2AEYA

Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with 2,5 dideoxy-2,5-immino-d-mannitol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
537
structure length
537
Chain Sequence
QIEQPYRTGYHFQPPSNWMNDPNGPMLYQGVYHFFYQYNPYAATFGDVIIWGHAVSYDLVNWIHLDPAIYPTQEADSKSCWSGSATILPGNIPAMLYTGSDSKSRQVQDLAWPKNLSDPFLREWVKHPKNPLITPPEGVKDDCFRDPSTAWLGPDGVWRIVVGGDRDNNGMAFLYQSTDFVNWKRYDQPLSSADATGTWECPDFYPVPLNSTNGLDTSVYGGSVRHVMKAGFEGHDWYTIGTYSPDRENFLPQNGLSLTGSTLDLRYDYGQFYASKSFFDDAKNRRVLWAWVPETDSQADDIEKGWAGLQSFPRALWIDRNGKQLIQWPVEEIEELRQNQVNLQNKNLKPGSVLEIHGIAASQADVTISFKLEGLKEAEVLDTTLVDPQALCNERGASSRGALGPFGLLAMASKDLKEQSAIFFRVFQNQLGRYSVLMCSDLSRSTVRSNIDTTSYGAFVDIDPRSEEISLRNLIDHSIIESFGAGGKTCITSRIYPKFVNNEEAHLFVFNNGTQNVKISEMSAWSMKNAKFVVDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords fructan 1-exohydrolase IIa
publication title Insights into the fine architecture of the active site of chicory fructan 1-exohydrolase: 1-kestose as substrate vs sucrose as inhibitor.
pubmed doi rcsb
source organism Cichorium intybus
molecule tags Hydrolase
total genus 128
structure length 537
sequence length 537
ec nomenclature ec 3.2.1.153: Fructan beta-(2,1)-fructosidase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 2aeyA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2aeyA01
3H3LA 5AYEA 3WPVA 3WPZA 3BYKA 3ZXJA 1GYEB 5FLWA 3LF7A 2QQVA 3IMMA 3OSDA 3SC7X 3D60A 4KC8A 4UFMA 1YIFA 4UFHA 4QHZA 2X8TA 3QEFA 3R67A 4N1IA 3WAUA 3WN2A 4CCCA 3TAWA 3WPYA 4UDIA 5GLOA 3UGHA 1Y9MA 5FMBA 3ZR5A 4UDKA 3WN0A 4ONZA 2B4WA 3U14A 5FKBA 3OM2A 5A7VB 3ZXKA 3C7HA 1Y9GA 4FFFA 4UFJA 2ADDA 2X8SA 4FFIA 1PT2A 3U1XA 4CCDA 2ADEA 3OM6A 5GLQA 5FMCA 1UYPA 4O8PA 3D5YA 1YRZA 5AYCA 3D61A 3QC2A 4COTA 3WASA 5JOYA 1Y7BA 5GLLA 5GLPA 3WPUA 3RWKX 3C7OA 3OM4A 4O8OA 3VT0A 3S5QA 4U6BA 4KC7A 4CCEA 3NMBA 4O8NA 4PVAA 3AKGA 3P2NA 3BYLA 2AEYA 4MLGA 1Y4WA 3VSSA 5A8DA 1YI7A 5ANNA 2QQWA 3LFIA 1GYDB 3VT2A 3WATA 3AKFA 3C7FA 5FMDA 1W2TA 4D47A 3QZ4A 2VDTA 4PVIA 3QEEA 3R4YA 5GLRA 5B6SA 5A8CA 3ZR6A 3AKIA 3C7GA 5GLNA 3LEMA 5FK8A 4N2RA 5A7VA 5C0PA 2YFSA 3LDKA 2EXJA 3OM7A 1VKDA 4N2ZA 2AC1A 3LDRA 3BYJA 4FFHA 3AKHA 4N4BA 4UDKE 1GYHA 1OYGA 3WMZA 3VSZA 4B1MA 5JOWA 5FKCA 5GLKA 3PIGA 4EQVA 4HXCA 4QQSA 3C7EA 4KMIA 3KSTA 3VSFA 3D5ZA 3UGFA 5JOZA 4UDGA 4KCAA 5FK7A 1ST8A 3WN1A 4U6DA 3LV4A 2EXIA 4UDJA 3QEDA 5GLMA 4AK6A 3OM5A 1UV4A 3C2UA 3WMYA 4AK7A 2EXHA 3UGGA 2YFRA 2XQRA 2YFTA 4AK5A 3ZXLA 3KF5A 5JOXA 1W18A 3U75A 2OXBA 4UFIA 5AYDA 4JQTA 5FIXA 3BYNA 2AEZA 3LIHA 3VSRA 2EXKA 3PIJA 2QQUA 3KF3A 5AY9A 4UFKA 5B6TA 4AZZA 3VT1A 4KCBA 4NOVA 3HBKA 1WL7A 2X8FA 4B1LA 3NQHA 3K1UA 3CU9A 4FFGA 3LIGA 4UFLA 3R4ZA
chains in the Genus database with same CATH superfamily
1BHGA 3FHAA 2J1RA 1KFXL 4RFT0 1RUJ2 2PFWA 1W6PA 4CCLA 1G7YA 2J22A 3PJQA 2VVEA 4XFCA 3OY8A 5GM0A 4HK8A 5BNNB 2Q8CA 2YHJA 1V9U1 4QGLA 3VLBB 3WN2A 1NA1B 1FV3A 1SLIA 5IK4A 4LOSA 1C57A 1QMJA 1POV0 2ZXQA 4FPFA 3KVBA 4L8QA 4CU9A 5IUQA 1H6XA 3NNFA 5CFCA 4DZGA 2JE7A 5F3IA 1JZ2A 5F9TA 4HN1A 1PZ9A 3WG4A 1FPN2 3SITA 1EAH2 3FFQA 4KG8A 3ZYIB 4MH0E 5IK8A 2W0XA 3ZDVA 2ZX2A 1BMV2 1AXYA 3A21A 3H0OA 3N9MA 4FI9A 3RDIA 1LNSA 2WZR2 4Q4V3 5FMOL 5JWPA 4GJYA 4AI1A 1JOJA 1BEV2 4XJ9A 1JUIA 5GLZA 5AC91 3VZJA 4ARYA 2ZEZA 2JG9A 3J4UH 4YVSC 2W39A 1SDWA 2ZGKA 2A70A 1AYN3 3GYDA 4XJ8A 3E1F1 1ASJ3 2P3IA 2ZGUA 2OT7A 5FZ6A 3OUJA 2RS11 3DXUA 4XJWA 2GNMA 1CESA 1UY3A 3AB0A 4PJYA 4X6RB 3RRDA 1W6OB 5C7GA 1JZ7A 2ZGRA 5JXJA 1A34A 3P2NA 4NRMA 1BK0A 3HJRA 5BUVA 2R1BA 3V0AB 1NLRA 2CGPA 2WAAA 1VLNA 2XQXA 4HG6B 2Q8DA 3P6BA 5C8CA 5CISA 2VECA 5T54A 5HCHA 2WFPA 4LPLA 4AGRA 4C90A 2WQZC 3WUCA 1CQ9A 3MUZ1 2JDNA 2VOWA 2IVIB 2ZEWA 3ZFFC 3HQUA 2Y8KA 2HWF1 4MV2A 4QQLA 5T5JA 4LO8A 3WF4A 5ACA1 2VBPA 3OBAA 4DUWA 4OHZA 4AWDA 1LENA 3MO4A 4KGGA 3WNKA 2QZ3A 2JX9A 5FK8A 4BQ3A 2OUHA 4JDMA 1NQJA 1AL0G 3TN91 1PGW1 4BM8A 5DG2A 5FZBA 3H8UA 3CEWA 3DPRB 3DYMA 4DFSA 2FDJA 2GU9A 2PELA 5IVBA 1RXGA 5FJKA 4BK4A 4MGQA 4AFBA 2PQSA 3UJQA 3D5ZA 5FK7A 3BODA 2RJKA 5FPZA 1GNYA 2JB8A 1UD1A 4IEZA 4XDPA 3QEDA 5GLMA 1TMF1 5FXZA 4N8MA 3RS6A 3WP5A 1LU1A 3MV11 4IGPA 4YM2A 1MZFA 1JOBA 1W8OA 1OD5A 2EXHA 4Q4V2 2QTWB 1IPJA 1MS8A 3FE5A 4GA9A 4Q27A 3T08A 1POV3 5KHIA 2ERFA 2GH8A 1B35B 3P5BA 3S30A 3O0VA 1O8PA 4AW7A 2CHHA 4AQSA 1AYN2 2I45A 4M4RA 4COUA 3I59A 1ASJ2 2DBNA 2AEZA 3H50A 4HOOA 5IW0A 3GBWA 4LKSA 1XSQA 4BA6A 1CPNA 4FPKA 1UMHA 5FZCA 4JAAA 3VDDA 1KJLA 1WCDJ 2BRTA 4Y3OA 4FFGA 1CONA 1SLBA 2NP0A 4YZ1A 4N53C 3WPZA 3FL7A 1V9U3 1YQ6A 1Q8QA 3I2HA 2JKBA 1DZRA 3OD4A 1AL23 1OBNA 4QB6A 2UWBA 2W1QA 3K51A 4MO3M 5F5QA 4Z8BA 1LAJA 4O9GA 4S2FA 5FY8A 5F5AA 4AEKA 5HCFA 1Y9MA 4YVWC 5JXGA 3JB8A 4PDWA 4XFBA 4MGTA 2W46A 5FYTA 1UY0A 4W6YA 1MS0A 4WZFA 2D6MA 1C28A 3PUIA 4QT6A 3A0KA 3ZXKA 4XF4A 4AHYA 5BY5A 2WNUB 5C3SA 4UFJA 3TEZA 1W3XA 2ADDA 2LALA 3ZFEC 3OYWB 4B8EA 2PTMA 5A33B 4YW2A 1O5UA 5GZDA 5C9AB 5AC93 5FO9B 2GMEA 3FC0A 1ZRDA 4PIYA 1H8TB 4E4HA 3WQBA 4PLNA 1O3QA 3GZEA 1NZCA 2WLPA 2VCCA 1XYNA 2RS13 4IEWA 3RWKX 2RDSA 1URXA 4Q0VA 4Q0SA 4N9HA 3ZVXA 3OM4A 4IEQA 2P3JA 2XPJA 1Q8OA 2IFRA 4U6BA 1DZQA 1U5IA 4FCAA 3NMBA 1EUTA 2X53S 3C3VA 5BNOB 2B8MA 3MZHA 3PL0A 3PUAA 1JI6A 1H0BA 1OLMA 1CX4A 1RHI1 3URFA 5K9YA 5LWBA 1GYDB 3AYEA 3PJYA 2HWF3 5ACA3 4XUTA 4ZXKA 4D7SA 4DNYA 4YFZA 4OUEA 1CJPA 5FLHA 4ASLA 5F7UA 1N1YA 1V9U2 2IXIA 4FP2A 3VBSC 2PN5A 2DUPA 5IWFA 2BNNA 5IATA 1W9WA 2HWE1 4Z1VA 4ORFA 5FZ1A 1ZBA1 4YVSA 3TN93 1SLLA 1Q43A 5EJ1B 3Q8BA 5KR7A 1UOFA 3CLPA 4EE2A 2RS31 3HR9A 1U12A 4LIUA 4OCTA 5LEJA 1UZWA 3VD9A 1XNKA 2D5HA 4W6WA 4GWMA 3DUIA 3H3ZA 4GMP1 3WMZA 3I2GA 4I02A 3GJBA 2UY8A 3RI9A 4D6RA 1LB2A 1ULGA 3PTRB 2W47A 4LK6A 3HOBA 5J98B 3WD5A 1K5MB 1QOOA 4DO0A 5AC92 2GZWA 1UXXX 2VOVA 5FPAA 1NXMA 4QX3A 1ALYA 1H2LA 2O8QA 2VXJA 4D6QA 2WNOA 3AFKA 2FHRA 4LJHA 4LTAA 1JN2P 5JOXA 2RS12 4XE9A 4NUBA 2Y6JA 2VMCA 3ZFGC 2WKKA 2A73B 5FBZA 1PK6B 4XACA 1W6NB 4NOTA 3T4VA 3F95A 3K77A 5A32B 2KR2A 1QDOA 5IVJA 2PMWB 3I2OA 5D21A 5JI7A 4GMP0 5LK5A 1FXZA 5LA2A 3CDZB 4UFKA 1QJY1 4FPJA 4NROA 4MVTA 1HQLA 2JDMA 3DECA 1XB9A 2HWF2 4PVIA 1HX6A 4DY5A 3J26N 5ACA2 3R4SA 4AHXA 1MS4A 4WM8C 1IG3A 3KLSA 4QQHA 2P1BA 2QQMA 4YWAA 2Q8OA 1LHNA 2BV4A 1RUNA 2R49A 2R0FA 3TN92 1F9KA 2LUWA 2VOKA 3WPYA 3NKGA 1PGW2 2YPDA 1M4WA 4IL7A 4FQZA 5FYYA 5LATA 3ZR5A 4CEWA 2CU5A 4WM7A 5A70A 3S5AA 3D61A 3LEKA 3WV6A 3A22A 4P9WA 4I0WB 5G05L 3TEWA 1XSRA 2EVXA 5HCAA 1MR5A 3A23A 2FDHA 3M3QA 4ATFA 1UOBA 4IV1C 5K0UA 4CZSA 3IAQA 4FFIA 5F3GA 5FY5A 3WCRA 1TMF2 1DYKA 1VB2A 1W9TA 3FBMA 3VBHC 2F17A 3VKLA 4BQ1A 4UWDA 1ZZ9A 2MEV1 3H1YA 4LITA 5FP4A 2YROA 3USSA 3J7MA 5B4NA 2E6VA 1ND3A 2VUCA 3RZGA 4O8PA 1OT5A 3MLKA 5CB7A 5AYCA 2ZGNA 2ZCWA 4XJUA 1JS9A 3M1HA 1QJU1 4CP1A 3HN1A 5DQ0A 1W28A 1RC6A 3GGLA 1PZ7A 1V6NA 3AL6A 4YVWA 5SV8A 4O8OA 3HPNA 3RPQA 4N43C 4QPWA 4JRAA 4PT6A 1ZA7A 3QCWA 3QH6A 4IQPA 1Y43B 1OVPA 5JZGB 3VSSA 3HD8B 4XMIA 2DV9A 5I0RA 1R1ZA 1YI7A 2AACA 3OEBA 5L9RA 3JUUA 4DRVA 3QOPA 5EP9A 1SZBA 4UI9L 1BK1A 4H55A 3USUA 1SPPB 4RD7A 3AC0A 2VMEA 2WA4A 1ZBA3 2B46X 3HNMA 2HLEA 3U78A 4M3CE 5A6XA 5B6SA 4WVVA 3AKIA 3C7GA 3M3IA 4META 5ERLA 5FYMA 3I54A 3WQ0A 4Z92B 1PZ8A 2RS33 1ND2B 1UF2C 5BNQA 4M0NA 2VZ1A 2E7QA 1X9TA 1JYXA 4LA3A 2PAMA 4GMP3 2VOTA 1W6PB 4UF0A 3OY8B 2ARAA 5A7PA 2C1FA 1QU0A 5I93A 5FPUA 4N4BA 4K8FA 4AEJA 3ZYFA 3VKOA 5A3UA 2VAUA 2Y0IA 2F6BA 3IDEA 2X10A 3QACA 2E26A 3AKTA 4AHZA 2WO2A 4LOTA 5CBLA 1W90A 4XYXA 1UO9A 1S0EA 2ZGQA 4JGZC 3ZXGA 5CFCB 3JU9A 3WW4A 3EMRA 4OLLA 1NAEA 1SHWB 5A6QA 2TNFA 1LGNA 3PUSA 3UV9A 4NPLA 4QKBA 3ILRA 1XE7A 1MVEA 3CIHA 2ZGSA 2Y6FA 3NV1A 4CUBA 4DEQA 3VN4A 1GYKA 1MEC1 1VBD1 1EPWA 1EY2A 2ID4A 2DFCA 2UU8A 4HFSA 4YZ3A 2WSUA 3I3DA 3VBFC 3WNPA 1COV1 2WO1A 1RB8G 4GZ9A 3J7HA 4UFIA 5F5IA 3WOGA 1CJDA 2VPVA 3GCXA 2YY1A 3L9JT 4NRQA 4W65A 4AVBA 3VZKA 1QJY3 3CJIC 1G6NA 1OA2A 1RHI2 4JQRA 2JG9B 4O61A 4CCNA 2BNOA 3OD0A 5ANQA 3SISA 2CWSA 4QWNA 1PVC1 4LIVA 2X8FA 1RGSA 1YQ2A 3PVOA 3THDA 5IYYA 4WVZA 2Y64A 3R4ZA 1N3OA 2RG4A 1N1SA 3OB8A 4LBMA 1MPXA 4YW1A 2HWE2 2W95A 5EZWA 5FYVA 1ZBA2 1W06A 1UNBA 3SC7X 5C8CB 2Q1FA 3ZOIA 5A1LA 4QHZA 1W9YA 2RR13 3IDCB 4HT1T 1HRI1 2RS32 5I8TA 4P9IA 1XRUA 1YYNA 4IEUA 4EZ4A 4YM3A 4QU1A 3ZFGA 3AXEA 4BISA 3LA7A 1O8SA 5C4WC 2NPIA 4M4PA 2J1VA 3WZ1A 1W04A 2IXHA 2NLRA 2FMYA 2IC1A 2VULA 3ZSJA 2OS2A 1IKQA 3OGRA 3OM2A 5A7QA 2WNEA 1V0AA 2ZKLA 3E5UA 5FPVA 2VL4A 3KSCA 2WR9A 4D8MA 5EQUA 2X8SA 1R64A 2MEV3 3POSA 1QY4A 5T3NA 2ADEA 2DUOA 3OM6A 1AF9A 5F2SA 3ELNA 1UYPA 2VCBA 5FP9A 3K46A 4GH4A 4WM8A 5EYXA 3H1MA 1QJU3 3N9PA 1AX0A 3CJXA 1ZX5A 2GNTA 1I3HA 4KBBA 3MF9A 4LHNA 4Y1VA 1NG0A 2VXRA 4NAOA 3OPTA 1Y7BA 5D2AA 3WPUA 1H8VA 1WLCA 2YYOA 3FLRA 3S5QA 3WDVA 1F4AA 4Q4W1 1DQ1A 1QJY2 4FT8A 3CZUA 1LECA 4IV1A 3RMXA 3TNPB 3HN3A 2YGMA 4BB3A 3I3MA 2QQWA 2WRAA 2PHLA 4QX8A 3VBHA 3I59B 2DVDA 3AJYA 3AKFA 2WYFA 4D47A 3CQOA 2BZDA 1LHVA 2A6XA 1W39A 1YUDA 2P2KA 1AHSA 2WWJA 3NW4A 3D0JA 4EWEA 5JSRA 4AFDA 4GB31 4EWAA 3VDDB 3OG2A 4K9SA 5E89A 2PHWA 3VGIA 3NNLA 1SQ4A 2GN7A 4MADA 4YNIA 1YI9A 3RJ2X 1IGOA 3GZUC 4RR3A 4BMEA 2BBVA 3K3NA 4I2OA 4YG3A 5HXVA 5E16A 3U11A 2V09A 2KXLA 4I01A 3B94A 5LZ6A 3AJZA 5A6ZA 5JOWA 2LS6A 4KWUA 2Y33A 5FYZA 1REFA 4PDWB 2MEV2 1TVGA 1I1EA 1UIJA 3GXUA 3IAPA 3SH4A 2D44A 2YMZA 5KXBA 2VUJA 4R4XA 1X8MA 2P4EA 2D6KA 2VMFA 1MEC3 1QJU2 1UU5A 4XF9A 3AVRA 1VBD3 1X9PA 1AR91 4QXCA 1JZ8A 3ACIA 4AK7A 1S0BA 1XU2A 4IE4A 4L2NA 3ZXAC 1V6IA 2DTYA 1PMHX 2VVDA 3R4DB 2J1UA 3P1IA 4CCKA 1JHJA 1GMMA 2DF7A 4CXXA 2R30A 3E5XA 3UKTA 5JIAA 4OULA 5KHJA 4O65A 3DKQA 2ZGPA 5FIXA 3D6EA 1WBFA 4KU8A 4L9BA 5KHHA 1VAMA 4BCUA 2PA7A 4JTOA 1PVC3 5AY9A 3ZN4A 2J42A 4FXGB 1WD3A 1J3QA 1RL3A 1YLLA 4JGZA 4H7MA 5DUWA 4DIQA 4YGDA 3NAPA 1VMJA 3PVBB 2OIIA 1LOEA 2FMDA 5L7OC 1FPN1 4AAXA 3H3LA 1V70A 4K3UA 5DUUA 2JICA 5FZGA 4CUCA 3SKJE 4FBFA 1XYOA 5FO7B 4IESA 5FLWA 1HRI3 3EYPA 3KQ4B 4K1ZA 3UNPA 4FAHA 4KC8A 2GDFA 1WD4A 3K4DA 2PHUA 3D60A 3W20A 1PM7A 3VBFA 1DQ0A 2DDUA 1W2AX 2KD7A 2JIJA 4A3ZA 2BWAA 2ILMA 4AQ6A 3TBDA 1GQGA 3Q8CA 1S0DA 2SLIA 1RMU1 2GAUA 2ZEXA 4E2SA 3O1MA 1PMIA 2A75A 1H1MA 2R073 3CJIA 4FPCA 3WNNA 2FDFA 4FVVA 5FKBA 4YVSB 1HKDA 3KGZA 5CIRA 1SFYA 5J1XA 1O3RA 4FFFA 1DCSA 3AMMA 1CN1A 1PT2A 3POFA 4XBNA 2YV8A 2B39A 5F6LB 5JMOA 1AUYA 5C3QA 4TWTA 4LLFA 1J3PA 1NCRC 4DUXA 3WQ7A 3D5YA 1WCSA 1IG0A 2XHNA 3W5NA 1MEC2 4NN0A 1WLDA 2WJSA 4DS0A 1VBD2 4BK5A 2NQYA 1DGRN 4JZRA 5IAVA 1QQP1 1COV2 3KCXA 3O1VA 3WASA 1S0CA 1RUG3 1CAWA 2JDAA 4HETA 4CUAA 3NL1A 4Q4W3 3DCQA 5HBAA 1DGLA 2IXJA 1JYVA 3ILFA 4BZ4A 4CCEA 1JYNA 1LEMA 2ORXA 3AKGA 4QPIA 3BYLA 1LRHA 1PVC2 4IE0A 3BGAA 3D8CA 1W9FA 5DAPA 2ZS6B 2R0HA 2P3YA 3BUCA 4E8DA 1WMFA 2ZEYA 4LO7A 1HIXA 2BYVE 4GB33 5FLIA 3ETPA 4P9XA 4Q29A 2CDPA 3TB0A 3OGGA 5DPNA 4RQPA 3TAYA 3L2YA 2ZX4A 1QXRA 5EPAA 5FPXA 3RJRA 5LRSA 5A8CA 1CAVA 3KV4A 3MW2A 1HRI2 4A41A 2DCKA 1SMVA 3LDBA 4LKFA 3RYKA 1S2BA 4FOWA 1HLCA 2V4VA 3WF0A 3MW4A 2Q4SA 2XJTA 1XBFA 5JVVA 1VKDA 4QX2A 5AVAA 3KV6A 1U0AA 4QB2A 3PLQA 4Y1ZA 2H0BA 3BB6A 5ABJA 3ZMOA 5GLKA 3ZYJB 3PUHA 4XJZA 2ZAAA 2RHPA 5DUXA 1LOAA 4CEWB 5A7SA 4WM7B 1ST8A 2HWB1 3B00A 3N4MA 3BIEA 3WN1A 5FZ4A 1MQTA 1AR93 5FOBB 3AKRA 4EZHA 1ULFA 4JGYC 3VHNA 1FMD1 2Z79A 1VALA 3AMPA 1QH6A 5K0UB 3WNMA 3ZN6A 5FLJA 4KMQA 4FTBA 3AZZA 2P34A 1CPMA 2PQQA 2BBAA 1CAUA 2BEOA 2DBIA 1F35A 3OTFA 4JHZA 5IJRA 3UGGA 2BUKA 3WSOA 4D69A 4Z2AA 4FP3A 3LSEA 4FTEA 1ND3B 4TXWA 3WDUA 1DF0A 1QH7A 1JBCA 1ULCA 1AXKA 1VRH1 4PIXA 4Q4W2 3D82A 4UXAA 1QXPA 2OW4A 3BVCA 5KXDA 2FDKA 4QX7A 4JC1A 4OFGA 2D98A 5EWSA 5CZKA 4F7ZA 3M8LA 1Q3EA 1HB1A 4MGIE 1DQ6A 4YVWB 3OGVA 4A4AA 2ZX1A 4NRPA 1OC1A 1FPN3 4ONUA 4ASKA 3WG3A 3N9QA 1VBC1 3RQ0A 4BYYA 2VOXA 4GB32 1WMXA 5AYEA 2WZR3 2ZGTA 1E5RA 1UZ0A 1UIKA 3LF7A 4DMIA 5BNPC 3IMMA 3FHQA 1J1TA 2HEYF 3KWVA 2Q30A 1RMU3 3T30A 3TAWA 3IT8A 4NWVA 4OUMA 1YIPA 3USUB 4AK3A 4UW3A 4J6GA 3MLLA 5EJ3A 4HZFA 3UGHA 4UDKA 3OEAA 4I09A 3RZZA 2GP3A 2XHKA 4XAAA 1OMIA 1UY1A 2A6VA 3SH5A 5C3RA 4CEYC 1F5JA 4HVQA 1ULEA 1OQEA 1FATA 3BIWE 4GULA 4AI2A 1WW5A 4CDWC 3ZXEA 4UF0B 4A6OA 1E5IA 5L7OA 1C4RA 5DDJ1 1IOAA 4JTNA 4MG2A 1W8WA 4QPGC 5CNAA 1AR92 1VBE1 4QXKA 1W99A 1M06G 2GC1A 4IERA 1QQP3 3JB4C 1DQ4A 1X8EA 2GMPA 4XDOA 3VDBA 2HKXA 4XQ4A 2I07B 1LTEA 5I91A 4IDZA 4D0QA 1WLWA 2JD4A 4MUVA 3ACGA 5FFOC 3OPZA 2RS51 2QDNA 3AKPA 4C8DA 1QJX1 1Q8VA 3WDXA 1SLTA 4V2VA 2J7MA 2XG3A 4XCAA 3ETQA 4EN8B 4KC7A 1OOPC 4LE4A 4L97A 1UY2A 4I3GA 4XOGA 4IETA 4KG0A 1W6MA 4L0PA 3VL8A 1C3HA 4PI0A 5FAXA 4EYUA 4EN9B 2QFEA 2R6QA 1NCRA 3P3PA 3VB9A 4CDXC 1REDA 2B9VA 4QM9A 1BYHA 1G9AA 2BQPA 4NIDA 3AMHA 2LRPA 2W94A 2ORZA 4M3CF 4YW4A 1XNCA 2YU2A 3WX5A 1RMU2 4ZS2A 2QE3A 4A3XA 4U2AA 1D4VB 4G4FA 1NY71 3K48A 5LK7B 3QD6A 4R9AA 2VBBA 5DXDA 1SDDB 1V6OA 3K75B 1OPOA 1VMFA 5CG9A 1ZA4A 2HWB3 2W1WA 3ZFGB 5A3PA 5JMCA 4ZKTB 1YNAA 1ZRFA 4MOAA 4Z2WA 1ENRA 4NE9A 2W1SA 1FMD3 4QKNA 5L36A 1YFXA 2ZKNA 1OLQA 4NHKA 3ZYRA 2PHRA 2ARCA 1V6MA 4F83A 5F37A 1S2EA 4S2DA 3BPZA 1QQP2 1LJ7A 2Q5TA 2YFRA 1VRH3 1QKQA 5FQ0A 4GH4B 4WM8B 2W91A 2BNMA 1C1FA 1W18A 2WBKA 1UWWA 1IZ3A 4QGMA 2OXBA 1FX5A 1CVNA 1OD3A 1QDCA 2OZ6A 1LR5A 5FJHA 1O6UA 4OI4A 3TNQA 5IVVA 1CGPA 4K20A 5M0TA 1X7NA 4ZXEA 5ISLA 5KXCA 3NNJA 2DTWA 4P00B 1LGCA 1V00A 2DCJA 4XFIA 3DYOA 4XPVA 4B1LA 3D4KA 3O1PA 4JGYA 5IFPA 2XLFA 5JCTA 5D8AC 2Z4FA 1H9WA 4IV1B 3MHZA 3AXDA 3LGRA 1LHOA 2R32A 4XUOA 3FWEA 4IV3C 4IW3A 2CV6A 1JTZX 2QQVA 2VZTA 3B7MA 4Q2FA 3VBHB 1YIFA 3IN9A 5DAQA 3S7IA 3H7JA 3OUHA 3PNAA 4GWIA 3S0MA 3VUOA 3QEFA 4WBBA 1K42A 1UZYA 2BJSA 2VTFA 3AYAA 4XTMA 3TRSB 2C5DA 1H1IA 4LO6B 4ONZA 3PUQA 1AVBA 4A42A 1HN0A 1V6JA 2IFWA 4NR1A 4BWOA 3POGA 4ZS3A 3VL9A 2JIGA 3ECQA 4RR3B 2HWB2 2VNRA 1VBE3 3VBUA 2VJXA 1FMD2 2QQIA 5FUIA 3WT3A 1GV9A 1NE4A 5EHDA 3HVDA 3B69A 1WCUA 5FZOA 3MEPA 5BNPA 2DCTA 3O1OA 4UW5A 1LCLA 3I2KA 2PYTA 4LORA 3KT1A 4Y5TA 2QBXA 3NV3A 1X82A 4RS5A 3ZM8A 2RS53 2YBPA 5LY1A 2D6OX 1VRH2 4CSWA 5FV3A 3NV4A 4R9BA 3PDQA 2RE9A 2XLAA 5CEHA 3FZ3A 4D94A 1E57A 4CPBA 1DQ5A 5J36A 3MFCA 3H7YA 2ZX0A 4CEYA 2YBSA 4BXSV 1ZZCA 4B3NA 4D3WA 3ALQA 1Z0HA 1Q8PA 1ZVFA 2F4PA 5GZCA 3SXWA 3I2DA 4BXFA 4CCOA 1VBC2 4NHLA 1KITA 3FJSA 3C7FA 3EO6A 5DAVA 1F15A 2R7EB 3KM5A 2FZ2A 2VDTA 1SCSA 4JVAA 1OH4A 5EFUA 4KWKA 1DZTA 1U5XA 3WDTA 5HV0A 4JGZB 3O12A 5GLNA 1MS9A 3NAPB 4OMDA 3H42B 3AX4A 1ZZBA 3B5LB 3GHNA 3IMNA 3SH3A 3LFMA 3GNEA 2R041 3LDKA 1S4CA 4MXWA 4N7UA 4HKLA 5FXXA 4LT5A 2VCMA 1OOPA 2VZPA 1WA4A 2XL9A 3VBFB 4UAPA 1CD3G 3TEXA 4B1MA 5FWJA 3VZNA 1VPHA 1UYXA 2NM1A 2VQUA 5DDJ2 1YO8A 3ZXFA 1E5HA 3CJIB 5A7WA 2EF6A 1VBE2 3RWNA 5FY7A 2XKPA 2IUWA 3V56A 1WW4A 3O0WA 3LOIA 1PO21 4YM1A 1SBDA 2HEWF 4GALA 5CAZA 4OHVA 1YFWA 4E4ZA 2CWMA 2VM9A 4PIZA 1DIWA 1OI6A 4DPNA 1MVQA 1UKRA 2RS52 4DINB 4D7TA 4PI2A 1QJX2 3ASIA 3HQRA 4LUKA 1PVXA 1Y3TA 2AH2A 4DXTA 2WWUA 1HN1A 2GN3A 5GLTA 5J37A 3D5OA 4YARA 2VH9A 2H6CA 2UWCA 1SFPA 2W9XA 5JPNB 2YFZA 4E2GA 4A44A 3PIJA 3RSJA 1CAWB 5C4WB 4ZPIA 4AQ2A 1Q8SA 3PU8A 1ODNA 4KL1A 1TMF3 4QXBA 4BMBA 2XH6A 3SCFA 5BNNC 4HANA 4BU2A 3ZFFA 4QPIB 2OX0A 2PAEA 3VD4A 3WVJA 3UJOA 1IS5A 4OYUA 5J7MA 4V1PA 3R67A 4XF1A 2QDRA 1UOGA 1AX2A 4NHMA 5IVEA 1YQ8A 1NY72 2DFBA 3T2TA 4RQPB 4RSUA 1ZRRA 2DURA 1DYPA 4R4ZA 1CAVB 3PHMA 3U14A 4PBPA 2RV9A 4CDQC 1QOTA 3R4UA 3BYWA 4QQOA 5C71A 4LBKA 5H9PA 3S6PA 1QXJA 4PCRA 1TZOA 3KV9A 4HMZA 1F4HA 1OQ1A 3U1XA 3WF2A 5T50A 5D8AA 3ZLIA 4HONA 4JCKA 4Y5Z0 1ACCA 4Q1PA 2AREA 3T2PA 5ABJB 5DG1A 4IV3A 1DLCA 2VQTA 3Q8AA 4W8JA 2VW2A 4XFFA 2RDNA 4YLZA 2FCVA 5FZFA 1MQTB 3HNBM 3GALA 2JXAA 5EIYB 3T1MA 3BTZA 3Q8FA 3GZTB 4XIKA 5FZ9A 5DMYA 3ZN6B 1MACA 4EN0A 4UW6A 4LNVA 4O8NA 1CAUB 4PVAA 2HBUA 5KHKA 3ABZA 2BFUS 5JI9A 2DWRA 1B09A 2HEVF 1TQ5A 1ZBE1 1GNHA 1CR7A 2GNBA 4WZCA 4BLIA 2ZGLA 4N9IA 2YPJA 4E9KA 2WS91 4XVHA 3M3CA 3PVNA 2DU1A 1A8MA 4N53A 2XGXA 2D97A 2I2SA 1GWLA 1UYZA 1R091 2NMOA 4AVSA 1U5ZA 4OI1A 4JDNA 4S2HA 2R043 1OUSA 4H14A 4LBOA 5A7NA 3DPRC 2PHTA 1PHMA 2RVAA 5FYSA 4HL0A 1D7PM 3LA3A 1VB4A 2Y38A 2JDHA 2P3KA 4OQ9A 3ROUA 3ZXDA 3BOWA 3OGJA 3PU3A 4XHXA 4IEPA 1RHI3 4TN7A 4EROA 1SLAA 2XJPA 1O3TA 1Q5OA 3ZFEA 4HXCA 5JPMB 1WCKA 1E5SA 1PO23 2QCSB 4PQQA 1JZ5A 4KCAA 1RUOA 2AR6A 1DFQA 5A1FA 1C1LA 2WNVC 2BPA2 2HWE3 2VY0A 5A3NA 4D7YA 4X8PA 3UL2A 4B29A 1NLQA 5L7OB 1WA6X 2YFTA 2ZHNA 5LA1A 3M4FA 4OI0A 3SKVA 3CU7A 1UX6A 2EAKA 1EUUA 2Y26A 3KHCA 2YDEA 1ZREA 2VUDA 2YG0A 4HPKA 1I5ZA 3WDWA 4DXZA 1BZWA 1W05A 2E32A 3ZIWA 3J9SA 3VBRC 4Q8LA 3SHRA 5FRAA 2V72A 2XLGA 4ZU5A 4OHYA 3APBA 1W6MB 3VBSA 1U5YA 3DXTA 4Q26A 4PLMA 4R52A 2HWD1 1NCRB 2CTVA 2R042 1SFNA 4N90A 4CCCA 4N7IA 3IM0A 1G86A 3CL1A 1YC61 3LOBA 5SV5A 1JYWA 4F8AA 1ENXA 4XJAA 1O59A 2ZMLA 3BTXA 2O1QA 3WP4A 2A71A 2XR4A 1ZYBA 1YQCA 2BW8A 2IXKA 4P9YA 5C9AC 4AOCA 1LODA 1H8TC 5FZ3A 3DV8A 1CZSA 2QVSB 1LOBA 4XQWA 3VKFC 1H2NA 1PO22 2ZMKA 1OFNA 1BXHA 1GWMA 1PNGA 1LULA 2QUOA 4URTA 4HSLA 4HSJA 4XQDA 2W2IA 3MIBA 3OF1A 4K1YA 1YFUA 4C1WA 4LO5B 4L11A 3I3EA 5DN2A 2WWSA 3NJZA 4AR2A 3B01A 4MGZE 4W4ZA 1TE1B 2VZSA 2CL2A 3O1RA 5HXMA 3LPFA 3MYXA 1GZTA 4CDQA 1VIWB 1ZBE3 4K8RB 3TEYA 3CNAA 5FQ0B 1K12A 4PBOA 3NV2A 1YJKA 3ZO0B 5LBEA 2WS93 1A3KA 4XZUG 5K4LA 2CSGA 3VT2A 4OHXA 4XXAA 1W2NA 3AP4A 1DLLA 1QF3A 1R093 3K4AA 2SBAA 3AK0A 3M3OA 2R16A 4ES8A 3ZDSA 2D5FA 4LXLA 1I9RA 4FO9A 5I0SA 3RZKA 3GZAA 4EN6B 5B2GB 4RL7A 1H2MA 3N7LA 4QMAA 5FTTC 2W1UA 3EXUA 2Q1MA 4J1WA 4JGYB 2OQ6A 1GSLA 1BLZA 4MLOA 3N7KA 5FXWA 5FOJB 2BU9A 1JZ6A 1O7FA 3OM7A 1J84A 2YC2A 3LWCA 1KRIA 3POWA 5LEKA 2BGCA 1DGRA 2JENA 1FYUA 1K5MC 1KFUL 3FX3A 4MXVA 1RUE1 1QHDA 2XL7A 4NPRA 4NIHA 4AHWA 3R6SA 2DVAA 1NLSA 3H1WA 1KQRA 2ZMNA 3I3QA 2RDQA 2J1AA 4LBQA 1ZRCA 3LSDA 3PMEA 4ARXA 1MZ5A 3AKSA 3ENRA 4UDJA 4IUGA 5GZEA 4PF5A 1UV4A 4M01A 1TME1 1XJAA 4GWJA 1VMHA 3S57A 3VBUB 1NCQC 1HV1A 4NVPA 2VNVA 4K6BA 2G1MA 2DVBA 1W8HA 5GZGA 3NRUA 4QDQA 4UT5A 4CCMA 5BNPB 3N9NA 5FZOB 2E7TA 4P9LA 1KEXA 1TEIA 2HYXA 2ZBJA 4N43A 3J7NA 4B7KA 3AP9A 3I8TA 5KXEA 2OPWA 4GIQA 4RS5B 1ZBE2 1OA3A 5FY9A 2FDGA 4DEVA 2A5ZA 2WS92 1WL7A 4CEYB 1C8M1 1R1A1 4UDGA 2RJ2A 2NZ9A 2WNVA 3M2MA 1R092 3MICA 2OPKA 1DQ2A 2HWD3 1NYWA 4ISQA 1JYTA 5J09A 3RVHA 1BBT1 4CU8A 4QX0A 3T09A 4IGQA 1EV11 1D2SA 1LU2A 1BVVA 4JKKA 3RFRA 1RUH1 4YGEA 3ZPOA 5FZAA 1COV3 1W6QA 3KCCA 4RGGA 4V2WA 4BH9A 4AVVA 1AR61 4DOUA 4Q0UA 4ITCA 2C24A 2ZACA 1OKQA 4BHPA 3ZIXA 2Y6KA 3SMHA 3W58A 1EP0A 5GJ6A 2VG9A 4G9SB 1H6YA 2JE9A 1YQ5A 4JV4A 2IWGB 4MXWB 3ZYHA 2RM21 2GNDA 2IXCA 2VE1A 4CCDA 1OOPB 3VBRA 3WEZA 1ODMA 2H0VA 4NAMA 4YPJA 1G9DA 5GLQA 1NT0A 3H3UA 1UCXA 2ET1A 3KV5A 2VNOA 1GUIA 4B4PA 1NKGA 1J58A 3ME2A 1YRZA 5F5CA 3PMSA 1GQHA 4AE2A 2QKDA 4TTGA 4Y33A 5A7WB 1RUC1 4KWLA 4A7ZA 1WBLA 2NYYA 2AGSA 4LKDA 2FD8A 1JW6A 3ZSKA 1RUD1 4CYDA 4LHLA 2VVFA 2ZOEB 1OXCA 4FPHA 4W6XA 1YHFA 4WVWA 3T3YA 5I0DA 4YGBA 3J8F1 4HBNA 3POEA 5TSWA 2TBVA 4ET7A 3O1TA 2GH2A 1TNFA 5FZKA 4Y22A 3JCIA 3ON7A 4AEMA 1T6BX 4JKLA 3U4SA 5JLVA 3QZ4A 2Q1ZB 1FV2A 3T0DA 2A6ZA 1UZVA 3B3QE 2HWD2 3ZR6A 3EJKA 3S7EA 1LHUA 1Q56A 4QDRA 2OZJA 4LLOA 5A7VA 3CHXA 3ZFFB 3N3HA 3O1UA 4HVOA 1WMEA 4JRLA 2WZ8A 5C4WA 2VQAA 2X29A 2EIDA 1O4ZA 4YFWA 3DN7A 5DAWA 1HB2A 2WQ4A 1XNTA 4FFHA 1RUE3 3H8RA 1GYHA 3W59A 2Y34A 3ORJA 3FUOA 5CYYA 4B7EA 1H1AA 1FT9A 5FP7A 2N7GA 4KNCA 3EHKA 3OCPA 4CPBD 3T1LA 2RMU1 2ZX3A 3ACFA 3M3EA 1TME3 2OYZA 3LV4A 3QLQA 4LBLA 1XE8A 4LHKA 5CA6A 3OM5A 5DZEA 2XJUA 3C2UA 2B4KA 1VE0A 3DEMA 2EALA 2VW1A 4Y24A 5GALA 4B4RA 5FZ7A 4RGAA 2XXZA 5D8AB 4YRDA 2QNKA 2X09A 1LOFC 3LQCA 3V64A 4AK5A 4XAEA 4YW5A 5CU1A 1IS4A 4IV3B 1JMUB 1QOSA 1UX7A 1SACA 5C5UA 2DVFA 5D1IA 2DUQA 2FCUA 1RXFA 1H30A 1W3VA 2YXSA 1GQPA 5A7OA 1VBA1 3GCWA 3LD8A 3KF3A 1C8M3 2EICA 5IVCA 2BTVC 5FBJA 3EQEA 5HV4A 1OLME 3HT2A 3N9LA 3SNMA 1BBT3 3HQXA 4EWDA 4M3CA 1S0FA 1EV13 3BYKA 3MBWA 1ZNPA 3Q8EA 1IPSA 1RUH3 4XTPA 5I8SA 1NCQA 2ARBA 1FI2A 4OZXA 3T2OA 1AR63 5CKNA 3KCYA 2EIEA 4X6QB 1YFYA 2P37A 2X8TA 4HK9A 2ZZQA 1LESA 4N53B 4CDUC 2WLQA 1GOHA 2YFUA 5J3UA 4UDIA 1H4HA 1F5FA 2AUYA 5CADA 4K21A 1RITA 3W5MA 1GWKA 3NKTA 3HAGA 4RFRB 1FOD1 3NJYA 3T4HB 4E27A 5AFBA 1GFF2 2P6CA 2PHDA 1BQPA 1HB3A 1RUE2 2JG8C 2RM23 4KGQA 3C7HA 4M0HA 4DRRA 1Y9GA 1G8WA 3KMHA 3MV01 1CIYA 4KU7A 4F3JA 5C3PA 3U4XA 2H6BA 2GC0A 3ES1A 2VZRA 1OKOA 3JBG1 5FMCA 1W2OA 3CZJA 3BTYA 1TME2 1IQDC 1RUC3 3ACHA 4COWA 4LBJA 3VD7A 3ZFEB 1X36A 1ZZ6A 3AP6A 5A80A 3JD71 1DGWA 4CE8A 1RUD3 3ZSEA 5C8WA 3EB7A 2VZOA 3LEGA 2ZA9A 3IB3A 1J3RA 3J8F3 1Z7S2 4X8NA 4YM0A 5IVYA 3E6DA 5LRRA 3POYA 1W0PA 1RTVA 2AENA 2D40A 1GZ9A 4MHUA 3GM8A 1UOJA 3E97A 4NMIA 2AEYA 1GICA 4NIIA 1C8M2 1R1A2 3EBRA 3MUY1 1OUXA 4I3PA 2ZGOA 4HVRA 3OGSA 5DZGA 1DGWX 4COYA 1BBT2 4HPKB 1EV12 4IE5A 5FUNA 2BDRA 1C8NA 5FCCA 1RUH2 2OVUA 1L7QA 3M70A 1AR62 3BPSA 4N2RA 3BTAA 3N9OA 1W8TA 1AZDA 4XHBA 2UURA 3QBQA 4ZZ5A 3VBSB 5BV6A 2AC1A 1C5HA 1XNAA 2JDZA 3P3NA 1AJKA 4PDWC 2WT0A 3B93A 3LKJA 5A3LA 1HXS1 2YC0A 2D3SA 4QHBA 3UT0A 1GP5A 2RM22 2CYFA 1UMIA 5H9SA 2RMU3 1JXNA 1L3JA 2CAVA 4PF1A 4AEDC 4CA9A 3VSFA 2OKXA 3L2HA 1OURA 2YU1A 4INDA 3VZLA 1OLRA 4P5HA 2BWCA 2XB6C 1DBNA 4PHZA 1JODA 1RUC2 2Z69A 5IFTA 1UW8A 2ZHMA 1AYM1 2JD9A 1RIRA 3A0NA 3WXPA 1L7LA 2HWC2 2UYBA 5FR3A 1RUD2 4NIGA 3KF5A 1AL21 4XURA 2W3JA 1F31A 5L9BA 2WINB 3X29B 3OUIA 4GQ7A 4FPOB 1VBA3 4ZHNA 3J8F2 2QQPA 2RDRA 5LW9A 5AYDA 3ZX7A 5T5OA 1XE0A 1NOVA 1AX1A 1J83A 2NN8A 4XMAA 3WHTA 1J59A 4AI0A 3T0AA 4CDQB 1KD7A 1GZWA 4XC9A 4QDSA 3FUQA 4GJZA 2CGNA 3KVAA 3SCHA 4L92A 4KBZA 5CFDC 3FLPA 5IT6A 1N1VA 4XBQA 1LOFA 1AR71 2BGOA 1PO11 2VTXJ 3W21A 3WF3A 1GOFA 2OA2A 2VMGA 3ZYBA 5IK7A 1FOD3 3ZPYA 3VKMA 1JU4A 5FP3A 3WN0A 3O14A 2YGLA 1UPSA 2VZQA 3OBZA 4TLGA 4NHYA 1K3IA 3B9IA 4P9JA 1UZZA 2A3YA 3VV1A 5K8SA 2VUAA 2JDUA 3ATGA 3K2OA 3JBG3 1F2NA 2RMU2 1VBC3 4LHSA 2VC9A 3K3OA 4BQWA 1WMDA 2VW0A 2VGDA 3VZOA 4QGNA 3TYJA 4CTEA 1W8FA 1I6XA 3ES4A 3R0RA 1NXD1 3JD73 4IE7A 4O9EA 4AI3A 1JOPA 2Y60A 1KJRA 4FXKB 2PAKA 1WUVA 2D7FA 3SLIA 4CDUA 4COTA 2V5YA 2ZHLA 5E88A 4LBQB 4XETA 3UETA 3BI3A 4Q4Y1 5T5PA 4B4QA 4QQ2A 3BN6A 1Y9QA 2YC4A 1VBA2 1HV0A 2JG8A 3IWZA 5DABA 2C0ZA 2CY6A 2LW8A 4UW4A 3PTYA 1V6KA 2X5IC 5A8DA 3TOJA 3N7JA 4MZUA 5DDJ3 5A3TA 5EYYA 1HQNA 1SBEA 1FNYA 2OUJA 4N43B 4P02B 4QD2A 5GLVA 1W2TA 3ZN5A 2VBDA 2FZ1A 4CU6A 3I4IA 3OPWA 4RN5A 5FXVA 2D3PA 2VD7A 5GLRA 1LEDA 5AFEA 1IHMA 1TNRA 2BVVA 2P17A 3CO2A 3WF1A 3NSTA 2RJLA 2WNVB 2XWBB 1QJX3 3I49A 1N3QA 5E1RA 1HXS3 3OBRA 1FOD2 4FAGA 4QM8A 1JH5A 5H9RA 3MIHA 4CEWC 4GAZA 4WM7C 3KS7A 5JDBA 3AKHA 5HCBA 2CGOA 2G19A 1W6QB 2ZGMA 4Z07A 2C26A 4CP9A 2R1DA 5FKCA 4CDWA 4EQVA 2KM2A 3VBOC 3JBG2 1DP0A 4GWNA 5K0UC 3KSTA 3UGFA 4SBVA 4BQYA 1XYPA 3AZYA 2V73A 4H2AA 4QPGA 1STMA 2Y0OA 3OOXA 4RHV1 1AYM3 4QX1A 4AYUA 2LM3A 2Y6GA 3HNYM 4DB5A 3JD72 5FYCA 3WNLA 1ND3C 4BIFA 1NX9A 4HKOA 4DXSA 1JZ3A 3VBRB 1G9FA 1JU3A 2FCTA 1VBB1 2GC2A 5LBCA 1LKNA 1LOCA 1OQDA 4E4DX 3WUDA 2IZWA 3CKHA 4AGGA 3U37A 4TYSA 4K40A 3LPGA 4QU2A 5FZ0A 4YZ2A 5LB6A 2VR4A 5FUPA 5T5LA 2E31A 1N1TA 3B02A 1IKPA 4I30A 3I97A 3HMYA 3LIHA 4DUVA 3WCSA 5DAXA 4S2GA 1IPKA 1UXZA 4AEDA 5GKAC 3WY6A 4AZZA 2MPFA 4BQ4A 3I2IA 5FZEA 4CDXA 2W87A 1AR73 3AZXA 3WG2A 1PO13 4OI2A 3RGBA 4XDQA 4BQ5A 1O4YA 4CUGA 2JDPA 3PURA 1W8UA 4IEVA 2DU0A 2XKOA 4MHRA 4Y22B 1D2QA 3MLJA 4LMFA 1OVSA 2J1EA 5E8AA 3AZVA 4LBQD 1JYIA 3IDAA 3LEIA 2VZUA 3A7QA 1YEWA 5GLOA 3HWJA 4KI5M 5FMBA 1UU4A 1HXS2 4J1XA 4SLIA 1H4GA 2P5BA 3E5QA 3POBA 1WWYA 5L9VA 2BP6A 3WHUA 5A7VB 4IGOA 1RYYA 4XEZA 3HEIA 3H9AA 5LBFA 4Q8KA 1RUF1 1W0OA 5J48A 5HPOA 2ES3A 3JXSA 3HBZA 3V65A 5CFDA 1X50A 3G7DA 1AYM2 1NA1C 1KXGA 3MFAA 5I0TA 2WC2A 1VAKA 1RVF1 3MIEA 4Q4Y3 5FY0A 1AL22 4CXYA 2QQNA 2D6NA 3QC2A 1WKYA 2JB4A 1PIV1 5JXHA 3AYDA 5JOYA 1S1AA 2JDKA 5GLPA 3C7OA 4TLFA 5L73A 5DZFA 3THPA 1QIQA 4ATEA 3THCA 2Z2SB 2A3XA 5FYUA 5LA9A 2ENRA 2EIBA 3AP5A 4ZU4A 3U10A 2VMDA 1DDLA 1QEXA 1YXWA 1Y4WA 5T52A 2XVLA 3AMNA 2B45X 4NJ4A 4Q0PA 3VHPA 4AI8A 2WIIB 3UKNA 1ULDA 3UESA 5JSPA 5J96B 3BKZA 3WATA 4P08A 5FMDA 3WP6A 2HJIA 3RZHA 3KT7A 1S0GA 2GC3A 2JWPA 2WZEA 4MSVA 1AR72 1MS1A 1OSGA 1PMJX 1PO12 5FP8A 4BJ0A 2E63A 2JEMA 2B42B 3CBNA 5FPBA 1NUKA 2XONA 4AQTA 3LZZA 4P14A 1KS5A 1XPWA 4RYDA 5IAXA 2WN3A 4M3CB 4IEXA 1OPMA 2YFSA 1VRBA 3JQXA 1KGYA 1NCQB 4ZZ8A 1CZVA 4LR4A 5BYNA 2X5IA 1KS4A 2VZ3A 4LULA 5LBBA 3IPVA 2B5HA 5FZ8A 1H2KA 1JYCA 3F2ZA 4AVAA 4LBNA 4WV8A 4QQSA 4UBGA 3LCPA 3C7EA 4RHV3 4BOWA 2G9ZA 4WVMA 3POIA 5E6HA 3RNSA 3D0SA 4FPYA 1UMZA 5LA0A 2EXIA 4RGKA 4GH4C 4Y5SA 4K7JA 1V6LA 4BPZA 1VBB3 4YSFA 1A8DA 2QQLA 4MX3A 5A3MA 2GP5A 2WUHA 2ZABA 3FMGA 4KQ7A 4LO4B 4Q4Y2 1IQAA 1JUHA 3IBMA 5KHGA 1LHWA 2Z42A 5FYBA 2P6HA 2RR11 2ZAHA 4FPEA 4ZONA 2TUNA 3MPBA 4IEYA 5LCWL 3O5SA 2WA3A 3VSRA 1OFSA 1YCIA 3KZ4C 4IXLA 5BXXA 3VBOA 4XUNA 3LB9A 1Z78A 3AM2A 5CVRA 3UYJA 1DYOA 1K5JA 2CAUA 2DCZA 4MGYE 3VT1A 5I8YA 4UYBA 5B4XA 3GDBA 3V0BA 4H3WA 3LIGA 4Q4X1 3RZJA 4LUMA 3ST7A 1B35C 4OQ8A 3WPVA 3BU0A 4Y20A 5AVPA 4MGKE 4UOJA 2CDOA 4KH9A 1BVP1 4UFMA 4XF0A 4UFHA 2A6WA 2GSYA 3AKQA 5JIUA 4XFHA 1O5LA 2B7YA 1QGLA 2A6YA 1AR81 1P8JA 2V5DA 4RR3C 4AG4A 3Q9OA 3H8XA 5FPLA 4EV0A 4LEJA 2E53A 2YUEA 4FSJA 4KWJA 2B4WA 1RUF3 4NIAA 5JSOA 3KGLA 4QKDA 1CWPA 3RYPA 2W92A 4C91A 5C2MA 3KD4A 2HH9A 1RUI1 2VZVA 3N36A 5F6KA 5FREA 3WLUA 3WNXA 4CP2A 1XXNA 2WSVA 4RHV2 4BQ2A 3U0ZA 5A6YA 1XQNA 1RVF3 1WW7A 4LKEA 3IKWA 2VTXA 1PIV3 3NJVA 1VBB2 1X33A 5F8PA 5F3EA 1CAXA 2Q0AA 2A7AA 1A6CA 4JDOA 4YGCA 3UK9A 2VU9A 2VQ0A 1XOYA 2WQ8A 5CKQA 2XJVA 3WINE 2IVJA 2PLV1 2WNUC 4Y4RA 1W9SA 1CIWA 2C4XA 3FN9A 3U07A 3ZSLA 2BFUL 1D4M1 4MLGA 4A2UA 4NHXA 4TZDA 5ANNA 1YJLA 2R061 4YG0A 2G9GA 5F3CA 1REEA 4OVEA 5BNNA 4QB1A 2K46A 3SQOA 2WABA 3NAPC 1NA1A 4QX5A 5FZMA 2IXLA 2XMLA 3R4YA 2XJQA 3WP3A 1JHNA 2C9KA 2WDBA 3AFGA 4UBHA 1UQXA 1XU1A 4GKYA 1HB4A 1GZWB 3IDBB 1GNZA 2WFF1 3G6JB 4YZ4A 2VO5A 1EYBA 1O91A 3PVEA 2O14A 5BNOC 3KT4A 5LASA 1GP4A 1GKBA 3WDYA 3RI8A 2BVBA 1DHKB 3LDRA 3NJXA 1H9PA 1R081 3BYJA 4UDKE 1NZIA 2VMIA 2XUEA 1RUF2 3IIIA 3CF6E 2DYCA 2XJSA 3OJBA 2D3RA 3PIGA 5IVFA 4XW3A 5JOZA 3I2FA 5FZIA 1ZM1A 1GANA 2E9QA 4CVUA 2QZ2A 4AK6A 2EAAA 1RVF2 5FDBA 1CZTA 2AYHA 4AXOA 3WMYA 1QJZA 1HRV1 1GP6A 1PIV2 1SLCA 2AZ5A 2JKXA 1UU6A 1HDKA 3LE0A 1PGL1 2XDVA 1W6OA 3ZXLA 5C70A 2WL1A 2WO7A 3MDPA 1UL9A 2UYAA 4JKMA 1US2A 3KB5A 2XUMA 3JZVA 1GBGA 4G3YC 2K2SA 4NO4A 3FFZA 3V0AA 5FYIA 2XVGA 2QQJA 1PM4A 4JQTA 4XUPA 4YW6A 1WLTA 3VDAA 4CDUB 2WN2A 5C6CA 3BYNA 2R071 2Y6HA 2VCAA 1G9BA 2QQUA 4E4SA 4QPIC 1XNDA 1GLHA 5GLWA 1IS6A 4Q4X3 3SEPA 1ZZ8A 2W52A 4KCBA 3MW3A 4Y4YA 2YBKA 2JG8B 4DY3A 3CMGA 3VD3A 4ASMB 3ILNA 1NQDA 4HKWA 5F32A 3ZXJA 4U36A 4XBLA 5FZDA 3WQ1A 1GYEB 4RQPC 2G9FA 4AI9A 5BPXA 2C9AA 2HBTA 4JHTA 2K9ZA 2JE8A 3OSDA 4N1IA 1AR83 3MPPG 3POJA 2CNAA 2J1TA 3ACLA 3DPRA 4FOYA 1PK6C 4QPYA 2WO3A 4BE3A 3WAUA 2XJRA 1S0JA 3K4ZA 2G4IA 3KQRA 1RUG1 1BKZA 1S55A 4M00A 3VD5A 3SEEA 1IS3A 1RUI3 3I7DA 2Y6LA 1MS5A 3MIDA 1Z7S1 4GKXA 4HN0A 4IE6A 4MYEA 2JJ6A 4EN7B 5ABJC 4FOQA 4XF3A 1HJFA 5KC5A 3QH7A 4A6SA 1US3A 1B35A 4C1XA 4LQRA 1MQTC 5CKMA 4CP9B 4AFMA 3MIGA 1ULPA 4CDWB 2OQ7A 2EIGA 5JR2A 5FWEA 2O8OA 1OH3A 1GOGA 2PLV3 2X8KA 2RR12 4FPGA 4QPGB 3VHRA 4DQAA 5F39A 4C0BA 3I3BA 3E6CC 3BALA 4AGVA 4COZA 4CU7A 1LOGA 1SEFA 1W0NA 1UN1A 1D4M3 4CP0A 4AL9A 4OHWA 5IK5A 2R063 4GXLA 4QKFA 2LTNA 2UWAA 2XBO1 3GF6A 3JQWA 1G9CA 3E6BA 3J7LA 4XXPA 3ZKUA 3LFIA 2C6SA 3TWIA 3ZYGA 4XFGA 4E8CA 1MS3A 4Q4X2 5FYHA 2W08A 4OZOA 1SBFA 3ZSMA 3VZMA 3QEEA 1T6GC 3ZYPA 4AEDB 2ZHKA 3FHIB 4LK7A 1F8VA 2WFF3 4A7KA 1RUJ1 1PX4A 2E7AA 3VHOA 1A78A 3LEMA 4CDXB 2TEPA 1AR82 3AZWA 4LA2A 4CRQA 4YZ5A 5KBFA 1O3SA 5C0PA 1R083 2WNUA 3BU7A 1UKGA 5A3OA 2HWC1 5JZGC 3I2JA 4CCJA 4QQPA 3OYWA 2YZ4A 1AXZA 4N2ZA 1GU3A 5C33A 3DGTA 5A33A 4XZPA 5L19A 4FQ4A 1RJ7A 1RUI2 2ET7A 3ZKYA 5C9AA 2HYKA 5HI0A 2E33A 1H8TA 1RJ8A 2FQPA 4W50A 2Q8EA 4URAA 2WT1A 2FBEA 3H8OA 1DG6A 1J1LA 4ZU7A 1QNWA 3WR0A 3UKVA 1APNA 1EAH1 1HRV3 4R8HA 5H9QA 3WG1A 4BQXA 1OHFA 1ND2C 4QAWA 5GLUA 3N35A 4QXHA 1BMV1 3RYRA 3WW2A 4XFAA 1K45A 3T2QA 1WCQA 2WZR1 3GBGA 3IZOA 2QJVA 3IIAA 5FY1A 5EXOA 2XQRA 2D6PA 1BEV1 2WYSA 2PXJA 4Q1RA 2PLV2 1UYYA 5I0UA 5BNOA 1XNBA 5CFDB 4I0BA 5F1RA 3AMQA 2LROA 5EV7A 3N7MA 2BOJA 3MI8A 5T55A 4RA0A 3RG0A 1D4M2 2VMHA 2W5FA 3DYPA 4XIOA 4Z82A 1UPIA 1QJFA 2R062 1ENQA 1ZRIA 4LE3A 4BDVB 2ETEA 3INAA 3KHBA 2J1SA 2WT2A 4QHOA 5CFCC 1D0HA 2PHXA 4TSVA 1BJQA 5APAA 4NOVA 1HW5A 2KA3A 3NO8A 4AAPA 3D3AA 4BLJA 2V4AA 2B9UA 3CU9A 3MGUA 4UFLA 1PGSA 4YYOA 1DU3D 2D6LX 3VDCA 2WFF2 3FBYA 2WAOA 1VR3A 1RINA 1W2UA 4YW3A 1GR3A 5JAXA 2A3WA 1O4TA 1R082 1Z7S3 2JG9C 2BOIA 3HT1A 1C5IA 1W8NA 3NWKA 4MGSA 3T0BA 2DVGA 2XWJB 1TL2A 3O7OA 1VP6A 4AFAA 4XILA 1QNYA 5JUVA 1T2XA 2WZPP 1D0GA 1K5MA 3WW1A 2ZJCA 4NWWA 3O0XA 3WW3A 4L99A 3RZMA 1ENSA 1R1A3 3LAGA 3C8XA 2GALA 5LY2A 2GMMA 4PLOA 2X5IB 5DUVA 5C3OA 5C8CC 3B9CA 1PNFA 4NPMA 3IPVB 4Y1YA 2D93A 1HRV2 1QWRA 1JZ4A 1TG7A 3VKNA 3ITQA 4E2QA 5JR7B 1PGL2 4I0AA 4BIOA 2JECA 4WVMB 1PK6A 3NNMA 1W6NA 2MNGA 2W68A 4P9GA 4Q4V1 2NMNA 3SCGA 3W9AA 4OMCA 4C0HA 1SG3A 5A32A 5C5TA 1MZEA 3RZLA 5GLLA 4DXRA 2D43A 5FY4A 1ONAA 3AP7A 1QJEA 3VT0A 2F4LA 5G04L 2R072 2XBO3 3WNOA 3BOPA 2ZPXA 3MF6A 3ZMNA 1AYN1 1ASJ1 3FLTA 1POQA 1UY4A 1XC6A 1W03A 2XVKA 3BCWA 4XABA 4AFCA 4A7YA 4H7LA 1UAIA 2BERA 4XUQA 4R9CA 2X05A 2EA7A 2YB7A 1VJ2A 4ISRA 1RUJ3 3R05A 5EJZB 4Q5OA 3VBOB 2QQKA 5JXIA 3THTA 2ARXA 2A1XA 1LGBA 4FOVA 3GJAA 4Q0QA 4ES9A 1N47A 5IHRA 5KC6A 4FTSA 5FMOS 3V0BB 2HWC3 4Y1UA 4AF9A 1N3PA 1RUG2 4CXWA 1FAYA 3DL3A 5K7PA 4AVCA 3MIFA 1YWKA 2EXJA 4Y20B 5A1AA 1WZXA 4XCBA 3AL5A 4P5YA 1EPZA 1OYGA 4GD4A 1SCRA 1BCXA 4YG6A 3VSZA 2JDYA 2FDIA 5FZLA 4EJRA 3M7AA 1EAH3 4KMIA 1KDMA 3GBFA 3OBTA 3VBUC 4U6DA 4O7XA 3VDDC 1GZCA 2ZZJA 3NVCA 3A4UA 1FNZA 4FPLA 4OUSA 2K0GA 2O0OA 5F2WA 1BEV3 3AVSA 4IEOA 4ZY9A 2DCYA 4R9DA 1S0IA 1ZZ7A 3RMYA 1NE6A 2L9LA 3DKWA 1WGPA 4AVTA 5A3WA 4RS5C 2BGPA 1I5PA 5JZGA 2ATFA 2UY9A 4D6SA 1L7RA 1VAVA 2XOMA 1OF3A 4COVA 1POV1 3NNGA 5FO8B 5KWRA 1W8ZA 4Y26A 3U75A 1OA4A 1ULOA 1WW6A 4YW7A 1AJOA 1OF4A 2MHFA 4Y1XA 4JX0A 1CAXB 4PQ9A 5FZHA 2XBO2 4J25A 4A45A 2PHFA 2QQOA 1MZ6A 2EXKA 5CG8A 1SPPA 3AYCA 3HIFA 1KDKA 2E51A 4HLTA 5B6TA 1PX3A 1CX1A 3LA2A 3GHMA 2ZTNA 1HQWA 3DF0A 2VNGA 1S2KA 2Z5WA 3HBKA 5GZFA 3O1SA 1HJGA 3K1UA 1ND2A 3NQHA 2I74A
chains in the Genus database with same CATH topology
3H3LA 5AYEA 3WPVA 3WPZA 3BYKA 3ZXJA 1GYEB 5FLWA 3LF7A 2QQVA 3IMMA 3OSDA 3SC7X 3D60A 4KC8A 4UFMA 1YIFA 4UFHA 4QHZA 2X8TA 3QEFA 3R67A 4N1IA 3WAUA 3WN2A 4CCCA 3TAWA 3WPYA 4UDIA 5GLOA 3UGHA 1Y9MA 5FMBA 3ZR5A 4UDKA 3WN0A 4ONZA 2B4WA 3U14A 5FKBA 3OM2A 5A7VB 3ZXKA 3C7HA 1Y9GA 4FFFA 4UFJA 2ADDA 2X8SA 4FFIA 1PT2A 3U1XA 4CCDA 2ADEA 3OM6A 5GLQA 5FMCA 1UYPA 4O8PA 3D5YA 1YRZA 5AYCA 3D61A 3QC2A 4COTA 3WASA 5JOYA 1Y7BA 5GLLA 5GLPA 3WPUA 3RWKX 3C7OA 3OM4A 4O8OA 3VT0A 3S5QA 4U6BA 4KC7A 4CCEA 3NMBA 4O8NA 4PVAA 3AKGA 3P2NA 3BYLA 2AEYA 4MLGA 1Y4WA 3VSSA 5A8DA 1YI7A 5ANNA 2QQWA 3LFIA 1GYDB 3VT2A 3WATA 3AKFA 3C7FA 5FMDA 1W2TA 4D47A 3QZ4A 2VDTA 4PVIA 3QEEA 3R4YA 5GLRA 5B6SA 5A8CA 3ZR6A 3AKIA 3C7GA 5GLNA 3LEMA 5FK8A 4N2RA 5A7VA 5C0PA 2YFSA 3LDKA 2EXJA 3OM7A 1VKDA 4N2ZA 2AC1A 3LDRA 3BYJA 4FFHA 3AKHA 4N4BA 4UDKE 1GYHA 1OYGA 3WMZA 3VSZA 4B1MA 5JOWA 5FKCA 5GLKA 3PIGA 4EQVA 4HXCA 4QQSA 3C7EA 4KMIA 3KSTA 3VSFA 3D5ZA 3UGFA 5JOZA 4UDGA 4KCAA 5FK7A 1ST8A 3WN1A 4U6DA 3LV4A 2EXIA 4UDJA 3QEDA 5GLMA 4AK6A 3OM5A 1UV4A 3C2UA 3WMYA 4AK7A 2EXHA 3UGGA 2YFRA 2XQRA 2YFTA 4AK5A 3ZXLA 3KF5A 5JOXA 1W18A 3U75A 2OXBA 4UFIA 5AYDA 4JQTA 5FIXA 3BYNA 2AEZA 3LIHA 3VSRA 2EXKA 3PIJA 2QQUA 3KF3A 5AY9A 4UFKA 5B6TA 4AZZA 3VT1A 4KCBA 4NOVA 3HBKA 1WL7A 2X8FA 4B1LA 3NQHA 3K1UA 3CU9A 4FFGA 3LIGA 4UFLA 3R4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3L A;  5AYE A;  3WPV A;  3WPZ A;  3BYK A;  3ZXJ A;  1GYE B;  5FLW A;  3LF7 A;  2QQV A;  3IMM A;  3OSD A;  3SC7 X;  3D60 A;  4KC8 A;  4UFM A;  1YIF A;  4UFH A;  4QHZ A;  2X8T A;  3QEF A;  3R67 A;  4N1I A;  3WAU A;  3WN2 A;  4CCC A;  3TAW A;  3WPY A;  4UDI A;  5GLO A;  3UGH A;  1Y9M A;  5FMB A;  3ZR5 A;  4UDK A;  3WN0 A;  4ONZ A;  2B4W A;  3U14 A;  5FKB A;  3OM2 A;  5A7V B;  3ZXK A;  3C7H A;  1Y9G A;  4FFF A;  4UFJ A;  2ADD A;  2X8S A;  4FFI A;  1PT2 A;  3U1X A;  4CCD A;  2ADE A;  3OM6 A;  5GLQ A;  5FMC A;  1UYP A;  4O8P A;  3D5Y A;  1YRZ A;  5AYC A;  3D61 A;  3QC2 A;  4COT A;  3WAS A;  5JOY A;  1Y7B A;  5GLL A;  5GLP A;  3WPU A;  3RWK X;  3C7O A;  3OM4 A;  4O8O A;  3VT0 A;  3S5Q A;  4U6B A;  4KC7 A;  4CCE A;  3NMB A;  4O8N A;  4PVA A;  3AKG A;  3P2N A;  3BYL A;  2AEY A;  4MLG A;  1Y4W A;  3VSS A;  5A8D A;  1YI7 A;  5ANN A;  2QQW A;  3LFI A;  1GYD B;  3VT2 A;  3WAT A;  3AKF A;  3C7F A;  5FMD A;  1W2T A;  4D47 A;  3QZ4 A;  2VDT A;  4PVI A;  3QEE A;  3R4Y A;  5GLR A;  5B6S A;  5A8C A;  3ZR6 A;  3AKI A;  3C7G A;  5GLN A;  3LEM A;  5FK8 A;  4N2R A;  5A7V A;  5C0P A;  2YFS A;  3LDK A;  2EXJ A;  3OM7 A;  1VKD A;  4N2Z A;  2AC1 A;  3LDR A;  3BYJ A;  4FFH A;  3AKH A;  4N4B A;  4UDK E;  1GYH A;  1OYG A;  3WMZ A;  3VSZ A;  4B1M A;  5JOW A;  5FKC A;  5GLK A;  3PIG A;  4EQV A;  4HXC A;  4QQS A;  3C7E A;  4KMI A;  3KST A;  3VSF A;  3D5Z A;  3UGF A;  5JOZ A;  4UDG A;  4KCA A;  5FK7 A;  1ST8 A;  3WN1 A;  4U6D A;  3LV4 A;  2EXI A;  4UDJ A;  3QED A;  5GLM A;  4AK6 A;  3OM5 A;  1UV4 A;  3C2U A;  3WMY A;  4AK7 A;  2EXH A;  3UGG A;  2YFR A;  2XQR A;  2YFT A;  4AK5 A;  3ZXL A;  3KF5 A;  5JOX A;  1W18 A;  3U75 A;  2OXB A;  4UFI A;  5AYD A;  4JQT A;  5FIX A;  3BYN A;  2AEZ A;  3LIH A;  3VSR A;  2EXK A;  3PIJ A;  2QQU A;  3KF3 A;  5AY9 A;  4UFK A;  5B6T A;  4AZZ A;  3VT1 A;  4KCB A;  4NOV A;  3HBK A;  1WL7 A;  2X8F A;  4B1L A;  3NQH A;  3K1U A;  3CU9 A;  4FFG A;  3LIG A;  4UFL A;  3R4Z A; 
#chains in the Genus database with same CATH topology
 1BHG A;  3FHA A;  2J1R A;  1KFX L;  4RFT 0;  1RUJ 2;  2PFW A;  1W6P A;  4CCL A;  1G7Y A;  2J22 A;  3PJQ A;  2VVE A;  4XFC A;  3OY8 A;  5GM0 A;  4HK8 A;  5BNN B;  2Q8C A;  2YHJ A;  1V9U 1;  4QGL A;  3VLB B;  3WN2 A;  1NA1 B;  1FV3 A;  1SLI A;  5IK4 A;  4LOS A;  1C57 A;  1QMJ A;  1POV 0;  2ZXQ A;  4FPF A;  3KVB A;  4L8Q A;  4CU9 A;  5IUQ A;  1H6X A;  3NNF A;  5CFC A;  4DZG A;  2JE7 A;  5F3I A;  1JZ2 A;  5F9T A;  4HN1 A;  1PZ9 A;  3WG4 A;  1FPN 2;  3SIT A;  1EAH 2;  3FFQ A;  4KG8 A;  3ZYI B;  4MH0 E;  5IK8 A;  2W0X A;  3ZDV A;  2ZX2 A;  1BMV 2;  1AXY A;  3A21 A;  3H0O A;  3N9M A;  4FI9 A;  3RDI A;  1LNS A;  2WZR 2;  4Q4V 3;  5FMO L;  5JWP A;  4GJY A;  4AI1 A;  1JOJ A;  1BEV 2;  4XJ9 A;  1JUI A;  5GLZ A;  5AC9 1;  3VZJ A;  4ARY A;  2ZEZ A;  2JG9 A;  3J4U H;  4YVS C;  2W39 A;  1SDW A;  2ZGK A;  2A70 A;  1AYN 3;  3GYD A;  4XJ8 A;  3E1F 1;  1ASJ 3;  2P3I A;  2ZGU A;  2OT7 A;  5FZ6 A;  3OUJ A;  2RS1 1;  3DXU A;  4XJW A;  2GNM A;  1CES A;  1UY3 A;  3AB0 A;  4PJY A;  4X6R B;  3RRD A;  1W6O B;  5C7G A;  1JZ7 A;  2ZGR A;  5JXJ A;  1A34 A;  3P2N A;  4NRM A;  1BK0 A;  3HJR A;  5BUV A;  2R1B A;  3V0A B;  1NLR A;  2CGP A;  2WAA A;  1VLN A;  2XQX A;  4HG6 B;  2Q8D A;  3P6B A;  5C8C A;  5CIS A;  2VEC A;  5T54 A;  5HCH A;  2WFP A;  4LPL A;  4AGR A;  4C90 A;  2WQZ C;  3WUC A;  1CQ9 A;  3MUZ 1;  2JDN A;  2VOW A;  2IVI B;  2ZEW A;  3ZFF C;  3HQU A;  2Y8K A;  2HWF 1;  4MV2 A;  4QQL A;  5T5J A;  4LO8 A;  3WF4 A;  5ACA 1;  2VBP A;  3OBA A;  4DUW A;  4OHZ A;  4AWD A;  1LEN A;  3MO4 A;  4KGG A;  3WNK A;  2QZ3 A;  2JX9 A;  5FK8 A;  4BQ3 A;  2OUH A;  4JDM A;  1NQJ A;  1AL0 G;  3TN9 1;  1PGW 1;  4BM8 A;  5DG2 A;  5FZB A;  3H8U A;  3CEW A;  3DPR B;  3DYM A;  4DFS A;  2FDJ A;  2GU9 A;  2PEL A;  5IVB A;  1RXG A;  5FJK A;  4BK4 A;  4MGQ A;  4AFB A;  2PQS A;  3UJQ A;  3D5Z A;  5FK7 A;  3BOD A;  2RJK A;  5FPZ A;  1GNY A;  2JB8 A;  1UD1 A;  4IEZ A;  4XDP A;  3QED A;  5GLM A;  1TMF 1;  5FXZ A;  4N8M A;  3RS6 A;  3WP5 A;  1LU1 A;  3MV1 1;  4IGP A;  4YM2 A;  1MZF A;  1JOB A;  1W8O A;  1OD5 A;  2EXH A;  4Q4V 2;  2QTW B;  1IPJ A;  1MS8 A;  3FE5 A;  4GA9 A;  4Q27 A;  3T08 A;  1POV 3;  5KHI A;  2ERF A;  2GH8 A;  1B35 B;  3P5B A;  3S30 A;  3O0V A;  1O8P A;  4AW7 A;  2CHH A;  4AQS A;  1AYN 2;  2I45 A;  4M4R A;  4COU A;  3I59 A;  1ASJ 2;  2DBN A;  2AEZ A;  3H50 A;  4HOO A;  5IW0 A;  3GBW A;  4LKS A;  1XSQ A;  4BA6 A;  1CPN A;  4FPK A;  1UMH A;  5FZC A;  4JAA A;  3VDD A;  1KJL A;  1WCD J;  2BRT A;  4Y3O A;  4FFG A;  1CON A;  1SLB A;  2NP0 A;  4YZ1 A;  4N53 C;  3WPZ A;  3FL7 A;  1V9U 3;  1YQ6 A;  1Q8Q A;  3I2H A;  2JKB A;  1DZR A;  3OD4 A;  1AL2 3;  1OBN A;  4QB6 A;  2UWB A;  2W1Q A;  3K51 A;  4MO3 M;  5F5Q A;  4Z8B A;  1LAJ A;  4O9G A;  4S2F A;  5FY8 A;  5F5A A;  4AEK A;  5HCF A;  1Y9M A;  4YVW C;  5JXG A;  3JB8 A;  4PDW A;  4XFB A;  4MGT A;  2W46 A;  5FYT A;  1UY0 A;  4W6Y A;  1MS0 A;  4WZF A;  2D6M A;  1C28 A;  3PUI A;  4QT6 A;  3A0K A;  3ZXK A;  4XF4 A;  4AHY A;  5BY5 A;  2WNU B;  5C3S A;  4UFJ A;  3TEZ A;  1W3X A;  2ADD A;  2LAL A;  3ZFE C;  3OYW B;  4B8E A;  2PTM A;  5A33 B;  4YW2 A;  1O5U A;  5GZD A;  5C9A B;  5AC9 3;  5FO9 B;  2GME A;  3FC0 A;  1ZRD A;  4PIY A;  1H8T B;  4E4H A;  3WQB A;  4PLN A;  1O3Q A;  3GZE A;  1NZC A;  2WLP A;  2VCC A;  1XYN A;  2RS1 3;  4IEW A;  3RWK X;  2RDS A;  1URX A;  4Q0V A;  4Q0S A;  4N9H A;  3ZVX A;  3OM4 A;  4IEQ A;  2P3J A;  2XPJ A;  1Q8O A;  2IFR A;  4U6B A;  1DZQ A;  1U5I A;  4FCA A;  3NMB A;  1EUT A;  2X53 S;  3C3V A;  5BNO B;  2B8M A;  3MZH A;  3PL0 A;  3PUA A;  1JI6 A;  1H0B A;  1OLM A;  1CX4 A;  1RHI 1;  3URF A;  5K9Y A;  5LWB A;  1GYD B;  3AYE A;  3PJY A;  2HWF 3;  5ACA 3;  4XUT A;  4ZXK A;  4D7S A;  4DNY A;  4YFZ A;  4OUE A;  1CJP A;  5FLH A;  4ASL A;  5F7U A;  1N1Y A;  1V9U 2;  2IXI A;  4FP2 A;  3VBS C;  2PN5 A;  2DUP A;  5IWF A;  2BNN A;  5IAT A;  1W9W A;  2HWE 1;  4Z1V A;  4ORF A;  5FZ1 A;  1ZBA 1;  4YVS A;  3TN9 3;  1SLL A;  1Q43 A;  5EJ1 B;  3Q8B A;  5KR7 A;  1UOF A;  3CLP A;  4EE2 A;  2RS3 1;  3HR9 A;  1U12 A;  4LIU A;  4OCT A;  5LEJ A;  1UZW A;  3VD9 A;  1XNK A;  2D5H A;  4W6W A;  4GWM A;  3DUI A;  3H3Z A;  4GMP 1;  3WMZ A;  3I2G A;  4I02 A;  3GJB A;  2UY8 A;  3RI9 A;  4D6R A;  1LB2 A;  1ULG A;  3PTR B;  2W47 A;  4LK6 A;  3HOB A;  5J98 B;  3WD5 A;  1K5M B;  1QOO A;  4DO0 A;  5AC9 2;  2GZW A;  1UXX X;  2VOV A;  5FPA A;  1NXM A;  4QX3 A;  1ALY A;  1H2L A;  2O8Q A;  2VXJ A;  4D6Q A;  2WNO A;  3AFK A;  2FHR A;  4LJH A;  4LTA A;  1JN2 P;  5JOX A;  2RS1 2;  4XE9 A;  4NUB A;  2Y6J A;  2VMC A;  3ZFG C;  2WKK A;  2A73 B;  5FBZ A;  1PK6 B;  4XAC A;  1W6N B;  4NOT A;  3T4V A;  3F95 A;  3K77 A;  5A32 B;  2KR2 A;  1QDO A;  5IVJ A;  2PMW B;  3I2O A;  5D21 A;  5JI7 A;  4GMP 0;  5LK5 A;  1FXZ A;  5LA2 A;  3CDZ B;  4UFK A;  1QJY 1;  4FPJ A;  4NRO A;  4MVT A;  1HQL A;  2JDM A;  3DEC A;  1XB9 A;  2HWF 2;  4PVI A;  1HX6 A;  4DY5 A;  3J26 N;  5ACA 2;  3R4S A;  4AHX A;  1MS4 A;  4WM8 C;  1IG3 A;  3KLS A;  4QQH A;  2P1B A;  2QQM A;  4YWA A;  2Q8O A;  1LHN A;  2BV4 A;  1RUN A;  2R49 A;  2R0F A;  3TN9 2;  1F9K A;  2LUW A;  2VOK A;  3WPY A;  3NKG A;  1PGW 2;  2YPD A;  1M4W A;  4IL7 A;  4FQZ A;  5FYY A;  5LAT A;  3ZR5 A;  4CEW A;  2CU5 A;  4WM7 A;  5A70 A;  3S5A A;  3D61 A;  3LEK A;  3WV6 A;  3A22 A;  4P9W A;  4I0W B;  5G05 L;  3TEW A;  1XSR A;  2EVX A;  5HCA A;  1MR5 A;  3A23 A;  2FDH A;  3M3Q A;  4ATF A;  1UOB A;  4IV1 C;  5K0U A;  4CZS A;  3IAQ A;  4FFI A;  5F3G A;  5FY5 A;  3WCR A;  1TMF 2;  1DYK A;  1VB2 A;  1W9T A;  3FBM A;  3VBH C;  2F17 A;  3VKL A;  4BQ1 A;  4UWD A;  1ZZ9 A;  2MEV 1;  3H1Y A;  4LIT A;  5FP4 A;  2YRO A;  3USS A;  3J7M A;  5B4N A;  2E6V A;  1ND3 A;  2VUC A;  3RZG A;  4O8P A;  1OT5 A;  3MLK A;  5CB7 A;  5AYC A;  2ZGN A;  2ZCW A;  4XJU A;  1JS9 A;  3M1H A;  1QJU 1;  4CP1 A;  3HN1 A;  5DQ0 A;  1W28 A;  1RC6 A;  3GGL A;  1PZ7 A;  1V6N A;  3AL6 A;  4YVW A;  5SV8 A;  4O8O A;  3HPN A;  3RPQ A;  4N43 C;  4QPW A;  4JRA A;  4PT6 A;  1ZA7 A;  3QCW A;  3QH6 A;  4IQP A;  1Y43 B;  1OVP A;  5JZG B;  3VSS A;  3HD8 B;  4XMI A;  2DV9 A;  5I0R A;  1R1Z A;  1YI7 A;  2AAC A;  3OEB A;  5L9R A;  3JUU A;  4DRV A;  3QOP A;  5EP9 A;  1SZB A;  4UI9 L;  1BK1 A;  4H55 A;  3USU A;  1SPP B;  4RD7 A;  3AC0 A;  2VME A;  2WA4 A;  1ZBA 3;  2B46 X;  3HNM A;  2HLE A;  3U78 A;  4M3C E;  5A6X A;  5B6S A;  4WVV A;  3AKI A;  3C7G A;  3M3I A;  4MET A;  5ERL A;  5FYM A;  3I54 A;  3WQ0 A;  4Z92 B;  1PZ8 A;  2RS3 3;  1ND2 B;  1UF2 C;  5BNQ A;  4M0N A;  2VZ1 A;  2E7Q A;  1X9T A;  1JYX A;  4LA3 A;  2PAM A;  4GMP 3;  2VOT A;  1W6P B;  4UF0 A;  3OY8 B;  2ARA A;  5A7P A;  2C1F A;  1QU0 A;  5I93 A;  5FPU A;  4N4B A;  4K8F A;  4AEJ A;  3ZYF A;  3VKO A;  5A3U A;  2VAU A;  2Y0I A;  2F6B A;  3IDE A;  2X10 A;  3QAC A;  2E26 A;  3AKT A;  4AHZ A;  2WO2 A;  4LOT A;  5CBL A;  1W90 A;  4XYX A;  1UO9 A;  1S0E A;  2ZGQ A;  4JGZ C;  3ZXG A;  5CFC B;  3JU9 A;  3WW4 A;  3EMR A;  4OLL A;  1NAE A;  1SHW B;  5A6Q A;  2TNF A;  1LGN A;  3PUS A;  3UV9 A;  4NPL A;  4QKB A;  3ILR A;  1XE7 A;  1MVE A;  3CIH A;  2ZGS A;  2Y6F A;  3NV1 A;  4CUB A;  4DEQ A;  3VN4 A;  1GYK A;  1MEC 1;  1VBD 1;  1EPW A;  1EY2 A;  2ID4 A;  2DFC A;  2UU8 A;  4HFS A;  4YZ3 A;  2WSU A;  3I3D A;  3VBF C;  3WNP A;  1COV 1;  2WO1 A;  1RB8 G;  4GZ9 A;  3J7H A;  4UFI A;  5F5I A;  3WOG A;  1CJD A;  2VPV A;  3GCX A;  2YY1 A;  3L9J T;  4NRQ A;  4W65 A;  4AVB A;  3VZK A;  1QJY 3;  3CJI C;  1G6N A;  1OA2 A;  1RHI 2;  4JQR A;  2JG9 B;  4O61 A;  4CCN A;  2BNO A;  3OD0 A;  5ANQ A;  3SIS A;  2CWS A;  4QWN A;  1PVC 1;  4LIV A;  2X8F A;  1RGS A;  1YQ2 A;  3PVO A;  3THD A;  5IYY A;  4WVZ A;  2Y64 A;  3R4Z A;  1N3O A;  2RG4 A;  1N1S A;  3OB8 A;  4LBM A;  1MPX A;  4YW1 A;  2HWE 2;  2W95 A;  5EZW A;  5FYV A;  1ZBA 2;  1W06 A;  1UNB A;  3SC7 X;  5C8C B;  2Q1F A;  3ZOI A;  5A1L A;  4QHZ A;  1W9Y A;  2RR1 3;  3IDC B;  4HT1 T;  1HRI 1;  2RS3 2;  5I8T A;  4P9I A;  1XRU A;  1YYN A;  4IEU A;  4EZ4 A;  4YM3 A;  4QU1 A;  3ZFG A;  3AXE A;  4BIS A;  3LA7 A;  1O8S A;  5C4W C;  2NPI A;  4M4P A;  2J1V A;  3WZ1 A;  1W04 A;  2IXH A;  2NLR A;  2FMY A;  2IC1 A;  2VUL A;  3ZSJ A;  2OS2 A;  1IKQ A;  3OGR A;  3OM2 A;  5A7Q A;  2WNE A;  1V0A A;  2ZKL A;  3E5U A;  5FPV A;  2VL4 A;  3KSC A;  2WR9 A;  4D8M A;  5EQU A;  2X8S A;  1R64 A;  2MEV 3;  3POS A;  1QY4 A;  5T3N A;  2ADE A;  2DUO A;  3OM6 A;  1AF9 A;  5F2S A;  3ELN A;  1UYP A;  2VCB A;  5FP9 A;  3K46 A;  4GH4 A;  4WM8 A;  5EYX A;  3H1M A;  1QJU 3;  3N9P A;  1AX0 A;  3CJX A;  1ZX5 A;  2GNT A;  1I3H A;  4KBB A;  3MF9 A;  4LHN A;  4Y1V A;  1NG0 A;  2VXR A;  4NAO A;  3OPT A;  1Y7B A;  5D2A A;  3WPU A;  1H8V A;  1WLC A;  2YYO A;  3FLR A;  3S5Q A;  3WDV A;  1F4A A;  4Q4W 1;  1DQ1 A;  1QJY 2;  4FT8 A;  3CZU A;  1LEC A;  4IV1 A;  3RMX A;  3TNP B;  3HN3 A;  2YGM A;  4BB3 A;  3I3M A;  2QQW A;  2WRA A;  2PHL A;  4QX8 A;  3VBH A;  3I59 B;  2DVD A;  3AJY A;  3AKF A;  2WYF A;  4D47 A;  3CQO A;  2BZD A;  1LHV A;  2A6X A;  1W39 A;  1YUD A;  2P2K A;  1AHS A;  2WWJ A;  3NW4 A;  3D0J A;  4EWE A;  5JSR A;  4AFD A;  4GB3 1;  4EWA A;  3VDD B;  3OG2 A;  4K9S A;  5E89 A;  2PHW A;  3VGI A;  3NNL A;  1SQ4 A;  2GN7 A;  4MAD A;  4YNI A;  1YI9 A;  3RJ2 X;  1IGO A;  3GZU C;  4RR3 A;  4BME A;  2BBV A;  3K3N A;  4I2O A;  4YG3 A;  5HXV A;  5E16 A;  3U11 A;  2V09 A;  2KXL A;  4I01 A;  3B94 A;  5LZ6 A;  3AJZ A;  5A6Z A;  5JOW A;  2LS6 A;  4KWU A;  2Y33 A;  5FYZ A;  1REF A;  4PDW B;  2MEV 2;  1TVG A;  1I1E A;  1UIJ A;  3GXU A;  3IAP A;  3SH4 A;  2D44 A;  2YMZ A;  5KXB A;  2VUJ A;  4R4X A;  1X8M A;  2P4E A;  2D6K A;  2VMF A;  1MEC 3;  1QJU 2;  1UU5 A;  4XF9 A;  3AVR A;  1VBD 3;  1X9P A;  1AR9 1;  4QXC A;  1JZ8 A;  3ACI A;  4AK7 A;  1S0B A;  1XU2 A;  4IE4 A;  4L2N A;  3ZXA C;  1V6I A;  2DTY A;  1PMH X;  2VVD A;  3R4D B;  2J1U A;  3P1I A;  4CCK A;  1JHJ A;  1GMM A;  2DF7 A;  4CXX A;  2R30 A;  3E5X A;  3UKT A;  5JIA A;  4OUL A;  5KHJ A;  4O65 A;  3DKQ A;  2ZGP A;  5FIX A;  3D6E A;  1WBF A;  4KU8 A;  4L9B A;  5KHH A;  1VAM A;  4BCU A;  2PA7 A;  4JTO A;  1PVC 3;  5AY9 A;  3ZN4 A;  2J42 A;  4FXG B;  1WD3 A;  1J3Q A;  1RL3 A;  1YLL A;  4JGZ A;  4H7M A;  5DUW A;  4DIQ A;  4YGD A;  3NAP A;  1VMJ A;  3PVB B;  2OII A;  1LOE A;  2FMD A;  5L7O C;  1FPN 1;  4AAX A;  3H3L A;  1V70 A;  4K3U A;  5DUU A;  2JIC A;  5FZG A;  4CUC A;  3SKJ E;  4FBF A;  1XYO A;  5FO7 B;  4IES A;  5FLW A;  1HRI 3;  3EYP A;  3KQ4 B;  4K1Z A;  3UNP A;  4FAH A;  4KC8 A;  2GDF A;  1WD4 A;  3K4D A;  2PHU A;  3D60 A;  3W20 A;  1PM7 A;  3VBF A;  1DQ0 A;  2DDU A;  1W2A X;  2KD7 A;  2JIJ A;  4A3Z A;  2BWA A;  2ILM A;  4AQ6 A;  3TBD A;  1GQG A;  3Q8C A;  1S0D A;  2SLI A;  1RMU 1;  2GAU A;  2ZEX A;  4E2S A;  3O1M A;  1PMI A;  2A75 A;  1H1M A;  2R07 3;  3CJI A;  4FPC A;  3WNN A;  2FDF A;  4FVV A;  5FKB A;  4YVS B;  1HKD A;  3KGZ A;  5CIR A;  1SFY A;  5J1X A;  1O3R A;  4FFF A;  1DCS A;  3AMM A;  1CN1 A;  1PT2 A;  3POF A;  4XBN A;  2YV8 A;  2B39 A;  5F6L B;  5JMO A;  1AUY A;  5C3Q A;  4TWT A;  4LLF A;  1J3P A;  1NCR C;  4DUX A;  3WQ7 A;  3D5Y A;  1WCS A;  1IG0 A;  2XHN A;  3W5N A;  1MEC 2;  4NN0 A;  1WLD A;  2WJS A;  4DS0 A;  1VBD 2;  4BK5 A;  2NQY A;  1DGR N;  4JZR A;  5IAV A;  1QQP 1;  1COV 2;  3KCX A;  3O1V A;  3WAS A;  1S0C A;  1RUG 3;  1CAW A;  2JDA A;  4HET A;  4CUA A;  3NL1 A;  4Q4W 3;  3DCQ A;  5HBA A;  1DGL A;  2IXJ A;  1JYV A;  3ILF A;  4BZ4 A;  4CCE A;  1JYN A;  1LEM A;  2ORX A;  3AKG A;  4QPI A;  3BYL A;  1LRH A;  1PVC 2;  4IE0 A;  3BGA A;  3D8C A;  1W9F A;  5DAP A;  2ZS6 B;  2R0H A;  2P3Y A;  3BUC A;  4E8D A;  1WMF A;  2ZEY A;  4LO7 A;  1HIX A;  2BYV E;  4GB3 3;  5FLI A;  3ETP A;  4P9X A;  4Q29 A;  2CDP A;  3TB0 A;  3OGG A;  5DPN A;  4RQP A;  3TAY A;  3L2Y A;  2ZX4 A;  1QXR A;  5EPA A;  5FPX A;  3RJR A;  5LRS A;  5A8C A;  1CAV A;  3KV4 A;  3MW2 A;  1HRI 2;  4A41 A;  2DCK A;  1SMV A;  3LDB A;  4LKF A;  3RYK A;  1S2B A;  4FOW A;  1HLC A;  2V4V A;  3WF0 A;  3MW4 A;  2Q4S A;  2XJT A;  1XBF A;  5JVV A;  1VKD A;  4QX2 A;  5AVA A;  3KV6 A;  1U0A A;  4QB2 A;  3PLQ A;  4Y1Z A;  2H0B A;  3BB6 A;  5ABJ A;  3ZMO A;  5GLK A;  3ZYJ B;  3PUH A;  4XJZ A;  2ZAA A;  2RHP A;  5DUX A;  1LOA A;  4CEW B;  5A7S A;  4WM7 B;  1ST8 A;  2HWB 1;  3B00 A;  3N4M A;  3BIE A;  3WN1 A;  5FZ4 A;  1MQT A;  1AR9 3;  5FOB B;  3AKR A;  4EZH A;  1ULF A;  4JGY C;  3VHN A;  1FMD 1;  2Z79 A;  1VAL A;  3AMP A;  1QH6 A;  5K0U B;  3WNM A;  3ZN6 A;  5FLJ A;  4KMQ A;  4FTB A;  3AZZ A;  2P34 A;  1CPM A;  2PQQ A;  2BBA A;  1CAU A;  2BEO A;  2DBI A;  1F35 A;  3OTF A;  4JHZ A;  5IJR A;  3UGG A;  2BUK A;  3WSO A;  4D69 A;  4Z2A A;  4FP3 A;  3LSE A;  4FTE A;  1ND3 B;  4TXW A;  3WDU A;  1DF0 A;  1QH7 A;  1JBC A;  1ULC A;  1AXK A;  1VRH 1;  4PIX A;  4Q4W 2;  3D82 A;  4UXA A;  1QXP A;  2OW4 A;  3BVC A;  5KXD A;  2FDK A;  4QX7 A;  4JC1 A;  4OFG A;  2D98 A;  5EWS A;  5CZK A;  4F7Z A;  3M8L A;  1Q3E A;  1HB1 A;  4MGI E;  1DQ6 A;  4YVW B;  3OGV A;  4A4A A;  2ZX1 A;  4NRP A;  1OC1 A;  1FPN 3;  4ONU A;  4ASK A;  3WG3 A;  3N9Q A;  1VBC 1;  3RQ0 A;  4BYY A;  2VOX A;  4GB3 2;  1WMX A;  5AYE A;  2WZR 3;  2ZGT A;  1E5R A;  1UZ0 A;  1UIK A;  3LF7 A;  4DMI A;  5BNP C;  3IMM A;  3FHQ A;  1J1T A;  2HEY F;  3KWV A;  2Q30 A;  1RMU 3;  3T30 A;  3TAW A;  3IT8 A;  4NWV A;  4OUM A;  1YIP A;  3USU B;  4AK3 A;  4UW3 A;  4J6G A;  3MLL A;  5EJ3 A;  4HZF A;  3UGH A;  4UDK A;  3OEA A;  4I09 A;  3RZZ A;  2GP3 A;  2XHK A;  4XAA A;  1OMI A;  1UY1 A;  2A6V A;  3SH5 A;  5C3R A;  4CEY C;  1F5J A;  4HVQ A;  1ULE A;  1OQE A;  1FAT A;  3BIW E;  4GUL A;  4AI2 A;  1WW5 A;  4CDW C;  3ZXE A;  4UF0 B;  4A6O A;  1E5I A;  5L7O A;  1C4R A;  5DDJ 1;  1IOA A;  4JTN A;  4MG2 A;  1W8W A;  4QPG C;  5CNA A;  1AR9 2;  1VBE 1;  4QXK A;  1W99 A;  1M06 G;  2GC1 A;  4IER A;  1QQP 3;  3JB4 C;  1DQ4 A;  1X8E A;  2GMP A;  4XDO A;  3VDB A;  2HKX A;  4XQ4 A;  2I07 B;  1LTE A;  5I91 A;  4IDZ A;  4D0Q A;  1WLW A;  2JD4 A;  4MUV A;  3ACG A;  5FFO C;  3OPZ A;  2RS5 1;  2QDN A;  3AKP A;  4C8D A;  1QJX 1;  1Q8V A;  3WDX A;  1SLT A;  4V2V A;  2J7M A;  2XG3 A;  4XCA A;  3ETQ A;  4EN8 B;  4KC7 A;  1OOP C;  4LE4 A;  4L97 A;  1UY2 A;  4I3G A;  4XOG A;  4IET A;  4KG0 A;  1W6M A;  4L0P A;  3VL8 A;  1C3H A;  4PI0 A;  5FAX A;  4EYU A;  4EN9 B;  2QFE A;  2R6Q A;  1NCR A;  3P3P A;  3VB9 A;  4CDX C;  1RED A;  2B9V A;  4QM9 A;  1BYH A;  1G9A A;  2BQP A;  4NID A;  3AMH A;  2LRP A;  2W94 A;  2ORZ A;  4M3C F;  4YW4 A;  1XNC A;  2YU2 A;  3WX5 A;  1RMU 2;  4ZS2 A;  2QE3 A;  4A3X A;  4U2A A;  1D4V B;  4G4F A;  1NY7 1;  3K48 A;  5LK7 B;  3QD6 A;  4R9A A;  2VBB A;  5DXD A;  1SDD B;  1V6O A;  3K75 B;  1OPO A;  1VMF A;  5CG9 A;  1ZA4 A;  2HWB 3;  2W1W A;  3ZFG B;  5A3P A;  5JMC A;  4ZKT B;  1YNA A;  1ZRF A;  4MOA A;  4Z2W A;  1ENR A;  4NE9 A;  2W1S A;  1FMD 3;  4QKN A;  5L36 A;  1YFX A;  2ZKN A;  1OLQ A;  4NHK A;  3ZYR A;  2PHR A;  2ARC A;  1V6M A;  4F83 A;  5F37 A;  1S2E A;  4S2D A;  3BPZ A;  1QQP 2;  1LJ7 A;  2Q5T A;  2YFR A;  1VRH 3;  1QKQ A;  5FQ0 A;  4GH4 B;  4WM8 B;  2W91 A;  2BNM A;  1C1F A;  1W18 A;  2WBK A;  1UWW A;  1IZ3 A;  4QGM A;  2OXB A;  1FX5 A;  1CVN A;  1OD3 A;  1QDC A;  2OZ6 A;  1LR5 A;  5FJH A;  1O6U A;  4OI4 A;  3TNQ A;  5IVV A;  1CGP A;  4K20 A;  5M0T A;  1X7N A;  4ZXE A;  5ISL A;  5KXC A;  3NNJ A;  2DTW A;  4P00 B;  1LGC A;  1V00 A;  2DCJ A;  4XFI A;  3DYO A;  4XPV A;  4B1L A;  3D4K A;  3O1P A;  4JGY A;  5IFP A;  2XLF A;  5JCT A;  5D8A C;  2Z4F A;  1H9W A;  4IV1 B;  3MHZ A;  3AXD A;  3LGR A;  1LHO A;  2R32 A;  4XUO A;  3FWE A;  4IV3 C;  4IW3 A;  2CV6 A;  1JTZ X;  2QQV A;  2VZT A;  3B7M A;  4Q2F A;  3VBH B;  1YIF A;  3IN9 A;  5DAQ A;  3S7I A;  3H7J A;  3OUH A;  3PNA A;  4GWI A;  3S0M A;  3VUO A;  3QEF A;  4WBB A;  1K42 A;  1UZY A;  2BJS A;  2VTF A;  3AYA A;  4XTM A;  3TRS B;  2C5D A;  1H1I A;  4LO6 B;  4ONZ A;  3PUQ A;  1AVB A;  4A42 A;  1HN0 A;  1V6J A;  2IFW A;  4NR1 A;  4BWO A;  3POG A;  4ZS3 A;  3VL9 A;  2JIG A;  3ECQ A;  4RR3 B;  2HWB 2;  2VNR A;  1VBE 3;  3VBU A;  2VJX A;  1FMD 2;  2QQI A;  5FUI A;  3WT3 A;  1GV9 A;  1NE4 A;  5EHD A;  3HVD A;  3B69 A;  1WCU A;  5FZO A;  3MEP A;  5BNP A;  2DCT A;  3O1O A;  4UW5 A;  1LCL A;  3I2K A;  2PYT A;  4LOR A;  3KT1 A;  4Y5T A;  2QBX A;  3NV3 A;  1X82 A;  4RS5 A;  3ZM8 A;  2RS5 3;  2YBP A;  5LY1 A;  2D6O X;  1VRH 2;  4CSW A;  5FV3 A;  3NV4 A;  4R9B A;  3PDQ A;  2RE9 A;  2XLA A;  5CEH A;  3FZ3 A;  4D94 A;  1E57 A;  4CPB A;  1DQ5 A;  5J36 A;  3MFC A;  3H7Y A;  2ZX0 A;  4CEY A;  2YBS A;  4BXS V;  1ZZC A;  4B3N A;  4D3W A;  3ALQ A;  1Z0H A;  1Q8P A;  1ZVF A;  2F4P A;  5GZC A;  3SXW A;  3I2D A;  4BXF A;  4CCO A;  1VBC 2;  4NHL A;  1KIT A;  3FJS A;  3C7F A;  3EO6 A;  5DAV A;  1F15 A;  2R7E B;  3KM5 A;  2FZ2 A;  2VDT A;  1SCS A;  4JVA A;  1OH4 A;  5EFU A;  4KWK A;  1DZT A;  1U5X A;  3WDT A;  5HV0 A;  4JGZ B;  3O12 A;  5GLN A;  1MS9 A;  3NAP B;  4OMD A;  3H42 B;  3AX4 A;  1ZZB A;  3B5L B;  3GHN A;  3IMN A;  3SH3 A;  3LFM A;  3GNE A;  2R04 1;  3LDK A;  1S4C A;  4MXW A;  4N7U A;  4HKL A;  5FXX A;  4LT5 A;  2VCM A;  1OOP A;  2VZP A;  1WA4 A;  2XL9 A;  3VBF B;  4UAP A;  1CD3 G;  3TEX A;  4B1M A;  5FWJ A;  3VZN A;  1VPH A;  1UYX A;  2NM1 A;  2VQU A;  5DDJ 2;  1YO8 A;  3ZXF A;  1E5H A;  3CJI B;  5A7W A;  2EF6 A;  1VBE 2;  3RWN A;  5FY7 A;  2XKP A;  2IUW A;  3V56 A;  1WW4 A;  3O0W A;  3LOI A;  1PO2 1;  4YM1 A;  1SBD A;  2HEW F;  4GAL A;  5CAZ A;  4OHV A;  1YFW A;  4E4Z A;  2CWM A;  2VM9 A;  4PIZ A;  1DIW A;  1OI6 A;  4DPN A;  1MVQ A;  1UKR A;  2RS5 2;  4DIN B;  4D7T A;  4PI2 A;  1QJX 2;  3ASI A;  3HQR A;  4LUK A;  1PVX A;  1Y3T A;  2AH2 A;  4DXT A;  2WWU A;  1HN1 A;  2GN3 A;  5GLT A;  5J37 A;  3D5O A;  4YAR A;  2VH9 A;  2H6C A;  2UWC A;  1SFP A;  2W9X A;  5JPN B;  2YFZ A;  4E2G A;  4A44 A;  3PIJ A;  3RSJ A;  1CAW B;  5C4W B;  4ZPI A;  4AQ2 A;  1Q8S A;  3PU8 A;  1ODN A;  4KL1 A;  1TMF 3;  4QXB A;  4BMB A;  2XH6 A;  3SCF A;  5BNN C;  4HAN A;  4BU2 A;  3ZFF A;  4QPI B;  2OX0 A;  2PAE A;  3VD4 A;  3WVJ A;  3UJO A;  1IS5 A;  4OYU A;  5J7M A;  4V1P A;  3R67 A;  4XF1 A;  2QDR A;  1UOG A;  1AX2 A;  4NHM A;  5IVE A;  1YQ8 A;  1NY7 2;  2DFB A;  3T2T A;  4RQP B;  4RSU A;  1ZRR A;  2DUR A;  1DYP A;  4R4Z A;  1CAV B;  3PHM A;  3U14 A;  4PBP A;  2RV9 A;  4CDQ C;  1QOT A;  3R4U A;  3BYW A;  4QQO A;  5C71 A;  4LBK A;  5H9P A;  3S6P A;  1QXJ A;  4PCR A;  1TZO A;  3KV9 A;  4HMZ A;  1F4H A;  1OQ1 A;  3U1X A;  3WF2 A;  5T50 A;  5D8A A;  3ZLI A;  4HON A;  4JCK A;  4Y5Z 0;  1ACC A;  4Q1P A;  2ARE A;  3T2P A;  5ABJ B;  5DG1 A;  4IV3 A;  1DLC A;  2VQT A;  3Q8A A;  4W8J A;  2VW2 A;  4XFF A;  2RDN A;  4YLZ A;  2FCV A;  5FZF A;  1MQT B;  3HNB M;  3GAL A;  2JXA A;  5EIY B;  3T1M A;  3BTZ A;  3Q8F A;  3GZT B;  4XIK A;  5FZ9 A;  5DMY A;  3ZN6 B;  1MAC A;  4EN0 A;  4UW6 A;  4LNV A;  4O8N A;  1CAU B;  4PVA A;  2HBU A;  5KHK A;  3ABZ A;  2BFU S;  5JI9 A;  2DWR A;  1B09 A;  2HEV F;  1TQ5 A;  1ZBE 1;  1GNH A;  1CR7 A;  2GNB A;  4WZC A;  4BLI A;  2ZGL A;  4N9I A;  2YPJ A;  4E9K A;  2WS9 1;  4XVH A;  3M3C A;  3PVN A;  2DU1 A;  1A8M A;  4N53 A;  2XGX A;  2D97 A;  2I2S A;  1GWL A;  1UYZ A;  1R09 1;  2NMO A;  4AVS A;  1U5Z A;  4OI1 A;  4JDN A;  4S2H A;  2R04 3;  1OUS A;  4H14 A;  4LBO A;  5A7N A;  3DPR C;  2PHT A;  1PHM A;  2RVA A;  5FYS A;  4HL0 A;  1D7P M;  3LA3 A;  1VB4 A;  2Y38 A;  2JDH A;  2P3K A;  4OQ9 A;  3ROU A;  3ZXD A;  3BOW A;  3OGJ A;  3PU3 A;  4XHX A;  4IEP A;  1RHI 3;  4TN7 A;  4ERO A;  1SLA A;  2XJP A;  1O3T A;  1Q5O A;  3ZFE A;  4HXC A;  5JPM B;  1WCK A;  1E5S A;  1PO2 3;  2QCS B;  4PQQ A;  1JZ5 A;  4KCA A;  1RUO A;  2AR6 A;  1DFQ A;  5A1F A;  1C1L A;  2WNV C;  2BPA 2;  2HWE 3;  2VY0 A;  5A3N A;  4D7Y A;  4X8P A;  3UL2 A;  4B29 A;  1NLQ A;  5L7O B;  1WA6 X;  2YFT A;  2ZHN A;  5LA1 A;  3M4F A;  4OI0 A;  3SKV A;  3CU7 A;  1UX6 A;  2EAK A;  1EUU A;  2Y26 A;  3KHC A;  2YDE A;  1ZRE A;  2VUD A;  2YG0 A;  4HPK A;  1I5Z A;  3WDW A;  4DXZ A;  1BZW A;  1W05 A;  2E32 A;  3ZIW A;  3J9S A;  3VBR C;  4Q8L A;  3SHR A;  5FRA A;  2V72 A;  2XLG A;  4ZU5 A;  4OHY A;  3APB A;  1W6M B;  3VBS A;  1U5Y A;  3DXT A;  4Q26 A;  4PLM A;  4R52 A;  2HWD 1;  1NCR B;  2CTV A;  2R04 2;  1SFN A;  4N90 A;  4CCC A;  4N7I A;  3IM0 A;  1G86 A;  3CL1 A;  1YC6 1;  3LOB A;  5SV5 A;  1JYW A;  4F8A A;  1ENX A;  4XJA A;  1O59 A;  2ZML A;  3BTX A;  2O1Q A;  3WP4 A;  2A71 A;  2XR4 A;  1ZYB A;  1YQC A;  2BW8 A;  2IXK A;  4P9Y A;  5C9A C;  4AOC A;  1LOD A;  1H8T C;  5FZ3 A;  3DV8 A;  1CZS A;  2QVS B;  1LOB A;  4XQW A;  3VKF C;  1H2N A;  1PO2 2;  2ZMK A;  1OFN A;  1BXH A;  1GWM A;  1PNG A;  1LUL A;  2QUO A;  4URT A;  4HSL A;  4HSJ A;  4XQD A;  2W2I A;  3MIB A;  3OF1 A;  4K1Y A;  1YFU A;  4C1W A;  4LO5 B;  4L11 A;  3I3E A;  5DN2 A;  2WWS A;  3NJZ A;  4AR2 A;  3B01 A;  4MGZ E;  4W4Z A;  1TE1 B;  2VZS A;  2CL2 A;  3O1R A;  5HXM A;  3LPF A;  3MYX A;  1GZT A;  4CDQ A;  1VIW B;  1ZBE 3;  4K8R B;  3TEY A;  3CNA A;  5FQ0 B;  1K12 A;  4PBO A;  3NV2 A;  1YJK A;  3ZO0 B;  5LBE A;  2WS9 3;  1A3K A;  4XZU G;  5K4L A;  2CSG A;  3VT2 A;  4OHX A;  4XXA A;  1W2N A;  3AP4 A;  1DLL A;  1QF3 A;  1R09 3;  3K4A A;  2SBA A;  3AK0 A;  3M3O A;  2R16 A;  4ES8 A;  3ZDS A;  2D5F A;  4LXL A;  1I9R A;  4FO9 A;  5I0S A;  3RZK A;  3GZA A;  4EN6 B;  5B2G B;  4RL7 A;  1H2M A;  3N7L A;  4QMA A;  5FTT C;  2W1U A;  3EXU A;  2Q1M A;  4J1W A;  4JGY B;  2OQ6 A;  1GSL A;  1BLZ A;  4MLO A;  3N7K A;  5FXW A;  5FOJ B;  2BU9 A;  1JZ6 A;  1O7F A;  3OM7 A;  1J84 A;  2YC2 A;  3LWC A;  1KRI A;  3POW A;  5LEK A;  2BGC A;  1DGR A;  2JEN A;  1FYU A;  1K5M C;  1KFU L;  3FX3 A;  4MXV A;  1RUE 1;  1QHD A;  2XL7 A;  4NPR A;  4NIH A;  4AHW A;  3R6S A;  2DVA A;  1NLS A;  3H1W A;  1KQR A;  2ZMN A;  3I3Q A;  2RDQ A;  2J1A A;  4LBQ A;  1ZRC A;  3LSD A;  3PME A;  4ARX A;  1MZ5 A;  3AKS A;  3ENR A;  4UDJ A;  4IUG A;  5GZE A;  4PF5 A;  1UV4 A;  4M01 A;  1TME 1;  1XJA A;  4GWJ A;  1VMH A;  3S57 A;  3VBU B;  1NCQ C;  1HV1 A;  4NVP A;  2VNV A;  4K6B A;  2G1M A;  2DVB A;  1W8H A;  5GZG A;  3NRU A;  4QDQ A;  4UT5 A;  4CCM A;  5BNP B;  3N9N A;  5FZO B;  2E7T A;  4P9L A;  1KEX A;  1TEI A;  2HYX A;  2ZBJ A;  4N43 A;  3J7N A;  4B7K A;  3AP9 A;  3I8T A;  5KXE A;  2OPW A;  4GIQ A;  4RS5 B;  1ZBE 2;  1OA3 A;  5FY9 A;  2FDG A;  4DEV A;  2A5Z A;  2WS9 2;  1WL7 A;  4CEY B;  1C8M 1;  1R1A 1;  4UDG A;  2RJ2 A;  2NZ9 A;  2WNV A;  3M2M A;  1R09 2;  3MIC A;  2OPK A;  1DQ2 A;  2HWD 3;  1NYW A;  4ISQ A;  1JYT A;  5J09 A;  3RVH A;  1BBT 1;  4CU8 A;  4QX0 A;  3T09 A;  4IGQ A;  1EV1 1;  1D2S A;  1LU2 A;  1BVV A;  4JKK A;  3RFR A;  1RUH 1;  4YGE A;  3ZPO A;  5FZA A;  1COV 3;  1W6Q A;  3KCC A;  4RGG A;  4V2W A;  4BH9 A;  4AVV A;  1AR6 1;  4DOU A;  4Q0U A;  4ITC A;  2C24 A;  2ZAC A;  1OKQ A;  4BHP A;  3ZIX A;  2Y6K A;  3SMH A;  3W58 A;  1EP0 A;  5GJ6 A;  2VG9 A;  4G9S B;  1H6Y A;  2JE9 A;  1YQ5 A;  4JV4 A;  2IWG B;  4MXW B;  3ZYH A;  2RM2 1;  2GND A;  2IXC A;  2VE1 A;  4CCD A;  1OOP B;  3VBR A;  3WEZ A;  1ODM A;  2H0V A;  4NAM A;  4YPJ A;  1G9D A;  5GLQ A;  1NT0 A;  3H3U A;  1UCX A;  2ET1 A;  3KV5 A;  2VNO A;  1GUI A;  4B4P A;  1NKG A;  1J58 A;  3ME2 A;  1YRZ A;  5F5C A;  3PMS A;  1GQH A;  4AE2 A;  2QKD A;  4TTG A;  4Y33 A;  5A7W B;  1RUC 1;  4KWL A;  4A7Z A;  1WBL A;  2NYY A;  2AGS A;  4LKD A;  2FD8 A;  1JW6 A;  3ZSK A;  1RUD 1;  4CYD A;  4LHL A;  2VVF A;  2ZOE B;  1OXC A;  4FPH A;  4W6X A;  1YHF A;  4WVW A;  3T3Y A;  5I0D A;  4YGB A;  3J8F 1;  4HBN A;  3POE A;  5TSW A;  2TBV A;  4ET7 A;  3O1T A;  2GH2 A;  1TNF A;  5FZK A;  4Y22 A;  3JCI A;  3ON7 A;  4AEM A;  1T6B X;  4JKL A;  3U4S A;  5JLV A;  3QZ4 A;  2Q1Z B;  1FV2 A;  3T0D A;  2A6Z A;  1UZV A;  3B3Q E;  2HWD 2;  3ZR6 A;  3EJK A;  3S7E A;  1LHU A;  1Q56 A;  4QDR A;  2OZJ A;  4LLO A;  5A7V A;  3CHX A;  3ZFF B;  3N3H A;  3O1U A;  4HVO A;  1WME A;  4JRL A;  2WZ8 A;  5C4W A;  2VQA A;  2X29 A;  2EID A;  1O4Z A;  4YFW A;  3DN7 A;  5DAW A;  1HB2 A;  2WQ4 A;  1XNT A;  4FFH A;  1RUE 3;  3H8R A;  1GYH A;  3W59 A;  2Y34 A;  3ORJ A;  3FUO A;  5CYY A;  4B7E A;  1H1A A;  1FT9 A;  5FP7 A;  2N7G A;  4KNC A;  3EHK A;  3OCP A;  4CPB D;  3T1L A;  2RMU 1;  2ZX3 A;  3ACF A;  3M3E A;  1TME 3;  2OYZ A;  3LV4 A;  3QLQ A;  4LBL A;  1XE8 A;  4LHK A;  5CA6 A;  3OM5 A;  5DZE A;  2XJU A;  3C2U A;  2B4K A;  1VE0 A;  3DEM A;  2EAL A;  2VW1 A;  4Y24 A;  5GAL A;  4B4R A;  5FZ7 A;  4RGA A;  2XXZ A;  5D8A B;  4YRD A;  2QNK A;  2X09 A;  1LOF C;  3LQC A;  3V64 A;  4AK5 A;  4XAE A;  4YW5 A;  5CU1 A;  1IS4 A;  4IV3 B;  1JMU B;  1QOS A;  1UX7 A;  1SAC A;  5C5U A;  2DVF A;  5D1I A;  2DUQ A;  2FCU A;  1RXF A;  1H30 A;  1W3V A;  2YXS A;  1GQP A;  5A7O A;  1VBA 1;  3GCW A;  3LD8 A;  3KF3 A;  1C8M 3;  2EIC A;  5IVC A;  2BTV C;  5FBJ A;  3EQE A;  5HV4 A;  1OLM E;  3HT2 A;  3N9L A;  3SNM A;  1BBT 3;  3HQX A;  4EWD A;  4M3C A;  1S0F A;  1EV1 3;  3BYK A;  3MBW A;  1ZNP A;  3Q8E A;  1IPS A;  1RUH 3;  4XTP A;  5I8S A;  1NCQ A;  2ARB A;  1FI2 A;  4OZX A;  3T2O A;  1AR6 3;  5CKN A;  3KCY A;  2EIE A;  4X6Q B;  1YFY A;  2P37 A;  2X8T A;  4HK9 A;  2ZZQ A;  1LES A;  4N53 B;  4CDU C;  2WLQ A;  1GOH A;  2YFU A;  5J3U A;  4UDI A;  1H4H A;  1F5F A;  2AUY A;  5CAD A;  4K21 A;  1RIT A;  3W5M A;  1GWK A;  3NKT A;  3HAG A;  4RFR B;  1FOD 1;  3NJY A;  3T4H B;  4E27 A;  5AFB A;  1GFF 2;  2P6C A;  2PHD A;  1BQP A;  1HB3 A;  1RUE 2;  2JG8 C;  2RM2 3;  4KGQ A;  3C7H A;  4M0H A;  4DRR A;  1Y9G A;  1G8W A;  3KMH A;  3MV0 1;  1CIY A;  4KU7 A;  4F3J A;  5C3P A;  3U4X A;  2H6B A;  2GC0 A;  3ES1 A;  2VZR A;  1OKO A;  3JBG 1;  5FMC A;  1W2O A;  3CZJ A;  3BTY A;  1TME 2;  1IQD C;  1RUC 3;  3ACH A;  4COW A;  4LBJ A;  3VD7 A;  3ZFE B;  1X36 A;  1ZZ6 A;  3AP6 A;  5A80 A;  3JD7 1;  1DGW A;  4CE8 A;  1RUD 3;  3ZSE A;  5C8W A;  3EB7 A;  2VZO A;  3LEG A;  2ZA9 A;  3IB3 A;  1J3R A;  3J8F 3;  1Z7S 2;  4X8N A;  4YM0 A;  5IVY A;  3E6D A;  5LRR A;  3POY A;  1W0P A;  1RTV A;  2AEN A;  2D40 A;  1GZ9 A;  4MHU A;  3GM8 A;  1UOJ A;  3E97 A;  4NMI A;  2AEY A;  1GIC A;  4NII A;  1C8M 2;  1R1A 2;  3EBR A;  3MUY 1;  1OUX A;  4I3P A;  2ZGO A;  4HVR A;  3OGS A;  5DZG A;  1DGW X;  4COY A;  1BBT 2;  4HPK B;  1EV1 2;  4IE5 A;  5FUN A;  2BDR A;  1C8N A;  5FCC A;  1RUH 2;  2OVU A;  1L7Q A;  3M70 A;  1AR6 2;  3BPS A;  4N2R A;  3BTA A;  3N9O A;  1W8T A;  1AZD A;  4XHB A;  2UUR A;  3QBQ A;  4ZZ5 A;  3VBS B;  5BV6 A;  2AC1 A;  1C5H A;  1XNA A;  2JDZ A;  3P3N A;  1AJK A;  4PDW C;  2WT0 A;  3B93 A;  3LKJ A;  5A3L A;  1HXS 1;  2YC0 A;  2D3S A;  4QHB A;  3UT0 A;  1GP5 A;  2RM2 2;  2CYF A;  1UMI A;  5H9S A;  2RMU 3;  1JXN A;  1L3J A;  2CAV A;  4PF1 A;  4AED C;  4CA9 A;  3VSF A;  2OKX A;  3L2H A;  1OUR A;  2YU1 A;  4IND A;  3VZL A;  1OLR A;  4P5H A;  2BWC A;  2XB6 C;  1DBN A;  4PHZ A;  1JOD A;  1RUC 2;  2Z69 A;  5IFT A;  1UW8 A;  2ZHM A;  1AYM 1;  2JD9 A;  1RIR A;  3A0N A;  3WXP A;  1L7L A;  2HWC 2;  2UYB A;  5FR3 A;  1RUD 2;  4NIG A;  3KF5 A;  1AL2 1;  4XUR A;  2W3J A;  1F31 A;  5L9B A;  2WIN B;  3X29 B;  3OUI A;  4GQ7 A;  4FPO B;  1VBA 3;  4ZHN A;  3J8F 2;  2QQP A;  2RDR A;  5LW9 A;  5AYD A;  3ZX7 A;  5T5O A;  1XE0 A;  1NOV A;  1AX1 A;  1J83 A;  2NN8 A;  4XMA A;  3WHT A;  1J59 A;  4AI0 A;  3T0A A;  4CDQ B;  1KD7 A;  1GZW A;  4XC9 A;  4QDS A;  3FUQ A;  4GJZ A;  2CGN A;  3KVA A;  3SCH A;  4L92 A;  4KBZ A;  5CFD C;  3FLP A;  5IT6 A;  1N1V A;  4XBQ A;  1LOF A;  1AR7 1;  2BGO A;  1PO1 1;  2VTX J;  3W21 A;  3WF3 A;  1GOF A;  2OA2 A;  2VMG A;  3ZYB A;  5IK7 A;  1FOD 3;  3ZPY A;  3VKM A;  1JU4 A;  5FP3 A;  3WN0 A;  3O14 A;  2YGL A;  1UPS A;  2VZQ A;  3OBZ A;  4TLG A;  4NHY A;  1K3I A;  3B9I A;  4P9J A;  1UZZ A;  2A3Y A;  3VV1 A;  5K8S A;  2VUA A;  2JDU A;  3ATG A;  3K2O A;  3JBG 3;  1F2N A;  2RMU 2;  1VBC 3;  4LHS A;  2VC9 A;  3K3O A;  4BQW A;  1WMD A;  2VW0 A;  2VGD A;  3VZO A;  4QGN A;  3TYJ A;  4CTE A;  1W8F A;  1I6X A;  3ES4 A;  3R0R A;  1NXD 1;  3JD7 3;  4IE7 A;  4O9E A;  4AI3 A;  1JOP A;  2Y60 A;  1KJR A;  4FXK B;  2PAK A;  1WUV A;  2D7F A;  3SLI A;  4CDU A;  4COT A;  2V5Y A;  2ZHL A;  5E88 A;  4LBQ B;  4XET A;  3UET A;  3BI3 A;  4Q4Y 1;  5T5P A;  4B4Q A;  4QQ2 A;  3BN6 A;  1Y9Q A;  2YC4 A;  1VBA 2;  1HV0 A;  2JG8 A;  3IWZ A;  5DAB A;  2C0Z A;  2CY6 A;  2LW8 A;  4UW4 A;  3PTY A;  1V6K A;  2X5I C;  5A8D A;  3TOJ A;  3N7J A;  4MZU A;  5DDJ 3;  5A3T A;  5EYY A;  1HQN A;  1SBE A;  1FNY A;  2OUJ A;  4N43 B;  4P02 B;  4QD2 A;  5GLV A;  1W2T A;  3ZN5 A;  2VBD A;  2FZ1 A;  4CU6 A;  3I4I A;  3OPW A;  4RN5 A;  5FXV A;  2D3P A;  2VD7 A;  5GLR A;  1LED A;  5AFE A;  1IHM A;  1TNR A;  2BVV A;  2P17 A;  3CO2 A;  3WF1 A;  3NST A;  2RJL A;  2WNV B;  2XWB B;  1QJX 3;  3I49 A;  1N3Q A;  5E1R A;  1HXS 3;  3OBR A;  1FOD 2;  4FAG A;  4QM8 A;  1JH5 A;  5H9R A;  3MIH A;  4CEW C;  4GAZ A;  4WM7 C;  3KS7 A;  5JDB A;  3AKH A;  5HCB A;  2CGO A;  2G19 A;  1W6Q B;  2ZGM A;  4Z07 A;  2C26 A;  4CP9 A;  2R1D A;  5FKC A;  4CDW A;  4EQV A;  2KM2 A;  3VBO C;  3JBG 2;  1DP0 A;  4GWN A;  5K0U C;  3KST A;  3UGF A;  4SBV A;  4BQY A;  1XYP A;  3AZY A;  2V73 A;  4H2A A;  4QPG A;  1STM A;  2Y0O A;  3OOX A;  4RHV 1;  1AYM 3;  4QX1 A;  4AYU A;  2LM3 A;  2Y6G A;  3HNY M;  4DB5 A;  3JD7 2;  5FYC A;  3WNL A;  1ND3 C;  4BIF A;  1NX9 A;  4HKO A;  4DXS A;  1JZ3 A;  3VBR B;  1G9F A;  1JU3 A;  2FCT A;  1VBB 1;  2GC2 A;  5LBC A;  1LKN A;  1LOC A;  1OQD A;  4E4D X;  3WUD A;  2IZW A;  3CKH A;  4AGG A;  3U37 A;  4TYS A;  4K40 A;  3LPG A;  4QU2 A;  5FZ0 A;  4YZ2 A;  5LB6 A;  2VR4 A;  5FUP A;  5T5L A;  2E31 A;  1N1T A;  3B02 A;  1IKP A;  4I30 A;  3I97 A;  3HMY A;  3LIH A;  4DUV A;  3WCS A;  5DAX A;  4S2G A;  1IPK A;  1UXZ A;  4AED A;  5GKA C;  3WY6 A;  4AZZ A;  2MPF A;  4BQ4 A;  3I2I A;  5FZE A;  4CDX A;  2W87 A;  1AR7 3;  3AZX A;  3WG2 A;  1PO1 3;  4OI2 A;  3RGB A;  4XDQ A;  4BQ5 A;  1O4Y A;  4CUG A;  2JDP A;  3PUR A;  1W8U A;  4IEV A;  2DU0 A;  2XKO A;  4MHR A;  4Y22 B;  1D2Q A;  3MLJ A;  4LMF A;  1OVS A;  2J1E A;  5E8A A;  3AZV A;  4LBQ D;  1JYI A;  3IDA A;  3LEI A;  2VZU A;  3A7Q A;  1YEW A;  5GLO A;  3HWJ A;  4KI5 M;  5FMB A;  1UU4 A;  1HXS 2;  4J1X A;  4SLI A;  1H4G A;  2P5B A;  3E5Q A;  3POB A;  1WWY A;  5L9V A;  2BP6 A;  3WHU A;  5A7V B;  4IGO A;  1RYY A;  4XEZ A;  3HEI A;  3H9A A;  5LBF A;  4Q8K A;  1RUF 1;  1W0O A;  5J48 A;  5HPO A;  2ES3 A;  3JXS A;  3HBZ A;  3V65 A;  5CFD A;  1X50 A;  3G7D A;  1AYM 2;  1NA1 C;  1KXG A;  3MFA A;  5I0T A;  2WC2 A;  1VAK A;  1RVF 1;  3MIE A;  4Q4Y 3;  5FY0 A;  1AL2 2;  4CXY A;  2QQN A;  2D6N A;  3QC2 A;  1WKY A;  2JB4 A;  1PIV 1;  5JXH A;  3AYD A;  5JOY A;  1S1A A;  2JDK A;  5GLP A;  3C7O A;  4TLF A;  5L73 A;  5DZF A;  3THP A;  1QIQ A;  4ATE A;  3THC A;  2Z2S B;  2A3X A;  5FYU A;  5LA9 A;  2ENR A;  2EIB A;  3AP5 A;  4ZU4 A;  3U10 A;  2VMD A;  1DDL A;  1QEX A;  1YXW A;  1Y4W A;  5T52 A;  2XVL A;  3AMN A;  2B45 X;  4NJ4 A;  4Q0P A;  3VHP A;  4AI8 A;  2WII B;  3UKN A;  1ULD A;  3UES A;  5JSP A;  5J96 B;  3BKZ A;  3WAT A;  4P08 A;  5FMD A;  3WP6 A;  2HJI A;  3RZH A;  3KT7 A;  1S0G A;  2GC3 A;  2JWP A;  2WZE A;  4MSV A;  1AR7 2;  1MS1 A;  1OSG A;  1PMJ X;  1PO1 2;  5FP8 A;  4BJ0 A;  2E63 A;  2JEM A;  2B42 B;  3CBN A;  5FPB A;  1NUK A;  2XON A;  4AQT A;  3LZZ A;  4P14 A;  1KS5 A;  1XPW A;  4RYD A;  5IAX A;  2WN3 A;  4M3C B;  4IEX A;  1OPM A;  2YFS A;  1VRB A;  3JQX A;  1KGY A;  1NCQ B;  4ZZ8 A;  1CZV A;  4LR4 A;  5BYN A;  2X5I A;  1KS4 A;  2VZ3 A;  4LUL A;  5LBB A;  3IPV A;  2B5H A;  5FZ8 A;  1H2K A;  1JYC A;  3F2Z A;  4AVA A;  4LBN A;  4WV8 A;  4QQS A;  4UBG A;  3LCP A;  3C7E A;  4RHV 3;  4BOW A;  2G9Z A;  4WVM A;  3POI A;  5E6H A;  3RNS A;  3D0S A;  4FPY A;  1UMZ A;  5LA0 A;  2EXI A;  4RGK A;  4GH4 C;  4Y5S A;  4K7J A;  1V6L A;  4BPZ A;  1VBB 3;  4YSF A;  1A8D A;  2QQL A;  4MX3 A;  5A3M A;  2GP5 A;  2WUH A;  2ZAB A;  3FMG A;  4KQ7 A;  4LO4 B;  4Q4Y 2;  1IQA A;  1JUH A;  3IBM A;  5KHG A;  1LHW A;  2Z42 A;  5FYB A;  2P6H A;  2RR1 1;  2ZAH A;  4FPE A;  4ZON A;  2TUN A;  3MPB A;  4IEY A;  5LCW L;  3O5S A;  2WA3 A;  3VSR A;  1OFS A;  1YCI A;  3KZ4 C;  4IXL A;  5BXX A;  3VBO A;  4XUN A;  3LB9 A;  1Z78 A;  3AM2 A;  5CVR A;  3UYJ A;  1DYO A;  1K5J A;  2CAU A;  2DCZ A;  4MGY E;  3VT1 A;  5I8Y A;  4UYB A;  5B4X A;  3GDB A;  3V0B A;  4H3W A;  3LIG A;  4Q4X 1;  3RZJ A;  4LUM A;  3ST7 A;  1B35 C;  4OQ8 A;  3WPV A;  3BU0 A;  4Y20 A;  5AVP A;  4MGK E;  4UOJ A;  2CDO A;  4KH9 A;  1BVP 1;  4UFM A;  4XF0 A;  4UFH A;  2A6W A;  2GSY A;  3AKQ A;  5JIU A;  4XFH A;  1O5L A;  2B7Y A;  1QGL A;  2A6Y A;  1AR8 1;  1P8J A;  2V5D A;  4RR3 C;  4AG4 A;  3Q9O A;  3H8X A;  5FPL A;  4EV0 A;  4LEJ A;  2E53 A;  2YUE A;  4FSJ A;  4KWJ A;  2B4W A;  1RUF 3;  4NIA A;  5JSO A;  3KGL A;  4QKD A;  1CWP A;  3RYP A;  2W92 A;  4C91 A;  5C2M A;  3KD4 A;  2HH9 A;  1RUI 1;  2VZV A;  3N36 A;  5F6K A;  5FRE A;  3WLU A;  3WNX A;  4CP2 A;  1XXN A;  2WSV A;  4RHV 2;  4BQ2 A;  3U0Z A;  5A6Y A;  1XQN A;  1RVF 3;  1WW7 A;  4LKE A;  3IKW A;  2VTX A;  1PIV 3;  3NJV A;  1VBB 2;  1X33 A;  5F8P A;  5F3E A;  1CAX A;  2Q0A A;  2A7A A;  1A6C A;  4JDO A;  4YGC A;  3UK9 A;  2VU9 A;  2VQ0 A;  1XOY A;  2WQ8 A;  5CKQ A;  2XJV A;  3WIN E;  2IVJ A;  2PLV 1;  2WNU C;  4Y4R A;  1W9S A;  1CIW A;  2C4X A;  3FN9 A;  3U07 A;  3ZSL A;  2BFU L;  1D4M 1;  4MLG A;  4A2U A;  4NHX A;  4TZD A;  5ANN A;  1YJL A;  2R06 1;  4YG0 A;  2G9G A;  5F3C A;  1REE A;  4OVE A;  5BNN A;  4QB1 A;  2K46 A;  3SQO A;  2WAB A;  3NAP C;  1NA1 A;  4QX5 A;  5FZM A;  2IXL A;  2XML A;  3R4Y A;  2XJQ A;  3WP3 A;  1JHN A;  2C9K A;  2WDB A;  3AFG A;  4UBH A;  1UQX A;  1XU1 A;  4GKY A;  1HB4 A;  1GZW B;  3IDB B;  1GNZ A;  2WFF 1;  3G6J B;  4YZ4 A;  2VO5 A;  1EYB A;  1O91 A;  3PVE A;  2O14 A;  5BNO C;  3KT4 A;  5LAS A;  1GP4 A;  1GKB A;  3WDY A;  3RI8 A;  2BVB A;  1DHK B;  3LDR A;  3NJX A;  1H9P A;  1R08 1;  3BYJ A;  4UDK E;  1NZI A;  2VMI A;  2XUE A;  1RUF 2;  3III A;  3CF6 E;  2DYC A;  2XJS A;  3OJB A;  2D3R A;  3PIG A;  5IVF A;  4XW3 A;  5JOZ A;  3I2F A;  5FZI A;  1ZM1 A;  1GAN A;  2E9Q A;  4CVU A;  2QZ2 A;  4AK6 A;  2EAA A;  1RVF 2;  5FDB A;  1CZT A;  2AYH A;  4AXO A;  3WMY A;  1QJZ A;  1HRV 1;  1GP6 A;  1PIV 2;  1SLC A;  2AZ5 A;  2JKX A;  1UU6 A;  1HDK A;  3LE0 A;  1PGL 1;  2XDV A;  1W6O A;  3ZXL A;  5C70 A;  2WL1 A;  2WO7 A;  3MDP A;  1UL9 A;  2UYA A;  4JKM A;  1US2 A;  3KB5 A;  2XUM A;  3JZV A;  1GBG A;  4G3Y C;  2K2S A;  4NO4 A;  3FFZ A;  3V0A A;  5FYI A;  2XVG A;  2QQJ A;  1PM4 A;  4JQT A;  4XUP A;  4YW6 A;  1WLT A;  3VDA A;  4CDU B;  2WN2 A;  5C6C A;  3BYN A;  2R07 1;  2Y6H A;  2VCA A;  1G9B A;  2QQU A;  4E4S A;  4QPI C;  1XND A;  1GLH A;  5GLW A;  1IS6 A;  4Q4X 3;  3SEP A;  1ZZ8 A;  2W52 A;  4KCB A;  3MW3 A;  4Y4Y A;  2YBK A;  2JG8 B;  4DY3 A;  3CMG A;  3VD3 A;  4ASM B;  3ILN A;  1NQD A;  4HKW A;  5F32 A;  3ZXJ A;  4U36 A;  4XBL A;  5FZD A;  3WQ1 A;  1GYE B;  4RQP C;  2G9F A;  4AI9 A;  5BPX A;  2C9A A;  2HBT A;  4JHT A;  2K9Z A;  2JE8 A;  3OSD A;  4N1I A;  1AR8 3;  3MPP G;  3POJ A;  2CNA A;  2J1T A;  3ACL A;  3DPR A;  4FOY A;  1PK6 C;  4QPY A;  2WO3 A;  4BE3 A;  3WAU A;  2XJR A;  1S0J A;  3K4Z A;  2G4I A;  3KQR A;  1RUG 1;  1BKZ A;  1S55 A;  4M00 A;  3VD5 A;  3SEE A;  1IS3 A;  1RUI 3;  3I7D A;  2Y6L A;  1MS5 A;  3MID A;  1Z7S 1;  4GKX A;  4HN0 A;  4IE6 A;  4MYE A;  2JJ6 A;  4EN7 B;  5ABJ C;  4FOQ A;  4XF3 A;  1HJF A;  5KC5 A;  3QH7 A;  4A6S A;  1US3 A;  1B35 A;  4C1X A;  4LQR A;  1MQT C;  5CKM A;  4CP9 B;  4AFM A;  3MIG A;  1ULP A;  4CDW B;  2OQ7 A;  2EIG A;  5JR2 A;  5FWE A;  2O8O A;  1OH3 A;  1GOG A;  2PLV 3;  2X8K A;  2RR1 2;  4FPG A;  4QPG B;  3VHR A;  4DQA A;  5F39 A;  4C0B A;  3I3B A;  3E6C C;  3BAL A;  4AGV A;  4COZ A;  4CU7 A;  1LOG A;  1SEF A;  1W0N A;  1UN1 A;  1D4M 3;  4CP0 A;  4AL9 A;  4OHW A;  5IK5 A;  2R06 3;  4GXL A;  4QKF A;  2LTN A;  2UWA A;  2XBO 1;  3GF6 A;  3JQW A;  1G9C A;  3E6B A;  3J7L A;  4XXP A;  3ZKU A;  3LFI A;  2C6S A;  3TWI A;  3ZYG A;  4XFG A;  4E8C A;  1MS3 A;  4Q4X 2;  5FYH A;  2W08 A;  4OZO A;  1SBF A;  3ZSM A;  3VZM A;  3QEE A;  1T6G C;  3ZYP A;  4AED B;  2ZHK A;  3FHI B;  4LK7 A;  1F8V A;  2WFF 3;  4A7K A;  1RUJ 1;  1PX4 A;  2E7A A;  3VHO A;  1A78 A;  3LEM A;  4CDX B;  2TEP A;  1AR8 2;  3AZW A;  4LA2 A;  4CRQ A;  4YZ5 A;  5KBF A;  1O3S A;  5C0P A;  1R08 3;  2WNU A;  3BU7 A;  1UKG A;  5A3O A;  2HWC 1;  5JZG C;  3I2J A;  4CCJ A;  4QQP A;  3OYW A;  2YZ4 A;  1AXZ A;  4N2Z A;  1GU3 A;  5C33 A;  3DGT A;  5A33 A;  4XZP A;  5L19 A;  4FQ4 A;  1RJ7 A;  1RUI 2;  2ET7 A;  3ZKY A;  5C9A A;  2HYK A;  5HI0 A;  2E33 A;  1H8T A;  1RJ8 A;  2FQP A;  4W50 A;  2Q8E A;  4URA A;  2WT1 A;  2FBE A;  3H8O A;  1DG6 A;  1J1L A;  4ZU7 A;  1QNW A;  3WR0 A;  3UKV A;  1APN A;  1EAH 1;  1HRV 3;  4R8H A;  5H9Q A;  3WG1 A;  4BQX A;  1OHF A;  1ND2 C;  4QAW A;  5GLU A;  3N35 A;  4QXH A;  1BMV 1;  3RYR A;  3WW2 A;  4XFA A;  1K45 A;  3T2Q A;  1WCQ A;  2WZR 1;  3GBG A;  3IZO A;  2QJV A;  3IIA A;  5FY1 A;  5EXO A;  2XQR A;  2D6P A;  1BEV 1;  2WYS A;  2PXJ A;  4Q1R A;  2PLV 2;  1UYY A;  5I0U A;  5BNO A;  1XNB A;  5CFD B;  4I0B A;  5F1R A;  3AMQ A;  2LRO A;  5EV7 A;  3N7M A;  2BOJ A;  3MI8 A;  5T55 A;  4RA0 A;  3RG0 A;  1D4M 2;  2VMH A;  2W5F A;  3DYP A;  4XIO A;  4Z82 A;  1UPI A;  1QJF A;  2R06 2;  1ENQ A;  1ZRI A;  4LE3 A;  4BDV B;  2ETE A;  3INA A;  3KHB A;  2J1S A;  2WT2 A;  4QHO A;  5CFC C;  1D0H A;  2PHX A;  4TSV A;  1BJQ A;  5APA A;  4NOV A;  1HW5 A;  2KA3 A;  3NO8 A;  4AAP A;  3D3A A;  4BLJ A;  2V4A A;  2B9U A;  3CU9 A;  3MGU A;  4UFL A;  1PGS A;  4YYO A;  1DU3 D;  2D6L X;  3VDC A;  2WFF 2;  3FBY A;  2WAO A;  1VR3 A;  1RIN A;  1W2U A;  4YW3 A;  1GR3 A;  5JAX A;  2A3W A;  1O4T A;  1R08 2;  1Z7S 3;  2JG9 C;  2BOI A;  3HT1 A;  1C5I A;  1W8N A;  3NWK A;  4MGS A;  3T0B A;  2DVG A;  2XWJ B;  1TL2 A;  3O7O A;  1VP6 A;  4AFA A;  4XIL A;  1QNY A;  5JUV A;  1T2X A;  2WZP P;  1D0G A;  1K5M A;  3WW1 A;  2ZJC A;  4NWW A;  3O0X A;  3WW3 A;  4L99 A;  3RZM A;  1ENS A;  1R1A 3;  3LAG A;  3C8X A;  2GAL A;  5LY2 A;  2GMM A;  4PLO A;  2X5I B;  5DUV A;  5C3O A;  5C8C C;  3B9C A;  1PNF A;  4NPM A;  3IPV B;  4Y1Y A;  2D93 A;  1HRV 2;  1QWR A;  1JZ4 A;  1TG7 A;  3VKN A;  3ITQ A;  4E2Q A;  5JR7 B;  1PGL 2;  4I0A A;  4BIO A;  2JEC A;  4WVM B;  1PK6 A;  3NNM A;  1W6N A;  2MNG A;  2W68 A;  4P9G A;  4Q4V 1;  2NMN A;  3SCG A;  3W9A A;  4OMC A;  4C0H A;  1SG3 A;  5A32 A;  5C5T A;  1MZE A;  3RZL A;  5GLL A;  4DXR A;  2D43 A;  5FY4 A;  1ONA A;  3AP7 A;  1QJE A;  3VT0 A;  2F4L A;  5G04 L;  2R07 2;  2XBO 3;  3WNO A;  3BOP A;  2ZPX A;  3MF6 A;  3ZMN A;  1AYN 1;  1ASJ 1;  3FLT A;  1POQ A;  1UY4 A;  1XC6 A;  1W03 A;  2XVK A;  3BCW A;  4XAB A;  4AFC A;  4A7Y A;  4H7L A;  1UAI A;  2BER A;  4XUQ A;  4R9C A;  2X05 A;  2EA7 A;  2YB7 A;  1VJ2 A;  4ISR A;  1RUJ 3;  3R05 A;  5EJZ B;  4Q5O A;  3VBO B;  2QQK A;  5JXI A;  3THT A;  2ARX A;  2A1X A;  1LGB A;  4FOV A;  3GJA A;  4Q0Q A;  4ES9 A;  1N47 A;  5IHR A;  5KC6 A;  4FTS A;  5FMO S;  3V0B B;  2HWC 3;  4Y1U A;  4AF9 A;  1N3P A;  1RUG 2;  4CXW A;  1FAY A;  3DL3 A;  5K7P A;  4AVC A;  3MIF A;  1YWK A;  2EXJ A;  4Y20 B;  5A1A A;  1WZX A;  4XCB A;  3AL5 A;  4P5Y A;  1EPZ A;  1OYG A;  4GD4 A;  1SCR A;  1BCX A;  4YG6 A;  3VSZ A;  2JDY A;  2FDI A;  5FZL A;  4EJR A;  3M7A A;  1EAH 3;  4KMI A;  1KDM A;  3GBF A;  3OBT A;  3VBU C;  4U6D A;  4O7X A;  3VDD C;  1GZC A;  2ZZJ A;  3NVC A;  3A4U A;  1FNZ A;  4FPL A;  4OUS A;  2K0G A;  2O0O A;  5F2W A;  1BEV 3;  3AVS A;  4IEO A;  4ZY9 A;  2DCY A;  4R9D A;  1S0I A;  1ZZ7 A;  3RMY A;  1NE6 A;  2L9L A;  3DKW A;  1WGP A;  4AVT A;  5A3W A;  4RS5 C;  2BGP A;  1I5P A;  5JZG A;  2ATF A;  2UY9 A;  4D6S A;  1L7R A;  1VAV A;  2XOM A;  1OF3 A;  4COV A;  1POV 1;  3NNG A;  5FO8 B;  5KWR A;  1W8Z A;  4Y26 A;  3U75 A;  1OA4 A;  1ULO A;  1WW6 A;  4YW7 A;  1AJO A;  1OF4 A;  2MHF A;  4Y1X A;  4JX0 A;  1CAX B;  4PQ9 A;  5FZH A;  2XBO 2;  4J25 A;  4A45 A;  2PHF A;  2QQO A;  1MZ6 A;  2EXK A;  5CG8 A;  1SPP A;  3AYC A;  3HIF A;  1KDK A;  2E51 A;  4HLT A;  5B6T A;  1PX3 A;  1CX1 A;  3LA2 A;  3GHM A;  2ZTN A;  1HQW A;  3DF0 A;  2VNG A;  1S2K A;  2Z5W A;  3HBK A;  5GZF A;  3O1S A;  1HJG A;  3K1U A;  1ND2 A;  3NQH A;  2I74 A; 
#chains in the Genus database with same CATH homology
 3H3L A;  5AYE A;  3WPV A;  3WPZ A;  3BYK A;  3ZXJ A;  1GYE B;  5FLW A;  3LF7 A;  2QQV A;  3IMM A;  3OSD A;  3SC7 X;  3D60 A;  4KC8 A;  4UFM A;  1YIF A;  4UFH A;  4QHZ A;  2X8T A;  3QEF A;  3R67 A;  4N1I A;  3WAU A;  3WN2 A;  4CCC A;  3TAW A;  3WPY A;  4UDI A;  5GLO A;  3UGH A;  1Y9M A;  5FMB A;  3ZR5 A;  4UDK A;  3WN0 A;  4ONZ A;  2B4W A;  3U14 A;  5FKB A;  3OM2 A;  5A7V B;  3ZXK A;  3C7H A;  1Y9G A;  4FFF A;  4UFJ A;  2ADD A;  2X8S A;  4FFI A;  1PT2 A;  3U1X A;  4CCD A;  2ADE A;  3OM6 A;  5GLQ A;  5FMC A;  1UYP A;  4O8P A;  3D5Y A;  1YRZ A;  5AYC A;  3D61 A;  3QC2 A;  4COT A;  3WAS A;  5JOY A;  1Y7B A;  5GLL A;  5GLP A;  3WPU A;  3RWK X;  3C7O A;  3OM4 A;  4O8O A;  3VT0 A;  3S5Q A;  4U6B A;  4KC7 A;  4CCE A;  3NMB A;  4O8N A;  4PVA A;  3AKG A;  3P2N A;  3BYL A;  2AEY A;  4MLG A;  1Y4W A;  3VSS A;  5A8D A;  1YI7 A;  5ANN A;  2QQW A;  3LFI A;  1GYD B;  3VT2 A;  3WAT A;  3AKF A;  3C7F A;  5FMD A;  1W2T A;  4D47 A;  3QZ4 A;  2VDT A;  4PVI A;  3QEE A;  3R4Y A;  5GLR A;  5B6S A;  5A8C A;  3ZR6 A;  3AKI A;  3C7G A;  5GLN A;  3LEM A;  5FK8 A;  4N2R A;  5A7V A;  5C0P A;  2YFS A;  3LDK A;  2EXJ A;  3OM7 A;  1VKD A;  4N2Z A;  2AC1 A;  3LDR A;  3BYJ A;  4FFH A;  3AKH A;  4N4B A;  4UDK E;  1GYH A;  1OYG A;  3WMZ A;  3VSZ A;  4B1M A;  5JOW A;  5FKC A;  5GLK A;  3PIG A;  4EQV A;  4HXC A;  4QQS A;  3C7E A;  4KMI A;  3KST A;  3VSF A;  3D5Z A;  3UGF A;  5JOZ A;  4UDG A;  4KCA A;  5FK7 A;  1ST8 A;  3WN1 A;  4U6D A;  3LV4 A;  2EXI A;  4UDJ A;  3QED A;  5GLM A;  4AK6 A;  3OM5 A;  1UV4 A;  3C2U A;  3WMY A;  4AK7 A;  2EXH A;  3UGG A;  2YFR A;  2XQR A;  2YFT A;  4AK5 A;  3ZXL A;  3KF5 A;  5JOX A;  1W18 A;  3U75 A;  2OXB A;  4UFI A;  5AYD A;  4JQT A;  5FIX A;  3BYN A;  2AEZ A;  3LIH A;  3VSR A;  2EXK A;  3PIJ A;  2QQU A;  3KF3 A;  5AY9 A;  4UFK A;  5B6T A;  4AZZ A;  3VT1 A;  4KCB A;  4NOV A;  3HBK A;  1WL7 A;  2X8F A;  4B1L A;  3NQH A;  3K1U A;  3CU9 A;  4FFG A;  3LIG A;  4UFL A;  3R4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...