 4COTA 3VSRA 3P2NA 5FMBA 4KMIA 3WAUA 4B1LA 4KC7A 3WPZA 3CU9A 5C0PA 3NMBA 4UFIA 2AC1A 3U75A 3C7HA 4FFHA 4ONZA 1UYPA 3OM4A 3OM5A 4N2RA 5FKCA 5GLPA 3QEDA 4AZZA 3BYJA 1VKDA 1YI7A 3WN0A 4UFKA 3VT0A 4U6BA 4CCCA 4U6DA 5FKBA 4MLGA 4D47A 5FMDA 4UFMA 3WASA 3WMYA 5JOZA 3WPVA 5A7VB 3SC7X 3AKIA 3ZXLA 5A8DA 3QZ4A 4UDGA 3LFIA 3LDKA 3QC2A 4UDJA 1GYDB 3C7OA 3WPYA 4AK7A 3VSZA 3WATA 3UGHA 3OSDA 3RWKX 2EXKA 4QHZA 3BYNA 3QEEA 4N4BA 1Y9MA 2B4WA 5FK8A 3LIGA 2XQRA 5GLQA 5GLNA 5A8CA 4KC8A 3AKHA 4FFGA 2EXHA 1GYHA 3S5QA 1W18A 2EXJA 3R67A 2X8TA 4N1IA 1YIFA 4UFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OM7 A;  3LIH A;  5AYE A;  5AY9 A;  3C7E A;  3HBK A;  3WPU A;  3VSF A;  4O8N A;  5FLW A;  3IMM A;  3KF5 A;  4FFF A;  5AYD A;  3KF3 A;  4UFJ A;  4PVA A;  5ANN A;  3ZXJ A;  3LF7 A;  3VT1 A;  1YRZ A;  3WN2 A;  5JOY A;  4HXC A;  3VSS A;  5FMC A;  2YFT A;  3AKG A;  4UDI A;  2ADD A;  3ZR6 A;  2QQW A;  3LDR A;  3ZXK A;  3BYK A;  4CCE A;  2X8F A;  4N2Z A;  5JOX A;  5A7V A;  3WMZ A;  5AYC A;  1Y7B A;  4B1M A;  5B6T A;  2X8S A;  4UFH A;  3D61 A;  3QEF A;  3LEM A;  4KCB A;  5JOW A;  4JQT A;  1UV4 A;  3VT2 A;  1PT2 A;  5B6S A;  5FIX A;  3TAW A;  4O8O A;  4QQS A;  2QQV A;  4UDK A;  4AK5 A;  1W2T A;  5GLK A;  5GLR A;  3PIG A;  1GYE B;  4CCD A;  5GLO A;  3AKF A;  3UGF A;  3OM6 A;  3U1X A;  1WL7 A;  5GLL A;  2YFS A;  4O8P A;  3U14 A;  2QQU A;  3LV4 A;  4UDK E;  2YFR A;  3D60 A;  2ADE A;  3OM2 A;  4FFI A;  3PIJ A;  5GLM A;  2VDT A;  3ZR5 A;  3C2U A;  3WN1 A;  3NQH A;  4EQV A;  1Y9G A;  3UGG A;  3C7F A;  2EXI A;  4AK6 A;  2AEY A;  3H3L A;  1OYG A;  4NOV A;  3R4Y A;  3K1U A;  3BYL A;  2OXB A;  3KST A;  3C7G A;  2AEZ A;  4KCA A;  1ST8 A;  5FK7 A;  3R4Z A;  3D5Z A;  4PVI A;  3D5Y A;  1Y4W A;  4COT A;  3VSR A;  3P2N A;  5FMB A;  4KMI A;  3WAU A;  4B1L A;  4KC7 A;  3WPZ A;  3CU9 A;  5C0P A;  3NMB A;  4UFI A;  2AC1 A;  3U75 A;  3C7H A;  4FFH A;  4ONZ A;  1UYP A;  3OM4 A;  3OM5 A;  4N2R A;  5FKC A;  5GLP A;  3QED A;  4AZZ A;  3BYJ A;  1VKD A;  1YI7 A;  3WN0 A;  4UFK A;  3VT0 A;  4U6B A;  4CCC A;  4U6D A;  5FKB A;  4MLG A;  4D47 A;  5FMD A;  4UFM A;  3WAS A;  3WMY A;  5JOZ A;  3WPV A;  5A7V B;  3SC7 X;  3AKI A;  3ZXL A;  5A8D A;  3QZ4 A;  4UDG A;  3LFI A;  3LDK A;  3QC2 A;  4UDJ A;  1GYD B;  3C7O A;  3WPY A;  4AK7 A;  3VSZ A;  3WAT A;  3UGH A;  3OSD A;  3RWK X;  2EXK A;  4QHZ A;  3BYN A;  3QEE A;  4N4B A;  1Y9M A;  2B4W A;  5FK8 A;  3LIG A;  2XQR A;  5GLQ A;  5GLN A;  5A8C A;  4KC8 A;  3AKH A;  4FFG A;  2EXH A;  1GYH A;  3S5Q A;  1W18 A;  2EXJ A;  3R67 A;  2X8T A;  4N1I A;  1YIF A;  4UFL A; 
#chains in the Genus database with same CATH topology
 4IXL A;  1TMF 2;  3VKN A;  4QX3 A;  4W65 A;  3ZFG A;  1ZBA 3;  4HSJ A;  2VXR A;  4HL0 A;  5FUI A;  1CD3 G;  5FZD A;  2OZ6 A;  3NO8 A;  4D7Y A;  3DYO A;  2WNV A;  3UL2 A;  3P3N A;  2RR1 1;  3WDY A;  1QKQ A;  1RVF 3;  5E16 A;  1TME 2;  3FFQ A;  4UDI A;  1HJG A;  3MGU A;  4E4Z A;  3AKR A;  3CIH A;  3WEZ A;  4I0B A;  4XMA A;  1RHI 1;  1GZW B;  2A6Y A;  2VR4 A;  1YQ8 A;  2XQX A;  4K40 A;  4XJ9 A;  3SEE A;  3HVD A;  1IQD C;  2VH9 A;  1DHK B;  4CDU B;  5FOB B;  4HN0 A;  2ZAB A;  1DGW X;  2R1B A;  3APB A;  3N7J A;  4Q0U A;  5IUQ A;  2RM2 1;  2VUC A;  4AED A;  1VBC 3;  5F37 A;  4YW7 A;  4S2G A;  4CUG A;  4QKN A;  2BER A;  1H8T A;  1X8E A;  2QQV A;  1W6O B;  1A3K A;  3AP9 A;  5GKA C;  2VMC A;  4CPB D;  4N43 A;  4DRR A;  1COV 2;  1XE8 A;  1S2B A;  4EV0 A;  2HWC 3;  5IK4 A;  3AKF A;  1AR6 1;  2YGL A;  1IOA A;  1UF2 C;  5GZE A;  5E88 A;  5BNO C;  1C5H A;  4QU2 A;  2GSY A;  1IPS A;  5AFE A;  5FZ7 A;  1UNB A;  1JYW A;  3M4F A;  3LV4 A;  2YG0 A;  3OUH A;  3ES4 A;  1O3S A;  1VB4 A;  3FLT A;  4YG3 A;  4NVP A;  4YZ4 A;  4ZON A;  1YFU A;  3B00 A;  4AAX A;  3RZG A;  3C7F A;  2QTW B;  4Y5T A;  4DXR A;  2JEC A;  1WBL A;  3GCX A;  3CHX A;  1AR7 1;  1K5M B;  3AC0 A;  2K2S A;  2PXJ A;  4ZXK A;  3WD5 A;  4ET7 A;  1HJF A;  4IW3 A;  4YM2 A;  4NWW A;  5GLU A;  1JYT A;  3Q8E A;  2C9A A;  4X8N A;  5DAW A;  2V5D A;  3GAL A;  4UAP A;  1DQ1 A;  5J09 A;  4OI2 A;  4Q4V 2;  1QJX 1;  1O3T A;  4MXW B;  4IUG A;  5A7N A;  5APA A;  3GBW A;  1QIQ A;  5BY5 A;  5C5T A;  1RUE 2;  2RS1 1;  2BP6 A;  3S7E A;  1AF9 A;  5J1X A;  2WWS A;  4K21 A;  3GCW A;  4RS5 A;  4FO9 A;  5H9Q A;  5I0S A;  1AXY A;  1AYM 3;  2ZCW A;  1DQ5 A;  5C8C A;  4QDR A;  4AI3 A;  1VBE 1;  2E31 A;  3DEM A;  1DFQ A;  4MH0 E;  2ZGP A;  2ZHL A;  1W9S A;  5JPN B;  1QOO A;  1DYO A;  4LE3 A;  1GKB A;  3H3Z A;  2VUL A;  4LIV A;  3WR0 A;  1H1M A;  4DOU A;  5JLV A;  1VR3 A;  4FOW A;  5B4N A;  4HMZ A;  2WSV A;  5L9V A;  3JXS A;  3OYW B;  1BKZ A;  1HB3 A;  4ASL A;  1EV1 3;  3WPV A;  5FJK A;  3VBH A;  2HJI A;  4UI9 L;  1X33 A;  2P3Y A;  4CDW B;  4FAH A;  4FPY A;  4MHU A;  2XWB B;  2GDF A;  1W04 A;  2Y0O A;  2R16 A;  4QXC A;  5CA6 A;  3QBQ A;  2RS3 1;  2W5F A;  2LW8 A;  4JGY A;  4OYU A;  5I93 A;  4GJY A;  1QMJ A;  2A6X A;  4XUR A;  3W20 A;  2HWD 2;  1YFY A;  1ASJ 1;  4MSV A;  2WR9 A;  4XW3 A;  3VD9 A;  4M0N A;  1VAM A;  4AFA A;  5BNP B;  1D7P M;  4A2U A;  3AKH A;  5T54 A;  3SKJ E;  4BQ5 A;  1O4Y A;  2ZPX A;  4MV2 A;  3JQX A;  5CFC A;  2OII A;  4YYO A;  4L92 A;  5ABJ A;  1REF A;  2NQY A;  5A3O A;  4UFL A;  5C71 A;  2HBT A;  2JE8 A;  2FD8 A;  1M4W A;  3C7E A;  5J36 A;  2BW8 A;  3ACH A;  5KC6 A;  2W3J A;  5KHJ A;  1BJQ A;  4Q4X 2;  3WXP A;  1JOJ A;  4RFT 0;  4OCT A;  4RR3 A;  1QH7 A;  3I2J A;  3IPV A;  3KS7 A;  2X5I C;  1JW6 A;  2Y8K A;  5ANN A;  1DGW A;  3AZY A;  2C6S A;  3LSE A;  3FUQ A;  1HRV 1;  4CCJ A;  4E2S A;  1I9R A;  4PIZ A;  4E2Q A;  4Q4W 1;  3ZR6 A;  2VTX A;  3BCW A;  2IFR A;  4JKL A;  4P9X A;  4YAR A;  3V0A B;  1SFP A;  4NHL A;  5FYH A;  1UZZ A;  3O12 A;  3C3V A;  3DGT A;  4LEJ A;  1US3 A;  4IV1 C;  2QE3 A;  3E5Q A;  2AZ5 A;  3AXD A;  4KCB A;  3LEM A;  3ZYG A;  2JDP A;  1ND3 C;  3CL1 A;  3R4U A;  5CVR A;  1NXD 1;  4Q4Y 2;  3RMX A;  4EN6 B;  1MZF A;  2K9Z A;  4ES8 A;  4P02 B;  2JB8 A;  2UU8 A;  5DAX A;  1N3O A;  2XKP A;  4JDO A;  4LOS A;  4QQS A;  1FOD 2;  1OXC A;  1YFW A;  1RHI 2;  2B9U A;  2DCY A;  5GZG A;  2RS5 2;  5DDJ 2;  2AAC A;  1C8M 1;  2OZJ A;  3WOG A;  5K0U B;  3FFZ A;  5DAP A;  4CCD A;  1CR7 A;  2YHJ A;  2JDK A;  3T1L A;  2VUA A;  3O1S A;  4QB2 A;  2JG9 C;  5C3O A;  4G9S B;  2DU1 A;  2RM2 2;  5CIS A;  2ZGL A;  5DG1 A;  4YZ5 A;  4Z2A A;  1R1A 1;  1LKN A;  3MLK A;  4G4F A;  2D6N A;  5FBZ A;  1OF3 A;  2XJU A;  2R49 A;  3MF6 A;  3PVN A;  3OM2 A;  2W52 A;  1MS9 A;  4AFD A;  1NCQ B;  3X29 B;  1SAC A;  4DUV A;  5GLM A;  1MPX A;  3MI8 A;  4KWL A;  2WZR 1;  3OBA A;  1UYZ A;  5GLW A;  3WN1 A;  5LK5 A;  3HNY M;  4EE2 A;  5JSR A;  4JGZ B;  2QZ2 A;  4UF0 B;  1AR6 2;  1G9A A;  2PLV 1;  4B3N A;  2VM9 A;  2P6C A;  5A7P A;  2RDS A;  3WZ1 A;  4R9A A;  1CAX B;  1GZT A;  1SHW B;  1UQX A;  3ZYI B;  1DLC A;  1PM7 A;  1QJY 1;  4KMI A;  2WA3 A;  3E6B A;  2IUW A;  1REE A;  1SDD B;  1G8W A;  1PZ8 A;  2R07 2;  2W1Q A;  4MYE A;  3VN4 A;  1BMV 1;  2BNM A;  3TNQ A;  3E6D A;  4IEV A;  4QAW A;  1GLH A;  5H9S A;  1X82 A;  3GZT B;  1JOP A;  2ZX4 A;  2VXJ A;  4OUM A;  1MQT C;  1CWP A;  1G7Y A;  2BV4 A;  4SBV A;  1IZ3 A;  2Y6F A;  1JN2 P;  5GLP A;  2XJQ A;  4OMC A;  4CDQ A;  4YW1 A;  2R06 3;  3S57 A;  5KXD A;  1RMU 2;  1WCD J;  4Q27 A;  2E7A A;  4HLT A;  4CDX C;  3ME2 A;  3WN0 A;  1EP0 A;  1UD1 A;  2P5B A;  2JE9 A;  3AP6 A;  1WW4 A;  5JI7 A;  5C3R A;  1N47 A;  4K1Y A;  3B94 A;  4Y1V A;  4R8H A;  1ULO A;  1W8O A;  3KHC A;  1VBA 2;  1TG7 A;  3SC7 X;  4Y3O A;  3H7Y A;  5CEH A;  2DTW A;  1IQA A;  1S0I A;  1SCR A;  3DYM A;  1VMF A;  4QD2 A;  5KHK A;  4AI9 A;  3AKP A;  4XFC A;  1HQL A;  3WAT A;  3ZKY A;  4I02 A;  3KQ4 B;  3ZPY A;  2P3I A;  3RWK X;  2VVD A;  4AF9 A;  3LFM A;  1CON A;  1IG3 A;  3K2O A;  1BQP A;  3KD4 A;  1MS8 A;  4Q0S A;  4UXA A;  2A3Y A;  4CEY B;  1EUT A;  3E97 A;  2R32 A;  4LK6 A;  2XJS A;  3LIG A;  5EYY A;  2Z79 A;  4D6S A;  5T55 A;  5FZ4 A;  4KBB A;  1RUJ 2;  1O8P A;  3I2D A;  2JDM A;  3R67 A;  4KG0 A;  1V6M A;  5LWB A;  2X8T A;  4ZU5 A;  4BLJ A;  3R4D B;  5FXW A;  4QPG C;  3TN9 3;  2RS3 2;  3M3O A;  4Z07 A;  3I3M A;  2RMU 3;  3MV0 1;  1FPN 3;  4E4D X;  1ASJ 2;  2PQS A;  4NE9 A;  4XFB A;  3UET A;  1DCS A;  1N1V A;  1KJR A;  3ZSE A;  5A3L A;  2R04 1;  4GH4 A;  1MEC 2;  1R08 3;  2P34 A;  3ACI A;  3AKG A;  3CF6 E;  3WW4 A;  3T3Y A;  1KFX L;  3JBG 3;  3R4S A;  4LLO A;  2EF6 A;  1Q5O A;  1VRH 1;  3MZH A;  1SBE A;  4QKD A;  4PJY A;  1WGP A;  5CAD A;  2YUE A;  3GDB A;  3ZVX A;  2FDF A;  2PFW A;  4LXL A;  5BUV A;  3ACL A;  1JS9 A;  2QCS B;  3WG3 A;  3ALQ A;  4Q4W 2;  2FDK A;  4HKW A;  3SH4 A;  1ULE A;  3T0A A;  3BKZ A;  1V9U 2;  5FBJ A;  2WBK A;  4Y4R A;  1GU3 A;  1GMM A;  4U36 A;  3UT0 A;  1LOA A;  4KGQ A;  1LB2 A;  3RZZ A;  4U6D A;  2HKX A;  1CAV B;  1JUH A;  4OI1 A;  3SCF A;  3U1X A;  4RYD A;  1EUU A;  1RUF 3;  1W6O A;  4EN0 A;  3KWV A;  2BVB A;  2MPF A;  5IW0 A;  4X6Q B;  4YVS B;  2ZEY A;  1JZ2 A;  4GKX A;  2YFR A;  1NXM A;  3HIF A;  1P8J A;  4ITC A;  1YQC A;  5DZG A;  4EQV A;  2Y38 A;  4LBQ D;  3DN7 A;  5LEJ A;  3SXW A;  2FMY A;  3BYL A;  2HYX A;  4XJA A;  3RQ0 A;  1Z7S 1;  4WM7 B;  3R4Z A;  3AK0 A;  3TAY A;  2DCK A;  1R1A 2;  1D2S A;  1JUI A;  3P3P A;  2A6Z A;  1H1A A;  2XL9 A;  2VPV A;  3NMB A;  3U4X A;  3VBO A;  4PLO A;  3ZYF A;  3ORJ A;  2IXC A;  2WZR 2;  4K9S A;  4W6X A;  1K5M A;  1A8M A;  4AK3 A;  1SG3 A;  1QWR A;  4COU A;  4TSV A;  4FPJ A;  4KL1 A;  3N36 A;  2RJ2 A;  4M00 A;  3N4M A;  3JD7 1;  4WBB A;  4MXW A;  3NNJ A;  3GZA A;  4JQR A;  1QJY 2;  2XKO A;  4LQR A;  1QJZ A;  3FL7 A;  1SZB A;  3B02 A;  3HJR A;  1CN1 A;  1D0H A;  3M8L A;  1HB2 A;  4CU9 A;  4E2G A;  4FTS A;  1BMV 2;  1PO2 1;  4QQ2 A;  2Y6J A;  2AGS A;  3PUH A;  1UX7 A;  2JE7 A;  3AKI A;  1AX1 A;  2WS9 1;  4YM3 A;  5HPO A;  1UPI A;  1W0N A;  1W6M B;  2W92 A;  3GYD A;  4GUL A;  4TWT A;  3WG4 A;  2JG8 C;  1A8D A;  3LFI A;  3LDK A;  5EXO A;  3OY8 B;  1ZA4 A;  4XE9 A;  5FZO A;  4JCK A;  1QDO A;  3TWI A;  3FHQ A;  3OYW A;  3WQ7 A;  1AHS A;  1QXP A;  5FLI A;  1FYU A;  5A1A A;  4FOV A;  4NII A;  2E7T A;  3I4I A;  2PHL A;  1SLC A;  4F8A A;  4LNV A;  4QGM A;  2XQR A;  5CIR A;  1AX0 A;  3GGL A;  2LUW A;  1DQ0 A;  1GQH A;  2DWR A;  4CDW A;  2ZAA A;  3WW2 A;  1B35 B;  2DUP A;  2HWB 3;  4OHY A;  2RG4 A;  5AYD A;  3AYD A;  2F17 A;  2Q8E A;  2ILM A;  2WNU C;  3BYW A;  1Q43 A;  1WW7 A;  1EAH 1;  4O65 A;  3ZN4 A;  4CZS A;  4COZ A;  4U2A A;  4YFZ A;  5BNP A;  2WO1 A;  4H7M A;  5FZI A;  4WVZ A;  2NMN A;  2VZ1 A;  2D98 A;  3J8F 1;  4ZS3 A;  3ITQ A;  2ZEX A;  1BHG A;  1L7Q A;  3RYK A;  1WLD A;  4D0Q A;  2EIE A;  3GJA A;  1W28 A;  1MVE A;  5AYC A;  2HWC 1;  4UWD A;  4Y24 A;  3FMG A;  3O5S A;  2CAU A;  5JXG A;  4NIG A;  3VBS A;  2VAU A;  4GKY A;  5FZ3 A;  1Q8P A;  1F9K A;  2WJS A;  1LCL A;  1NCR A;  4JQT A;  2A3W A;  4WVW A;  2XJR A;  5CG8 A;  1HXS 3;  1LOD A;  2IXL A;  2JKB A;  4XHB A;  3AB0 A;  3T4H B;  1YIP A;  2X29 A;  1OQD A;  4CE8 A;  3V0A A;  3OJB A;  2K0G A;  1A6C A;  2WWJ A;  1CX1 A;  4HG6 B;  2D3S A;  3IDC B;  2VMI A;  4XC9 A;  1UY1 A;  5TSW A;  3LPF A;  4UDK A;  3GHM A;  4BXF A;  2BNO A;  3OEB A;  4JRA A;  4XVH A;  5GJ6 A;  2BTV C;  1ACC A;  1OHF A;  2WLP A;  1WA6 X;  1OA3 A;  4QKB A;  4JKK A;  1W0O A;  2HWF 1;  4AGR A;  4CUC A;  5FYC A;  1JBC A;  1OLR A;  3R6S A;  4LK7 A;  5IHR A;  1KS4 A;  3I3Q A;  1BXH A;  4L97 A;  1EPW A;  1LHW A;  3VBR B;  1S0E A;  2E53 A;  3NNL A;  4LBN A;  3RI9 A;  2HEV F;  4KGG A;  2PMW B;  5F6L B;  4MLO A;  1IS6 A;  1NY7 1;  3VBF C;  2VJX A;  4NOV A;  3BTX A;  3R4Y A;  1C3H A;  2QQN A;  1JU3 A;  1H9P A;  2DF7 A;  4XJU A;  2KM2 A;  1GZ9 A;  3POG A;  1W8H A;  1LGN A;  1EV1 1;  2HH9 A;  3V0B B;  2LTN A;  4OLL A;  2WO7 A;  1C8N A;  2ZGM A;  5T5O A;  2ARB A;  3IIA A;  4JGZ A;  5FZL A;  2JD4 A;  2VBD A;  3AMP A;  4RL7 A;  3C7H A;  1CJP A;  4QB1 A;  1C1L A;  1NQD A;  3VBU C;  2PHD A;  2C5D A;  1OUR A;  4GD4 A;  3W21 A;  3WF3 A;  5IVF A;  4EZ4 A;  1CAX A;  1N3P A;  2JWP A;  4OI0 A;  4GB3 3;  1NE6 A;  4QPI A;  3NJX A;  4XFH A;  3WP4 A;  3OPZ A;  3GZE A;  2R30 A;  4E9K A;  5CFD C;  5F3E A;  3WHU A;  4WVM B;  1GYK A;  2CAV A;  4JHZ A;  3T4V A;  1D4M 1;  2D93 A;  1OOP A;  1EYB A;  1W3V A;  2CSG A;  3BVC A;  2WDB A;  2O8O A;  3ECQ A;  5D8A C;  4L11 A;  2UWB A;  3IDA A;  5CKM A;  3GF6 A;  4KQ7 A;  5JAX A;  5A7V B;  2B9V A;  3NAP B;  4XHX A;  1LHN A;  3AKS A;  4YGC A;  2VCB A;  1NKG A;  3AFK A;  2H6C A;  3ZFF A;  1POV 3;  3SIT A;  5A8D A;  1OBN A;  4XUN A;  4PDW B;  4CXX A;  5J7M A;  3NV3 A;  2YZ4 A;  4XBQ A;  1RTV A;  2ARX A;  2VVE A;  5LBF A;  4AAP A;  5FO7 B;  5J37 A;  1NLQ A;  4QT6 A;  1IGO A;  4LA3 A;  3IAP A;  3KHB A;  1X36 A;  4CCM A;  4BDV B;  1N1T A;  2K46 A;  5FO9 B;  3O1R A;  1NA1 B;  1N1S A;  3VZJ A;  1D2Q A;  2ES3 A;  2WS9 2;  2A6V A;  3UJO A;  4MUV A;  4NPL A;  4XYX A;  4EJR A;  1E5R A;  1ULD A;  1XE0 A;  1CZT A;  4BJ0 A;  1ZBA 2;  1V6N A;  4PF5 A;  4AQ6 A;  1OA4 A;  1Y43 B;  3FWE A;  4YM1 A;  4Z8B A;  4M0H A;  1T2X A;  3JQW A;  4CEY A;  1WMF A;  4KG8 A;  5F32 A;  3C8X A;  3DPR B;  2BJS A;  1RVF 2;  2WFF 1;  3A0N A;  4FFF A;  3ZFG C;  1LOF A;  4D8M A;  2W08 A;  4NRQ A;  2IVJ A;  2ORZ A;  2G9G A;  2JD9 A;  3CMG A;  4RA0 A;  5FPZ A;  4ARY A;  5JOY A;  2WNV C;  2GC0 A;  4K3U A;  4MGZ E;  3ZDS A;  4C0H A;  1VJ2 A;  5FMC A;  2YFT A;  4FQ4 A;  1ZZ8 A;  2ADD A;  1GAN A;  3EYP A;  3LDR A;  2GMM A;  1TMF 1;  2QVS B;  4Y4Y A;  5CU1 A;  5FQ0 B;  2G1M A;  4CCE A;  4CTE A;  3BYK A;  1VBD 3;  2J42 A;  2ARA A;  4I30 A;  1XND A;  3HD8 B;  1NOV A;  4A42 A;  3N7M A;  1ONA A;  3FE5 A;  4B1M A;  1UMH A;  4BK5 A;  1VBC 2;  5EP9 A;  2P2K A;  4MET A;  4M4R A;  4RN5 A;  1W9Y A;  1YNA A;  4X8P A;  3K3N A;  3J8F 2;  1VAL A;  3EMR A;  2XML A;  3OBT A;  4IV3 B;  4AED C;  4HVQ A;  4O8O A;  2GU9 A;  2HWC 2;  4CP0 A;  5IK7 A;  1YC6 1;  4CCL A;  1CIY A;  4AVV A;  2A3X A;  4MXV A;  4RQP A;  3IT8 A;  1H8T C;  2IXJ A;  2VBB A;  2FMD A;  2ZGN A;  2ZGQ A;  4G3Y C;  1NYW A;  1DBN A;  3ZYB A;  5JZG B;  1SBD A;  3NNM A;  4BQ4 A;  1VRB A;  3DV8 A;  4DZG A;  1JH5 A;  1WCQ A;  3I49 A;  4QXB A;  4XQW A;  3URF A;  1JHN A;  1CX4 A;  3QCW A;  3QH6 A;  5FDB A;  4TTG A;  1AZD A;  4DXS A;  5JXI A;  3ATG A;  4YVW A;  1ZBE 3;  4GWN A;  4XJZ A;  5L73 A;  3C2U A;  1MS4 A;  3B3Q E;  2YY1 A;  2Q1F A;  1CAV A;  3G7D A;  2E32 A;  3PVE A;  4DIQ A;  3MW4 A;  1LGC A;  5FWJ A;  3I2G A;  3RPQ A;  4CU8 A;  5IK8 A;  3CJX A;  3FN9 A;  1F4A A;  2X05 A;  1FI2 A;  4KWJ A;  5F39 A;  3D0S A;  3GBF A;  5A70 A;  2XBO 1;  1AYM 2;  1DF0 A;  5E1R A;  3NV2 A;  4P9G A;  1T6G C;  1W03 A;  5BNN B;  5F7U A;  3T08 A;  2JEM A;  3VDD B;  4CYD A;  1RUG 1;  3P6B A;  1AR8 1;  1NY7 2;  3LQC A;  4RS5 C;  4WM7 A;  1IG0 A;  4IGQ A;  1LOC A;  1QJF A;  3FC0 A;  5C8C C;  4HAN A;  4AZZ A;  4Q4V 1;  3AYE A;  2Z4F A;  1KDM A;  4I2O A;  1EV1 2;  1XNT A;  4J25 A;  4UFM A;  1S0D A;  5F5I A;  3KVB A;  2YPJ A;  5JOZ A;  5KC5 A;  1RC6 A;  4CCN A;  1N3Q A;  1AXK A;  1QF3 A;  3ABZ A;  3MIH A;  1U12 A;  4K1Z A;  2IXK A;  1HQN A;  5JCT A;  4XQD A;  3VBH C;  3VHO A;  1GBG A;  2RMU 1;  4P9J A;  3O0V A;  2XJV A;  3J26 N;  5A7Q A;  3NRU A;  5I8Y A;  1PO1 1;  1WWY A;  4LR4 A;  1MS1 A;  1GUI A;  4JGY C;  5FYV A;  1GR3 A;  4XEZ A;  1AL2 3;  5FZF A;  1A34 A;  1UU6 A;  2EXH A;  3N7L A;  4FFG A;  3SKV A;  4W4Z A;  3AKQ A;  3WIN E;  2VMH A;  3JBG 1;  4I0A A;  1RXG A;  2ZGO A;  2LS6 A;  1GP5 A;  1AYN 1;  2YC2 A;  5C9A B;  1UZ0 A;  3LIH A;  1S2K A;  5CFC C;  5ABJ C;  1BVP 1;  4XF0 A;  1JYX A;  3UKV A;  3M3I A;  1LUL A;  4CA9 A;  2HWD 1;  3AYC A;  3VSF A;  3IN9 A;  4D6R A;  2GZW A;  2QNK A;  3R0R A;  3NW4 A;  3LSD A;  4RR3 C;  4C1X A;  2QQW A;  2C9K A;  2WL1 A;  2VZT A;  2KR2 A;  3BOD A;  4XFF A;  1PX4 A;  3OBZ A;  1SPP B;  4IQP A;  4LKE A;  3T1M A;  5LCW L;  1US2 A;  3WUC A;  4H7L A;  4OZX A;  2HWE 3;  5FPA A;  5JOW A;  4IGP A;  2CGN A;  2KXL A;  2RHP A;  4QDS A;  4QX0 A;  5FTT C;  1FNZ A;  2Z2S B;  1H0B A;  3LZZ A;  1AUY A;  2CTV A;  1Z78 A;  1HQW A;  5A33 B;  1ND2 A;  2C1F A;  4I01 A;  4BH9 A;  4CUA A;  3RWN A;  1CVN A;  1OFN A;  2AR6 A;  2BFU L;  3ZN6 B;  1PIV 3;  3HBZ A;  3B93 A;  1W2T A;  2E7Q A;  3KV9 A;  3ASI A;  2ZX0 A;  5GZD A;  2Q8O A;  3T0B A;  3A4U A;  4UT5 A;  5LBB A;  4J1X A;  5GLO A;  1CZS A;  4Q4Y 1;  3KMH A;  4XAA A;  4FCA A;  3HT2 A;  1HRI 3;  2D7F A;  4NR1 A;  3RI8 A;  4PBO A;  5F5A A;  3MFA A;  2JDH A;  1FOD 1;  1FMD 3;  2QQL A;  3HN3 A;  1W6P B;  2ATF A;  4NMI A;  2RS5 1;  5DDJ 1;  5H9P A;  5A3T A;  3BIW E;  1IPJ A;  1QNY A;  3PUR A;  2V73 A;  2B7Y A;  1EY2 A;  4XFG A;  2VU9 A;  1HLC A;  2QJV A;  2VMF A;  4E27 A;  5J3U A;  3H3L A;  5A1L A;  4Q26 A;  5FWE A;  1IS5 A;  4JDM A;  1LEM A;  1WW6 A;  2BNN A;  1J1T A;  4WM8 B;  1YWK A;  5L9R A;  1GP4 A;  1SLT A;  2CWS A;  4HKL A;  4M3C B;  3B9I A;  3H8R A;  5FMB A;  3VSR A;  5IJR A;  3VBR A;  3LPG A;  4JKM A;  4BB3 A;  3OTF A;  3AXE A;  5FY5 A;  3D4K A;  2FCT A;  2B8M A;  2HLE A;  1Q3E A;  2W1W A;  3IZO A;  4GWJ A;  4AYU A;  1S2E A;  2R06 2;  2Y60 A;  3UNP A;  1NX9 A;  3KB5 A;  1F8V A;  3AVR A;  2XB6 C;  3MF9 A;  1ODN A;  3JUU A;  5HV0 A;  4CP9 B;  3V0B A;  2W46 A;  2R07 1;  4MOA A;  3K51 A;  2FDH A;  3VT0 A;  2XBO 2;  5IVE A;  1ZRD A;  4IGO A;  2OX0 A;  5FKB A;  3GXU A;  1RUH 3;  5SV8 A;  2HWB 1;  4IV1 B;  5IFT A;  2YGM A;  3GNE A;  5JXJ A;  1RUG 2;  3UES A;  5F1R A;  2Q30 A;  1G9D A;  3ZXL A;  1AR8 2;  4NOT A;  1DGR A;  2ZGR A;  2Y26 A;  1JOD A;  5AVP A;  1RMU 1;  5FP9 A;  2J1S A;  1SFY A;  1W2O A;  4WVM A;  4AGG A;  3C7O A;  2WYS A;  5F3I A;  5EIY B;  1IPK A;  2P17 A;  1O59 A;  3T0D A;  2A1X A;  2VZR A;  4HOO A;  2FQP A;  3CJI A;  5K7P A;  2EXK A;  1E5I A;  2VQU A;  3VDA A;  3OD4 A;  3FBM A;  4XFA A;  1OLM E;  3SCG A;  2LRP A;  1YLL A;  1VBA 1;  4N4B A;  1UIK A;  5KXB A;  3POJ A;  2PAM A;  5FK8 A;  3IB3 A;  1URX A;  2EAK A;  2FCU A;  3S5Q A;  4LKF A;  2R6Q A;  3TN9 2;  5K9Y A;  1YIF A;  2QBX A;  1S4C A;  1H9W A;  2RMU 2;  1WLT A;  4IL7 A;  1C4R A;  2V4V A;  1FPN 2;  1MR5 A;  2OPK A;  4FPG A;  4TLF A;  2DVB A;  5EFU A;  5AY9 A;  1PO1 2;  2E51 A;  5IT6 A;  4Q8K A;  2EID A;  1QJU 3;  1QEX A;  2B4K A;  2GN3 A;  1NLR A;  2MEV 3;  2Q4S A;  4NAM A;  2XHN A;  1E57 A;  5D2A A;  3USS A;  3Q8F A;  1RUJ 1;  4BQY A;  3O1U A;  1J59 A;  2PTM A;  5CBL A;  2YU1 A;  4HZF A;  5DN2 A;  1V6L A;  3KV5 A;  4XQ4 A;  1GNZ A;  3JBG 2;  1OH4 A;  2JDA A;  4GH4 C;  4MGI E;  1AYN 2;  3EB7 A;  5FLH A;  2RVA A;  2X8F A;  4AEJ A;  3DPR A;  3MW3 A;  2L9L A;  4K20 A;  1ALY A;  1W99 A;  1FAY A;  1CAW A;  4HN1 A;  4A6O A;  5B6T A;  2Q5T A;  2XON A;  1VAK A;  3AMM A;  3ZXE A;  1MEC 1;  2WQZ C;  3OGV A;  4QB6 A;  1ZZ6 A;  3VB9 A;  3TEZ A;  1O91 A;  4A7Y A;  4L8Q A;  4YWA A;  2CL2 A;  3EXU A;  4CU7 A;  1TQ5 A;  5M0T A;  2JKX A;  5KR7 A;  4O7X A;  5FYZ A;  3M3C A;  4RGA A;  5IAX A;  5HCF A;  1OUS A;  1GOF A;  5C70 A;  1AJK A;  2ZKL A;  2TEP A;  4IE5 A;  4QGL A;  4CDX B;  4AK5 A;  1IS3 A;  3HT1 A;  1DU3 D;  1H4G A;  2OUH A;  2DUR A;  1YHF A;  3ENR A;  3HN1 A;  1GYE B;  4TLG A;  3H7J A;  3EJK A;  3PVO A;  4DUW A;  1MAC A;  2HEW F;  4AWD A;  3LGR A;  5HCA A;  2XVK A;  4MGK E;  3WDU A;  4XIL A;  4LJH A;  4PHZ A;  5FYB A;  4K8F A;  3CNA A;  3PU3 A;  1SCS A;  1U0A A;  5T3N A;  1PVX A;  4LLF A;  3KVA A;  2CV6 A;  2JIJ A;  4BA6 A;  4MG2 A;  1WCS A;  1V9U 1;  3PLQ A;  3PIJ A;  1SLB A;  4PI0 A;  1UOJ A;  4PQQ A;  5JZG A;  1VIW B;  3U4S A;  1XXN A;  2F4P A;  4OUE A;  5FZ8 A;  5KHI A;  4FOY A;  2EXI A;  1PMJ X;  1Q8Q A;  2Y6H A;  2ZMK A;  3F2Z A;  2UUR A;  3HMY A;  3INA A;  4FP2 A;  5LY2 A;  3E5U A;  3J7H A;  3JB4 C;  3C7G A;  4GWM A;  1SDW A;  5CB7 A;  3WV6 A;  1Y4W A;  2PAK A;  5C33 A;  3P2N A;  2GN7 A;  4JAA A;  4QPG B;  5FY7 A;  1U5Y A;  3DXU A;  2GH2 A;  4ORF A;  3HEI A;  2CU5 A;  3BOP A;  4MGS A;  5A32 B;  1FX5 A;  3VV1 A;  2BBA A;  1POV 1;  5EZW A;  5KHG A;  2HYK A;  3VBO C;  3WG1 A;  4CU6 A;  1GQG A;  4RD7 A;  2DVA A;  1K5M C;  5FUN A;  3WY6 A;  5A6X A;  2DCT A;  4CVU A;  2Y6G A;  1MZE A;  1BEV 3;  1GNY A;  2DFC A;  1XNK A;  2FZ1 A;  2VMG A;  2E9Q A;  3KCY A;  2VO5 A;  3N9N A;  4EN8 B;  1KGY A;  1UU5 A;  3H42 B;  2W1S A;  4Q8L A;  1KFU L;  1RUD 3;  2C26 A;  2CDP A;  3SIS A;  5BNN A;  4FPK A;  4WZF A;  3VDD A;  1XE7 A;  2A6W A;  1WLW A;  4LTA A;  5BNQ A;  5C6C A;  5L7O A;  4OUL A;  1C57 A;  3WMY A;  1VMJ A;  4QMA A;  3MFC A;  3ZSJ A;  2AH2 A;  5FO8 B;  2J1E A;  5G04 L;  3F95 A;  3MHZ A;  5BV6 A;  4FPE A;  1OMI A;  4FBF A;  4UDG A;  3S30 A;  3N7K A;  4KI5 M;  4XPV A;  2PHR A;  5B2G B;  1WA4 A;  5IYY A;  3POS A;  2DVD A;  2KA3 A;  5I91 A;  2E63 A;  1W90 A;  3ZLI A;  2YBK A;  2D5F A;  3H1M A;  5FZB A;  1XYO A;  2D5H A;  3VZM A;  3SCH A;  3K48 A;  2HWB 2;  1Y9M A;  2B4W A;  5LY1 A;  2XG3 A;  2Z42 A;  4XCA A;  4YM0 A;  1G9F A;  1C5I A;  1UO9 A;  5A8C A;  1GYH A;  3N9O A;  4OHX A;  4IEX A;  4QHO A;  5FZ0 A;  4UBG A;  4CDW C;  3D82 A;  4NRP A;  1YQ2 A;  5F9T A;  3I7D A;  5ACA 3;  5I0D A;  2W2I A;  3WDW A;  4PF1 A;  5FLW A;  3M7A A;  3KF5 A;  4M3C E;  3ZFE B;  4KBZ A;  4IND A;  3KF3 A;  2OA2 A;  5AC9 3;  1LR5 A;  4LUM A;  5HCH A;  2ZX3 A;  3GM8 A;  5FZ9 A;  4LOT A;  4LBJ A;  5BNP C;  5FYS A;  1OQ1 A;  2C4X A;  5C9A A;  1BBT 3;  1LHO A;  3NV4 A;  5GLT A;  1COV 3;  3OPT A;  4SLI A;  3USU B;  5JOX A;  1M06 G;  2GNT A;  3QOP A;  4GMP 1;  3SH3 A;  1Q8O A;  1W6N A;  2QQO A;  3H8U A;  1HXS 2;  3AMN A;  3UK9 A;  4LIT A;  5FCC A;  4QQH A;  3NST A;  4QX7 A;  3AZW A;  4YW4 A;  5FZM A;  4B4R A;  3NWK A;  1XPW A;  4XUQ A;  3VBS C;  2XL7 A;  4M3C F;  3S6P A;  1NCR C;  4XET A;  4ATF A;  4ASM B;  2Y64 A;  4LO4 B;  4AI0 A;  5JMO A;  3V65 A;  1PNG A;  2GC2 A;  1LRH A;  4NAO A;  1W8T A;  1HV0 A;  4CRQ A;  4DS0 A;  2B39 A;  2VNO A;  4I0W B;  3FJS A;  3M3Q A;  1GOG A;  3THD A;  1GP6 A;  1XOY A;  4BWO A;  4DIN B;  4Z82 A;  4XZP A;  2YFZ A;  1RUE 3;  1JTZ X;  5A33 A;  3AZX A;  4BQ2 A;  1G9C A;  3U14 A;  3VL9 A;  3ZSK A;  1AR9 3;  2YXS A;  2RDN A;  5DZE A;  2LRO A;  4A3Z A;  1F35 A;  4GA9 A;  2UWC A;  4AEK A;  2JDN A;  3WP6 A;  4DMI A;  2VQ0 A;  3PUI A;  2I2S A;  3J7L A;  5A7W B;  1OYG A;  4LIU A;  2PHX A;  5EYX A;  2PHU A;  4NHM A;  3K1U A;  4BME A;  4KNC A;  4PBP A;  1W6P A;  1GZW A;  3B01 A;  3D5Y A;  2A71 A;  2WKK A;  5KXE A;  5LA9 A;  4C90 A;  3BB6 A;  5FRA A;  1UYX A;  2WNU B;  3ZXA C;  4A4A A;  4CDU A;  1RJ8 A;  3WDT A;  1K45 A;  4QKF A;  1STM A;  3KV4 A;  4LUK A;  1H2K A;  1HN1 A;  4HON A;  3VLB B;  4AHX A;  3I54 A;  4GB3 2;  4JGZ C;  4P9I A;  2DYC A;  2FHR A;  4P9Y A;  1Z0H A;  3OM5 A;  4WM8 A;  1RL3 A;  4BZ4 A;  3K77 A;  4M3C A;  3SMH A;  3WF4 A;  4DEQ A;  3IDE A;  1RUC 1;  1UZW A;  3QED A;  1OVS A;  2WWU A;  4LA2 A;  4P9L A;  1WME A;  3IM0 A;  2ZGT A;  3III A;  3LWC A;  4HK8 A;  4QPI C;  2HBU A;  2CGP A;  2D6O X;  3ZXG A;  1AL2 1;  2W47 A;  2V5Y A;  3I2H A;  1OOP C;  3K4D A;  2YC4 A;  2WNE A;  4NN0 A;  2VW2 A;  1LOE A;  4D7S A;  4COT A;  1L7L A;  4RHV 1;  5FY9 A;  4CP9 A;  1PX3 A;  3H1Y A;  1UIJ A;  3SQO A;  2O8Q A;  4JZR A;  4O9G A;  3ZFF C;  3VSZ A;  4YW3 A;  4XBN A;  4AI2 A;  1PVC 3;  3PVB B;  1KRI A;  3VHR A;  1W9T A;  2Y33 A;  2NYY A;  1W8Z A;  3TBD A;  3OB8 A;  2DCJ A;  5C4W B;  1GSL A;  1VPH A;  5T52 A;  2EXJ A;  4A7K A;  1XJA A;  4BQ1 A;  2XPJ A;  4XXA A;  5FZH A;  3POB A;  2WT0 A;  1W2U A;  3WLU A;  3O1O A;  2RR1 3;  3O1V A;  1J3P A;  2VNG A;  4AVT A;  5AYE A;  4A41 A;  2GH8 A;  2VCC A;  5T50 A;  2PAE A;  2ENR A;  2WLQ A;  1YYN A;  4JV4 A;  4DFS A;  1BLZ A;  3LKJ A;  4Y1X A;  1XRU A;  4X6R B;  5EHD A;  4E4S A;  2F4L A;  1LOF C;  2W0X A;  1ZBA 1;  1VBD 2;  5J48 A;  1I3H A;  2Q1Z B;  4ERO A;  4XDQ A;  2D6K A;  2GP5 A;  2XVL A;  3AMQ A;  5GLZ A;  1KDK A;  5EJ1 B;  1RVF 1;  1OQE A;  4PCR A;  3ST7 A;  3MPB A;  3MV1 1;  2GMP A;  1HRI 1;  3QEF A;  3AP7 A;  3WCR A;  2NM1 A;  4YZ3 A;  1JZ5 A;  1LOG A;  2OKX A;  1UV4 A;  5FYM A;  5LA1 A;  1PT2 A;  1G9B A;  3N9M A;  4BM8 A;  2D6M A;  3POE A;  1AR6 3;  5CFD B;  4XJW A;  2G19 A;  1V00 A;  3LA3 A;  2VTF A;  3OF1 A;  3O0X A;  4JRL A;  3UKN A;  5DG2 A;  5LAT A;  3ZX7 A;  2RDQ A;  2UY8 A;  1VBC 1;  2G4I A;  2VZO A;  4RGG A;  1Q56 A;  2XLA A;  4RQP C;  1S0J A;  1GZC A;  1L3J A;  2PA7 A;  2B45 X;  1W8U A;  3AZV A;  1LTE A;  2QFE A;  4XZU G;  3UGF A;  1O3R A;  1AVB A;  3K4Z A;  2XGX A;  2ZBJ A;  4Y20 B;  4O8P A;  4IE4 A;  2QQJ A;  2DCZ A;  4Z1V A;  4N8M A;  4HSL A;  1ZBE 2;  1AR7 3;  4QX2 A;  3D60 A;  2LAL A;  4UW3 A;  1F15 A;  3CZJ A;  1CAU B;  3VHP A;  5BYN A;  2XDV A;  1QJX 3;  4CCK A;  4YVW C;  1KJL A;  2JDY A;  4AK6 A;  3DKW A;  1TEI A;  1OPM A;  1W39 A;  2WAB A;  1QU0 A;  2F6B A;  2RS1 3;  4N53 B;  5FK7 A;  3D5Z A;  1TE1 B;  2HEY F;  4WVV A;  1I5Z A;  3WAU A;  1OPO A;  1RUH 1;  3AZZ A;  2CY6 A;  1R1Z A;  4IES A;  4B1L A;  1DQ4 A;  1VBE 3;  1OSG A;  1V70 A;  2UWA A;  1OD5 A;  1XYN A;  4FT8 A;  3KT1 A;  3TEW A;  1UYP A;  4LO7 A;  1J1L A;  1O5U A;  1WCU A;  2ZHK A;  2BGO A;  5A6Y A;  5LA2 A;  1UYY A;  2NLR A;  2WNV B;  2DDU A;  3BPZ A;  1MVQ A;  1H30 A;  3A22 A;  3DUI A;  4NPR A;  4WM7 C;  5LB6 A;  1YI7 A;  3ZSM A;  2FBE A;  1AYM 1;  4QU1 A;  5K0U A;  3I2I A;  4CCC A;  5A32 A;  4MLG A;  2H0B A;  4YSF A;  4BU2 A;  3S0M A;  4FTE A;  4IDZ A;  3RVH A;  3KCC A;  3VD5 A;  4Y1U A;  5FV3 A;  4HVO A;  2RS3 3;  5HXV A;  3WP5 A;  5HBA A;  2WQ8 A;  2BRT A;  5CKQ A;  4R9C A;  1O4T A;  1RUC 2;  1NCQ A;  1UMZ A;  3ILR A;  3S5A A;  1ASJ 3;  4NRM A;  5FMO L;  3VL8 A;  5ERL A;  2JDZ A;  3VDC A;  1QJU 1;  4AED B;  1UZY A;  3LOI A;  4UF0 A;  1AL2 2;  4Q0P A;  1XNC A;  2IZW A;  3IKW A;  4AE2 A;  2X09 A;  3BYN A;  1DLL A;  1H8T B;  3M2M A;  3MIF A;  4Q1P A;  3TRS B;  3HQU A;  4RHV 2;  3WNX A;  4MAD A;  3LE0 A;  3THT A;  3VZO A;  1UXZ A;  2XVG A;  2DV9 A;  4AQ2 A;  4BIO A;  1HRV 3;  1UZV A;  5F2W A;  5FYI A;  5T5L A;  3VGI A;  4EWE A;  5FLJ A;  1IS4 A;  4YZ1 A;  1U5X A;  3BTA A;  3LF7 A;  4LHN A;  1YRZ A;  4NHK A;  2DBN A;  1GQP A;  1PK6 B;  3OD0 A;  2B5H A;  1B09 A;  1O6U A;  2ZX2 A;  1LU1 A;  2Z5W A;  2VG9 A;  2WN2 A;  3JU9 A;  1E5H A;  3D3A A;  4LBM A;  5FZ6 A;  5FZG A;  3RZL A;  2Y6K A;  4NPM A;  2HWE 2;  4AGV A;  5LA0 A;  2X53 S;  5FP8 A;  2Z69 A;  5J98 B;  3W9A A;  1UL9 A;  5BPX A;  3ZFE A;  1KXG A;  5A3P A;  5GZC A;  2YC0 A;  4LBO A;  4JVA A;  3HQX A;  1QQP 3;  4UFH A;  4KU8 A;  1K42 A;  2A73 B;  2MHF A;  1I5P A;  1XSQ A;  1WKY A;  4K6B A;  1APN A;  4BCU A;  4RS5 B;  3RJ2 X;  1H6Y A;  1UOG A;  1MS3 A;  4NHX A;  1C8M 3;  3I2F A;  5C8C B;  3HNM A;  1PIV 2;  4QQP A;  2VOK A;  1S0F A;  4IEQ A;  3H8O A;  4PLM A;  5F5C A;  2ZGU A;  1ND2 C;  5E6H A;  2EAA A;  2WO2 A;  5FAX A;  5LW9 A;  1HRI 2;  2OVU A;  2BOJ A;  4AR2 A;  2CYF A;  4FPL A;  1JYV A;  1FMD 2;  4I3P A;  4YLZ A;  1W0P A;  4YZ2 A;  5C7G A;  2Q8C A;  2PLV 3;  2ADE A;  4BMB A;  4W6W A;  5EQU A;  3A0K A;  4OVE A;  3AP5 A;  1UCX A;  3WX5 A;  5DPN A;  1QJY 3;  1BEV 1;  1UY2 A;  5DQ0 A;  4XAC A;  4QM8 A;  4BHP A;  1TNR A;  4EZH A;  2DTY A;  1UX6 A;  2R0H A;  3NJY A;  1RUD 1;  4TYS A;  5IAV A;  1XQN A;  3THP A;  4CPB A;  4CXY A;  3M1H A;  4IET A;  4OUS A;  4QXH A;  1VBB 3;  4AQS A;  1HB1 A;  2VY0 A;  4LBQ B;  4IEP A;  1K5J A;  3MYX A;  5ABJ B;  1NLS A;  2VD7 A;  1DGL A;  3JCI A;  5E8A A;  2GNM A;  3NV1 A;  4N43 C;  2J1U A;  2XWJ B;  4DY5 A;  4BPZ A;  4LBL A;  1X8M A;  2DUO A;  3ZOI A;  4XAB A;  4RR3 B;  3CKH A;  4M01 A;  4GAZ A;  3IPV B;  2VZP A;  3ES1 A;  3ETQ A;  4R9B A;  1RUH 2;  1CGP A;  1V6O A;  4FPH A;  3KLS A;  2BZD A;  3DXT A;  3A7Q A;  2EIC A;  3LEI A;  2I74 A;  4P9W A;  1R64 A;  4YRD A;  4OQ9 A;  2YRO A;  2R06 1;  2GND A;  3ZXF A;  1JZ8 A;  3KT7 A;  5BXX A;  4CEW B;  4YW2 A;  1RB8 G;  5IVC A;  1ZZB A;  4YVS A;  2EIB A;  3K4A A;  2VME A;  2VZU A;  3TB0 A;  4MGQ A;  3O1M A;  2XHK A;  2W91 A;  1O4Z A;  1PGS A;  4IEO A;  3E5X A;  2OQ7 A;  5AC9 1;  2VQT A;  4FXK B;  4ISR A;  3EHK A;  3CJI C;  4FP3 A;  2JEN A;  5GLN A;  1BBT 1;  2A75 A;  4AHW A;  5C5U A;  4QX1 A;  3LB9 A;  3WQB A;  2D3P A;  2Q1M A;  3POI A;  3KV6 A;  4B4Q A;  2XJP A;  4XMI A;  2R04 3;  3SLI A;  1QJU 2;  4MO3 M;  2MEV 2;  1S0C A;  3OG2 A;  3WPU A;  4A45 A;  3H0O A;  3I59 B;  3ZYJ B;  1UXX X;  5C4W A;  5ANQ A;  2VUD A;  2ZEZ A;  2OQ6 A;  2V4A A;  3EBR A;  3DYP A;  4V2W A;  4NUB A;  3TEY A;  5K8S A;  3TN9 1;  2R7E B;  1VRH 3;  1SLA A;  4HXC A;  4P00 B;  3H8X A;  3TYJ A;  3JZV A;  4YNI A;  1PMH X;  1ZZ9 A;  5IAT A;  2W39 A;  1FPN 1;  4Y22 B;  4S2H A;  5LRR A;  4P14 A;  4W6Y A;  5IFP A;  5A3W A;  4CP1 A;  1R08 1;  4LO5 B;  1XYP A;  4NID A;  1W6M A;  2VOV A;  4IEZ A;  1ULG A;  3DPR C;  5FFO C;  1JU4 A;  4JDN A;  2W68 A;  1RUI 3;  3W5N A;  3OY8 A;  1ENQ A;  5BNO B;  2NPI A;  1AR9 1;  2D43 A;  3MLJ A;  4N7I A;  3ZIW A;  4B7E A;  2BBV A;  5FP3 A;  3KT4 A;  5JMC A;  3L2H A;  1GIC A;  3WF1 A;  2ZA9 A;  1J83 A;  2W94 A;  2OPW A;  1Q8V A;  5KWR A;  2WFP A;  2E6V A;  5JXH A;  4AHZ A;  5HI0 A;  2RV9 A;  3I2K A;  1S1A A;  3KM5 A;  1B35 A;  3PTY A;  2VCA A;  1QH6 A;  4UW6 A;  1K3I A;  5E89 A;  3V64 A;  1OD3 A;  4Y5Z 0;  4CP2 A;  2BWA A;  3CZU A;  4BQ3 A;  1ZNP A;  4YPJ A;  2E33 A;  3OEA A;  4B7K A;  2YFS A;  1E5S A;  3R05 A;  2QQU A;  3PJY A;  4Q5O A;  1CJD A;  1IKP A;  3PL0 A;  2DUQ A;  3ETP A;  1J58 A;  2CHH A;  1ODM A;  2JX9 A;  1O7F A;  1Z7S 3;  4S2D A;  5DUX A;  1Y9G A;  1RUF 1;  1PM4 A;  3I3B A;  1YUD A;  5JZG C;  3P1I A;  4LKS A;  4GZ9 A;  2AEY A;  2JJ6 A;  1JOB A;  3MID A;  3A21 A;  4QX5 A;  4KCA A;  4J1W A;  4OHZ A;  4NIH A;  3KGL A;  4AVC A;  3HWJ A;  4HVR A;  5DMY A;  4KC7 A;  4AQT A;  4PLN A;  3Q8C A;  2BGC A;  4LKD A;  2ZJC A;  5FPL A;  3JD7 3;  1NT0 A;  4P5H A;  1OF4 A;  2WN3 A;  1V6I A;  5J96 B;  1O8S A;  1U5I A;  2D3R A;  1BEV 2;  2XUE A;  3RFR A;  4JC1 A;  3POF A;  4N53 A;  3WW3 A;  3AFG A;  1QXR A;  1SBF A;  1RUD 2;  2B46 X;  2W87 A;  1PO2 3;  4XIK A;  4GH4 B;  4R4Z A;  3WF2 A;  2WS9 3;  2WAA A;  5FY4 A;  1OFS A;  3U11 A;  3WHT A;  5FMD A;  5BNN C;  1QGL A;  2WT1 A;  4LHL A;  4LO6 B;  3VDD C;  5L7O C;  1H2N A;  1CPN A;  5JWP A;  4ISQ A;  3PDQ A;  5FZA A;  1GV9 A;  3RYR A;  2PQQ A;  3POW A;  1HIX A;  3NKG A;  4UDJ A;  4AK7 A;  2PN5 A;  3UJQ A;  4B8E A;  5LZ6 A;  2ET1 A;  1QHD A;  2GP3 A;  3AP4 A;  4Y1Z A;  4BQX A;  1OLQ A;  2WQ4 A;  1W8W A;  1UOF A;  2TUN A;  3FUO A;  5ISL A;  3QEE A;  2O1Q A;  3WCS A;  2X5I B;  3WVJ A;  4UW5 A;  5F2S A;  5I8S A;  4ASK A;  5HCB A;  4URT A;  1EAH 3;  2ETE A;  3CBN A;  4PIX A;  2FZ2 A;  4UYB A;  5ACA 2;  4BE3 A;  1DP0 A;  3AM2 A;  4CDQ C;  1PGL 2;  3N9P A;  2X8K A;  2CWM A;  5AC9 2;  3WT3 A;  2VCM A;  3J8F 3;  3BTY A;  4FXG B;  3AJY A;  4PVA A;  4QWN A;  1BBT 2;  1ND3 B;  1UMI A;  5FY8 A;  1W9F A;  3FX3 A;  3B5L B;  5LRS A;  2ZHM A;  3VD3 A;  4IEW A;  4V1P A;  5FPV A;  3ACG A;  1UW8 A;  4DO0 A;  3TNP B;  1ULF A;  2DVG A;  2I07 B;  3OGR A;  3MW2 A;  5C9A C;  1FV3 A;  5A7V A;  1QOT A;  3NAP A;  3DCQ A;  3WDV A;  4XDP A;  5FUP A;  2W9X A;  1FT9 A;  4FPC A;  2X8S A;  1PK6 A;  4PDW A;  1WD3 A;  4WV8 A;  1LAJ A;  4MVT A;  2JG9 B;  4XF9 A;  3VBO B;  4CSW A;  4XFI A;  4U6B A;  3LCP A;  2P1B A;  1W3X A;  1UOB A;  3ZPO A;  4OQ8 A;  2YFU A;  2D97 A;  5FIX A;  3K75 B;  2ZAC A;  4DB5 A;  1I1E A;  2ZEW A;  3U78 A;  4H55 A;  4I3G A;  1NA1 A;  1ENX A;  2HWF 3;  2XOM A;  1R08 2;  1HXS 1;  2BGP A;  3RYP A;  1XU1 A;  5A7O A;  3MPP G;  5I0R A;  2O0O A;  1C28 A;  4BXS V;  4BIS A;  2ZS6 B;  2BWC A;  5GLK A;  1XBF A;  3ACF A;  3PNA A;  1AR9 2;  1F4H A;  5DXD A;  3VD7 A;  4ARX A;  3MLL A;  1UAI A;  4EYU A;  4M4P A;  2WNO A;  3RRD A;  5JIA A;  1DYP A;  4L9B A;  2XLF A;  5EPA A;  3ILN A;  5FZO B;  4N7U A;  5HXM A;  1AX2 A;  3HNB M;  1MQT B;  5DAB A;  5FQ0 A;  1D0G A;  5CG9 A;  3CU7 A;  4I09 A;  3THC A;  1QJE A;  2AEZ A;  1MZ5 A;  4F83 A;  4HT1 T;  2EAL A;  5DUV A;  2D40 A;  3QH7 A;  2VGD A;  1KEX A;  1PGW 1;  2ZAH A;  3CU9 A;  2W1U A;  4FI9 A;  3BI3 A;  1W2A X;  2J1V A;  5JUV A;  4QQL A;  2C24 A;  4CDU C;  1RUF 2;  1YO8 A;  3D0J A;  1JHJ A;  3OUI A;  1POQ A;  3WNL A;  4RSU A;  1D4M 3;  4IV3 A;  5A3M A;  1XSR A;  2MNG A;  3M70 A;  5DUW A;  1QDC A;  2IXH A;  4LUL A;  3BYJ A;  4LBQ A;  4WM8 C;  1VKD A;  4OFG A;  3NNG A;  3VKL A;  3WNM A;  2ZZQ A;  4LMF A;  1S0B A;  1WBF A;  2QQK A;  2XXZ A;  5F8P A;  1DZQ A;  2EVX A;  4N90 A;  4GB3 1;  4H2A A;  2BU9 A;  1K12 A;  4ZZ8 A;  3MO4 A;  4A6S A;  3MUY 1;  4N9I A;  1OLM A;  2J22 A;  2ZMN A;  2P3J A;  3LA2 A;  4W50 A;  3BGA A;  3ZMO A;  1AXZ A;  3FLR A;  5KXC A;  3DEC A;  5C2M A;  1PVC 2;  3VBS B;  1PZ7 A;  3NNF A;  1NCR B;  2YDE A;  4N9H A;  3U37 A;  2VEC A;  3OSD A;  3VZN A;  3RZM A;  4QHZ A;  3ILF A;  4CEW A;  5FYT A;  1G6N A;  3GJB A;  1W06 A;  3O1T A;  4L99 A;  3NVC A;  1R09 3;  2RR1 2;  4L2N A;  1BK0 A;  3AYA A;  2Y6L A;  1GWM A;  5AFB A;  2WFF 3;  4RGK A;  4KWU A;  2VQA A;  4XTP A;  2BFU S;  5D1I A;  4A3X A;  1D4V B;  4UW4 A;  3JB8 A;  1LEN A;  1ZZC A;  3AVS A;  4YFW A;  5IVB A;  1L7R A;  1QQP 1;  3CLP A;  3HBK A;  3BN6 A;  4O8N A;  1LJ7 A;  3WQ0 A;  5IVJ A;  1W8F A;  3AMH A;  1TMF 3;  1ZA7 A;  4UFJ A;  5JIU A;  1VB2 A;  1J3R A;  2XJT A;  3CEW A;  3VT1 A;  3WN2 A;  1RUN A;  1GWL A;  1A78 A;  3MIG A;  4OMD A;  2ORX A;  5DAV A;  3WDX A;  2I45 A;  4AVB A;  2J1R A;  4DRV A;  3ZXK A;  4W8J A;  2QKD A;  1PMI A;  1TME 3;  4QM9 A;  3I59 A;  3WMZ A;  1GNH A;  3J7N A;  3W59 A;  4DNY A;  5GLL A;  2DVF A;  5KHH A;  4ONU A;  1SFN A;  1WCK A;  3LAG A;  4EN9 B;  3PUA A;  3K46 A;  1VBD 1;  2WSU A;  4Y22 A;  3BOW A;  4XDO A;  1ZRI A;  3O7O A;  3RSJ A;  1UY4 A;  1VE0 A;  2JDU A;  4R4X A;  3TAW A;  1CES A;  4HBN A;  2D44 A;  4LT5 A;  4QPI B;  3T2T A;  1DZR A;  3NKT A;  4NRO A;  4Z2W A;  1SQ4 A;  3VKO A;  5BNO A;  3RGB A;  1OOP B;  3RZK A;  1NG0 A;  1YQ5 A;  1VBB 1;  1AR7 2;  3OBR A;  3NJV A;  3PMS A;  4E8C A;  5FRE A;  1W6Q B;  3AJZ A;  3OOX A;  3OM6 A;  1LHV A;  1YQ6 A;  3UYJ A;  1WZX A;  2QQI A;  5A3U A;  2FDG A;  4FTB A;  3ZFF B;  2V09 A;  3W58 A;  4DUX A;  4LHK A;  3OUJ A;  1QJX 2;  3PTR B;  4HPK B;  3FLP A;  4Y1Y A;  2TBV A;  5B4X A;  1W2N A;  1GOH A;  2RS1 2;  2ZGS A;  3OPW A;  5IVY A;  3T30 A;  2XBO 3;  1OA2 A;  2A5Z A;  1QOS A;  1VBE 2;  4P5Y A;  3ZIX A;  1ZBE 1;  3OGG A;  4CUB A;  4XF1 A;  4NWV A;  1SPP A;  1RUG 3;  4PT6 A;  4IE7 A;  3EQE A;  1AR8 3;  1ULP A;  2A70 A;  5C0P A;  5A6Z A;  2VNR A;  4Q4V 3;  3ZXD A;  4AFC A;  4UFI A;  3U75 A;  2Q8D A;  4OZO A;  4ZU4 A;  1O5L A;  4B4P A;  1I6X A;  5FP4 A;  3TEX A;  2VUJ A;  3AKT A;  3I3E A;  3BIE A;  2DFB A;  2JG8 B;  3IWZ A;  2UYB A;  5FKC A;  3J4U H;  3ZN6 A;  5FOJ B;  2WO3 A;  3DKQ A;  3QD6 A;  4UFK A;  1H6X A;  4QHB A;  2H6B A;  3S7I A;  1PGW 2;  4AI8 A;  1XU2 A;  4FOQ A;  2H0V A;  1WW5 A;  1BCX A;  2P3K A;  5K0U C;  4Y5S A;  1RJ7 A;  1OC1 A;  3VKM A;  3VZK A;  2CNA A;  3J7M A;  5JR2 A;  4S2F A;  2AEN A;  1JYN A;  4GIQ A;  1FXZ A;  3ZO0 B;  3K3O A;  1PO1 3;  1S0G A;  4GAL A;  1ENR A;  4YW5 A;  1GYD B;  3BUC A;  1NCQ C;  1Y3T A;  2BYV E;  3CDZ B;  3WNP A;  3WNN A;  1NE4 A;  1QXJ A;  5C3P A;  1UY3 A;  1V6J A;  5CYY A;  1AYN 3;  4YW6 A;  4IER A;  5JI9 A;  2WC2 A;  4Y26 A;  3O14 A;  2VOX A;  4EWA A;  1OKQ A;  4RQP B;  3WQ1 A;  1TL2 A;  1V0A A;  2HWD 3;  2VZS A;  4GXL A;  4LHS A;  4Y33 A;  1MS5 A;  5FY1 A;  1HRV 2;  2VVF A;  1RUO A;  3OM7 A;  1X9P A;  5JSO A;  1Y9Q A;  4PQ9 A;  1RUI 1;  2WA4 A;  5A7S A;  2V72 A;  5F3G A;  2X5I A;  5IK5 A;  4URA A;  3ZM8 A;  3BU7 A;  3IMM A;  2ARE A;  2IC1 A;  3ZXJ A;  2Y34 A;  4HKO A;  4FPO B;  1H8V A;  3AX4 A;  4UBH A;  4YVW B;  5EWS A;  4Q4X 3;  1JMU B;  1ULC A;  3MIE A;  3LEG A;  4D6Q A;  4COW A;  2NMO A;  1HDK A;  1JYC A;  2P6H A;  4IV1 A;  4QPW A;  3U10 A;  3LOB A;  5A80 A;  5FR3 A;  1QQP 2;  1JZ6 A;  1MZ6 A;  4OI4 A;  3I8T A;  2PHW A;  4MX3 A;  1Y7B A;  2G9Z A;  4TN7 A;  1ND3 A;  3LDB A;  4GQ7 A;  3ZFE C;  2IVI B;  3D61 A;  1C8M 2;  3VT2 A;  5FPX A;  3IBM A;  5FZC A;  4PI2 A;  2WRA A;  4YGD A;  1YCI A;  2HWE 1;  4Q2F A;  4AW7 A;  3HAG A;  4Q29 A;  4Q4Y 3;  4NIA A;  3SEP A;  2ZZJ A;  1ZZ7 A;  1C1F A;  1ZRR A;  4K7J A;  4CEY C;  5F3C A;  1J3Q A;  1FOD 3;  1KS5 A;  2JG9 A;  1LHU A;  5IVV A;  4JX0 A;  1RHI 3;  2EIG A;  1UN1 A;  3TOJ A;  2RJK A;  2RS5 3;  2JXA A;  1N1Y A;  5DDJ 3;  3VBF B;  5GLV A;  2BEO A;  1WL7 A;  1PIV 1;  2OUJ A;  2PLV 2;  2WUH A;  1H2M A;  1PHM A;  2P37 A;  2YPD A;  2BUK A;  3KQR A;  1DGR N;  5LAS A;  1LU2 A;  4AOC A;  4UDK E;  2RM2 3;  1OI6 A;  4H3W A;  4FFI A;  5EJ3 A;  3FHI B;  5H9R A;  3FHA A;  2VDT A;  3PJQ A;  4K8R B;  3ZR5 A;  3LA7 A;  4KU7 A;  5EV7 A;  4ZU7 A;  3D6E A;  5F5Q A;  3U0Z A;  3UGG A;  1FMD 1;  1F31 A;  3N9Q A;  3VBU B;  3WG2 A;  5FPU A;  5A3N A;  1VBB 2;  2J7M A;  2OXB A;  1DZT A;  3KST A;  1ST8 A;  2A7A A;  5F6K A;  5I8T A;  4QDQ A;  4PVI A;  1LOB A;  1VAV A;  4DY3 A;  2TNF A;  2ID4 A;  2D6L X;  2Y0I A;  5D8A B;  5FY0 A;  5FZE A;  5GAL A;  1JI6 A;  4QGN A;  1BVV A;  2VMD A;  1MQT A;  2N7G A;  3AL5 A;  2AC1 A;  3KSC A;  4V2V A;  4LO8 A;  2R07 3;  4XF3 A;  4D69 A;  3OGS A;  4A44 A;  3LD8 A;  1RIT A;  3Q8B A;  4IEU A;  1CQ9 A;  3OM4 A;  4OHW A;  4ONZ A;  3PU8 A;  2WIN B;  4CDX A;  2QUO A;  1YI9 A;  2OS2 A;  1ZM1 A;  3U07 A;  4COV A;  1SLI A;  4HET A;  2EA7 A;  4BLI A;  4HK9 A;  2GC3 A;  2RDR A;  1RED A;  1CPM A;  1RMU 3;  4Z92 B;  2OYZ A;  3D5O A;  5JVV A;  2E26 A;  1PZ9 A;  3IMN A;  4PIY A;  3WP3 A;  2WAO A;  3RG0 A;  3O0W A;  1AJO A;  1VBA 3;  5K4L A;  4YVS C;  3ZN5 A;  3N3H A;  4Q1R A;  4XAE A;  3T09 A;  4CXW A;  3RMY A;  3HOB A;  1RYY A;  2YV8 A;  4D7T A;  4DEV A;  3VHN A;  4YGE A;  4O61 A;  3H50 A;  1W8N A;  1ND2 B;  2YBS A;  3PME A;  3ZFG B;  1NUK A;  3CO2 A;  4KC8 A;  3BPS A;  3ON7 A;  5CNA A;  2R04 2;  1FV2 A;  3RDI A;  4AXO A;  4QPG A;  4N1I A;  4FPF A;  4R52 A;  2BOI A;  1RUJ 3;  4C8D A;  2SLI A;  1BYH A;  2NN8 A;  1KQR A;  4XIO A;  1YXW A;  2VW0 A;  1X9T A;  1VRH 2;  2VOW A;  3B7M A;  4J6G A;  1NZC A;  5I0T A;  4AFM A;  1ZRC A;  4XF4 A;  2OT7 A;  1BZW A;  4KH9 A;  4D94 A;  1LED A;  5C4W C;  3VSS A;  3B69 A;  1OKO A;  2QDN A;  3E6C C;  4F7Z A;  1JXN A;  1MEC 3;  1WUV A;  1UPS A;  2MEV 1;  3W5M A;  3KCX A;  2YBP A;  4P08 A;  4ZS2 A;  1Q8S A;  1ZYB A;  5DUU A;  2BQP A;  2VZV A;  1H1I A;  2B42 B;  1RUI 2;  4JHT A;  4XOG A;  3DF0 A;  1UY0 A;  2NZ9 A;  1LEC A;  4KMQ A;  2WZP P;  3IAQ A;  5FXZ A;  3T2O A;  4N43 B;  1YFX A;  4AG4 A;  4ZKT B;  4D3W A;  2BPA 2;  3IDB B;  4XUP A;  3A23 A;  2VOT A;  4XUO A;  3PHM A;  2LM3 A;  3VKF C;  5A1F A;  1S55 A;  4AL9 A;  3L2Y A;  5JSP A;  5L19 A;  2YMZ A;  3BAL A;  3ROU A;  1DG6 A;  1QY4 A;  1ZRF A;  1FAT A;  1G86 A;  1SLL A;  2VL4 A;  2AUY A;  2GNB A;  4Q4W 3;  3SHR A;  4F3J A;  1HX6 A;  1TZO A;  4NHY A;  3ZSL A;  1B35 C;  3OGJ A;  1RXF A;  1V9U 3;  2R1D A;  5T5P A;  4WZC A;  4LOR A;  5FXV A;  5JPM B;  4ZPI A;  3WF0 A;  3UKT A;  2JIG A;  1Z7S 2;  3ZKU A;  3H3U A;  2BDR A;  2SBA A;  1LES A;  3HR9 A;  1F2N A;  4AVS A;  4EWD A;  3CJI B;  3KZ4 C;  1PNF A;  1W6Q A;  3USU A;  4E8D A;  5CKN A;  1O3Q A;  3AL6 A;  4YG0 A;  4H14 A;  4Q0Q A;  3WUD A;  3BTZ A;  2VNV A;  2J1A A;  1VLN A;  3JD7 2;  5AVA A;  3MEP A;  3RZJ A;  4HPK A;  5FZ1 A;  3WPZ A;  2P4E A;  1R1A 3;  1RGS A;  3HPN A;  2IXI A;  3FBY A;  1X7N A;  1CIW A;  2YB7 A;  1PO2 2;  5FJH A;  4CCO A;  5HV4 A;  3O1P A;  2ZOE B;  2WZR 3;  3VBH B;  3NL1 A;  4O9E A;  2J1T A;  4TXW A;  4BOW A;  4NJ4 A;  4N53 C;  1WMX A;  3WNO A;  5C8W A;  2QDR A;  2ZTN A;  3H9A A;  2PEL A;  5FP7 A;  4DXT A;  5T5J A;  1ENS A;  1CZV A;  1R09 1;  4JGY B;  4XJ8 A;  3WSO A;  2YYO A;  2KD7 A;  3MIC A;  2JG8 A;  5FPB A;  2DBI A;  1CAW B;  1OH3 A;  2XR4 A;  3FZ3 A;  4KWK A;  2GME A;  2GC1 A;  3D8C A;  3HQR A;  3QC2 A;  2VBP A;  2X10 A;  5IWF A;  1XNB A;  4E4H A;  5CFC B;  3UGH A;  1F5F A;  5C3Q A;  1HB4 A;  4GJZ A;  4ES9 A;  4AHY A;  3VBR C;  1UU4 A;  3QAC A;  2ARC A;  1NAE A;  3G6J B;  5A7W A;  1LGB A;  1ZX5 A;  1EAH 2;  5CZK A;  4AEM A;  3L9J T;  3T2P A;  2QQM A;  4FAG A;  4COY A;  2WT2 A;  3MDP A;  4Q0V A;  1TME 1;  5FYU A;  1WD4 A;  5A6Q A;  1GWK A;  2WNU A;  2W95 A;  2FDJ A;  1V6K A;  2WYF A;  4AI1 A;  1ZRE A;  5L36 A;  2ET7 A;  3I97 A;  3OCP A;  4A7Z A;  3PUS A;  4MGT A;  3GHN A;  1IKQ A;  2OW4 A;  5DZF A;  4ZXE A;  4QX8 A;  3ZYH A;  4XBL A;  3ELN A;  2ZGK A;  4QPY A;  1XC6 A;  1DQ6 A;  1T6B X;  2UY9 A;  1OT5 A;  4GMP 3;  4XUT A;  4B29 A;  5ACA 1;  1POV 0;  4YGB A;  3PUQ A;  5GM0 A;  2XH6 A;  3P5B A;  1PGL 1;  4IE6 A;  4HFS A;  5EJZ B;  2FDI A;  4DQA A;  2ERF A;  4N2Z A;  1RIR A;  2GAU A;  2CGO A;  3POY A;  3GBG A;  3VZL A;  4FQZ A;  3NAP C;  1JYI A;  3MUZ 1;  4FSJ A;  1COV 1;  1X50 A;  5G05 L;  4NO4 A;  3VD4 A;  1RIN A;  1KIT A;  5C3S A;  5JDB A;  5I0U A;  3B9C A;  4DXZ A;  1TNF A;  2XLG A;  1PK6 C;  4PDW C;  2ZXQ A;  1VMH A;  2HWF 2;  2BVV A;  4IE0 A;  3J9S A;  4DPN A;  5B6S A;  4ZY9 A;  4AFB A;  1KD7 A;  4BYY A;  1HV1 A;  1J84 A;  4R9D A;  2UYA A;  2WZE A;  4QQO A;  4GWI A;  4MHR A;  1W05 A;  2VTX J;  1NA1 C;  3MBW A;  1UWW A;  5GLR A;  1WLC A;  1XB9 A;  3NJZ A;  1GFF 2;  3I3D A;  3PIG A;  4C91 A;  3RNS A;  5KBF A;  2JB4 A;  5FXX A;  5L7O B;  3BU0 A;  4OHV A;  3Q8A A;  2VW1 A;  5FYY A;  1FNY A;  2ZX1 A;  1AL0 G;  1OUX A;  1H2L A;  5GZF A;  1DYK A;  2QZ3 A;  1EPZ A;  5CAZ A;  1OVP A;  1WMD A;  3VUO A;  3ZYR A;  2RJL A;  2XUM A;  1W9W A;  2R0F A;  2WII B;  1YJL A;  2ZML A;  1RUE 1;  1YEW A;  2D6P A;  4FVV A;  5LBE A;  3RZH A;  2NP0 A;  3NQH A;  3VBF A;  1JZ4 A;  1NZI A;  4XCB A;  4C1W A;  1LNS A;  2ZKN A;  5FMO S;  5D21 A;  3RS6 A;  3M3E A;  3KGZ A;  1UKG A;  2ZHN A;  1YJK A;  3N35 A;  4BQW A;  5JR7 B;  4MZU A;  4CDQ B;  3GZU C;  4LPL A;  1SMV A;  3E1F 1;  4LE4 A;  5LBC A;  2Q0A A;  1HW5 A;  3Q9O A;  1D4M 2;  1RUC 3;  3VBU A;  1ZVF A;  1QNW A;  2IWG B;  4ATE A;  3QLQ A;  2AYH A;  3ZDV A;  4GMP 0;  1MS0 A;  3UV9 A;  2O14 A;  4FFH A;  4EN7 B;  4IEY A;  2VC9 A;  5DAQ A;  3RJR A;  3DL3 A;  1UKR A;  2G9F A;  5CFD A;  3WW1 A;  4N2R A;  4LBK A;  3T2Q A;  4IV3 C;  1F5J A;  5D8A A;  1NQJ A;  2GAL A;  3H1W A;  4RFR B;  4XTM A;  4XXP A;  2WZ8 A;  1VP6 A;  4RHV 3;  4D47 A;  3ZMN A;  3WAS A;  3EO6 A;  3VDB A;  1HN0 A;  2VE1 A;  4JTN A;  4BIF A;  4QXK A;  4Y20 A;  5SV5 A;  3SH5 A;  4TZD A;  1W6N B;  4L0P A;  3SNM A;  3CQO A;  5LK7 B;  2YU2 A;  2PHT A;  2PYT A;  1JZ3 A;  1TVG A;  5L9B A;  4ZHN A;  3QZ4 A;  3N9L A;  4JTO A;  3LEK A;  4MGY E;  3WPY A;  1DIW A;  1H4H A;  4YG6 A;  1CAU A;  2PHF A;  1DQ2 A;  3ZYP A;  1DDL A;  3I2O A;  1HKD A;  2QQP A;  2DU0 A;  1R09 2;  4Q4X 1;  4BK4 A;  5LEK A;  2FCV A;  5FZK A;  4UOJ A;  3V56 A;  5GLQ A;  2VZQ A;  2WFF 2;  4C0B A;  4CEW C;  3WNK A;  1PVC 1;  2JIC A;  1IHM A;  4ZZ5 A;  2CDO A;  2IFW A;  1BK1 A;  1XNA A;  2VZ3 A;  4AVA A;  1SEF A;  1JZ7 A;  2RE9 A;  1U5Z A;  3MIB A;  1W18 A;  2C0Z A; 
#chains in the Genus database with same CATH homology
 3OM7 A;  3LIH A;  5AYE A;  5AY9 A;  3C7E A;  3HBK A;  3WPU A;  3VSF A;  4O8N A;  5FLW A;  3IMM A;  3KF5 A;  4FFF A;  5AYD A;  3KF3 A;  4UFJ A;  4PVA A;  5ANN A;  3ZXJ A;  3LF7 A;  3VT1 A;  1YRZ A;  3WN2 A;  5JOY A;  4HXC A;  3VSS A;  5FMC A;  2YFT A;  3AKG A;  4UDI A;  2ADD A;  3ZR6 A;  2QQW A;  3LDR A;  3ZXK A;  3BYK A;  4CCE A;  2X8F A;  4N2Z A;  5JOX A;  5A7V A;  3WMZ A;  5AYC A;  1Y7B A;  4B1M A;  5B6T A;  2X8S A;  4UFH A;  3D61 A;  3QEF A;  3LEM A;  4KCB A;  5JOW A;  4JQT A;  1UV4 A;  3VT2 A;  1PT2 A;  5B6S A;  5FIX A;  3TAW A;  4O8O A;  4QQS A;  2QQV A;  4UDK A;  4AK5 A;  1W2T A;  5GLK A;  5GLR A;  3PIG A;  1GYE B;  4CCD A;  5GLO A;  3AKF A;  3UGF A;  3OM6 A;  3U1X A;  1WL7 A;  5GLL A;  2YFS A;  4O8P A;  3U14 A;  2QQU A;  3LV4 A;  4UDK E;  2YFR A;  3D60 A;  2ADE A;  3OM2 A;  4FFI A;  3PIJ A;  5GLM A;  2VDT A;  3ZR5 A;  3C2U A;  3WN1 A;  3NQH A;  4EQV A;  1Y9G A;  3UGG A;  3C7F A;  2EXI A;  4AK6 A;  2AEY A;  3H3L A;  1OYG A;  4NOV A;  3R4Y A;  3K1U A;  3BYL A;  2OXB A;  3KST A;  3C7G A;  2AEZ A;  4KCA A;  1ST8 A;  5FK7 A;  3R4Z A;  3D5Z A;  4PVI A;  3D5Y A;  1Y4W A;  4COT A;  3VSR A;  3P2N A;  5FMB A;  4KMI A;  3WAU A;  4B1L A;  4KC7 A;  3WPZ A;  3CU9 A;  5C0P A;  3NMB A;  4UFI A;  2AC1 A;  3U75 A;  3C7H A;  4FFH A;  4ONZ A;  1UYP A;  3OM4 A;  3OM5 A;  4N2R A;  5FKC A;  5GLP A;  3QED A;  4AZZ A;  3BYJ A;  1VKD A;  1YI7 A;  3WN0 A;  4UFK A;  3VT0 A;  4U6B A;  4CCC A;  4U6D A;  5FKB A;  4MLG A;  4D47 A;  5FMD A;  4UFM A;  3WAS A;  3WMY A;  5JOZ A;  3WPV A;  5A7V B;  3SC7 X;  3AKI A;  3ZXL A;  5A8D A;  3QZ4 A;  4UDG A;  3LFI A;  3LDK A;  3QC2 A;  4UDJ A;  1GYD B;  3C7O A;  3WPY A;  4AK7 A;  3VSZ A;  3WAT A;  3UGH A;  3OSD A;  3RWK X;  2EXK A;  4QHZ A;  3BYN A;  3QEE A;  4N4B A;  1Y9M A;  2B4W A;  5FK8 A;  3LIG A;  2XQR A;  5GLQ A;  5GLN A;  5A8C A;  4KC8 A;  3AKH A;  4FFG A;  2EXH A;  1GYH A;  3S5Q A;  1W18 A;  2EXJ A;  3R67 A;  2X8T A;  4N1I A;  1YIF A;  4UFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...