2AEYA

Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with 2,5 dideoxy-2,5-immino-d-mannitol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
537
structure length
537
Chain Sequence
QIEQPYRTGYHFQPPSNWMNDPNGPMLYQGVYHFFYQYNPYAATFGDVIIWGHAVSYDLVNWIHLDPAIYPTQEADSKSCWSGSATILPGNIPAMLYTGSDSKSRQVQDLAWPKNLSDPFLREWVKHPKNPLITPPEGVKDDCFRDPSTAWLGPDGVWRIVVGGDRDNNGMAFLYQSTDFVNWKRYDQPLSSADATGTWECPDFYPVPLNSTNGLDTSVYGGSVRHVMKAGFEGHDWYTIGTYSPDRENFLPQNGLSLTGSTLDLRYDYGQFYASKSFFDDAKNRRVLWAWVPETDSQADDIEKGWAGLQSFPRALWIDRNGKQLIQWPVEEIEELRQNQVNLQNKNLKPGSVLEIHGIAASQADVTISFKLEGLKEAEVLDTTLVDPQALCNERGASSRGALGPFGLLAMASKDLKEQSAIFFRVFQNQLGRYSVLMCSDLSRSTVRSNIDTTSYGAFVDIDPRSEEISLRNLIDHSIIESFGAGGKTCITSRIYPKFVNNEEAHLFVFNNGTQNVKISEMSAWSMKNAKFVVDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the fine architecture of the active site of chicory fructan 1-exohydrolase: 1-kestose as substrate vs sucrose as inhibitor.
pubmed doi rcsb
source organism Cichorium intybus
molecule tags Hydrolase
molecule keywords fructan 1-exohydrolase IIa
total genus 128
structure length 537
sequence length 537
ec nomenclature ec 3.2.1.153: Fructan beta-(2,1)-fructosidase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 2aeyA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2aeyA01
3VSRA 3VSZA 3R4ZA 3VSFA 3TAWA 3PIJA 5FMBA 5GLOA 3C7FA 1Y4WA 3WMZA 2XQRA 3S5QA 3AKGA 5FIXA 2ADEA 3WMYA 2EXJA 5GLNA 3QC2A 5FMCA 4KCBA 4D47A 4FFHA 3P2NA 4U6BA 3LDRA 4AK7A 5FKBA 2ADDA 2YFTA 4CCEA 4UDGA 5A8DA 3AKHA 3LV4A 3LIGA 3C7GA 2X8SA 3BYNA 4O8PA 3KF5A 3WN1A 3WPVA 1UYPA 1W18A 4FFFA 1GYEB 3D60A 4PVIA 2X8FA 5JOZA 3ZR6A 3NQHA 3WASA 1W2TA 1WL7A 3WN2A 3OM5A 5GLPA 4FFGA 5A7VB 4UFJA 3VT1A 2QQUA 3LIHA 3UGGA 5GLLA 2AEZA 4B1MA 3LFIA 3VSSA 2EXHA 4KC8A 4KCAA 5AYDA 3WATA 3U14A 3OM4A 4HXCA 2EXKA 3AKFA 3LF7A 3WAUA 5FKCA 3IMMA 4COTA 4UFIA 1VKDA 2YFRA 4O8NA 1YIFA 3KSTA 4UDKA 1YI7A 3ZR5A 5AYEA 1YRZA 5FK7A 3ZXKA 2B4WA 4ONZA 1GYDB 5GLKA 4AZZA 3D5ZA 1UV4A 3K1UA 5JOYA 5B6SA 3AKIA 5A7VA 4O8OA 4UDIA 3QEDA 3LDKA 5ANNA 4QQSA 4UDKE 3NMBA 2VDTA 5FLWA 2YFSA 3OM2A 3D61A 3OSDA 4UDJA 4KC7A 3RWKX 4PVAA 5FMDA 3ZXLA 4FFIA 5GLQA 5JOWA 4CCCA 4U6DA 5GLMA 3QEFA 4B1LA 3BYJA 1PT2A 5B6TA 4EQVA 3UGHA 4MLGA 3WPZA 3C2UA 5GLRA 3UGFA 4UFMA 3R67A 3QZ4A 5AYCA 4N2RA 2AEYA 2OXBA 3VT0A 1OYGA 2QQWA 3LEMA 4AK5A 3CU9A 1Y9GA 2QQVA 3WPYA 3R4YA 4UFKA 4CCDA 3C7OA 5FK8A 3KF3A 1GYHA 3C7HA 3WPUA 3HBKA 4N2ZA 4NOVA 3WN0A 3ZXJA 4UFHA 1Y9MA 4AK6A 2EXIA 3VT2A 3PIGA 2AC1A 4N4BA 3OM6A 4JQTA 3BYLA 3QEEA 4KMIA 5A8CA 1ST8A 3OM7A 5AY9A 3H3LA 4UFLA 5JOXA 3U75A 2X8TA 3D5YA 3C7EA 3SC7X 5C0PA 3U1XA 4N1IA 1Y7BA 4QHZA 3BYKA
chains in the Genus database with same CATH superfamily
4UOJA 2ZX0A 4JGYC 2YHJA 3WDUA 5SV8A 3TAWA 4OVEA 3IDCB 3MV01 2HJIA 3CDZB 1AHSA 3AXDA 4LULA 3K4DA 5E1RA 5IK7A 2FDGA 3WMZA 1PO12 2E6VA 2X10A 3MGUA 1PGL1 2PTMA 1BLZA 2WUHA 5F3GA 3VBUA 1OLQA 2MNGA 2Y34A 1G6NA 1OVPA 5DAQA 5FPZA 2OUJA 4YM0A 5FBJA 3TRSB 1OLME 4CYDA 2GC3A 2C0ZA 4YW1A 4MX3A 3MLKA 3SKVA 5A7WB 2Q8OA 1JOBA 4XQDA 4Q1PA 3SLIA 1W6OB 3ZMOA 1ALYA 3N7JA 1H1AA 5DDJ1 4LBJA 1WCUA 2R30A 4YVSB 5EPAA 1W8ZA 3MICA 3IKWA 1UY2A 5L19A 4JRLA 2PQQA 5GLWA 5F3IA 3V0BB 1VBB3 1W18A 4Q1RA 1V6IA 2EIEA 5JOZA 1VRH2 1QQP1 1VBA2 5J98B 4CTEA 1WL7A 3FWEA 3VHRA 1XE8A 4FPLA 2FZ2A 4CU7A 5FREA 1OH4A 4N7UA 1MQTC 3VBHA 1WGPA 5C8WA 5FMOS 1W2OA 2AEZA 1OUSA 2HEWF 5FYUA 1W9TA 3NAPB 4HN0A 1O5UA 4N43C 2EXKA 5IVFA 3TEZA 3WAUA 4K40A 4DFSA 4LKFA 4MOAA 1W28A 3T0DA 2JWPA 1VAVA 2FCVA 1FAYA 1US2A 3HD8B 4DQAA 5J96B 5LY1A 1QJX2 3KSTA 4UW3A 4QPGA 2X29A 2BERA 2YYOA 1UV4A 1MVQA 2C5DA 2RS53 4BXFA 2J1RA 4XCBA 3RZKA 2VZUA 1HN0A 5A7VA 3MEPA 4XJAA 2D6PA 4XVHA 2NMNA 1SPPA 3KM5A 2E33A 1QXJA 2OA2A 4RGGA 2ZEZA 3LDKA 5JIUA 1O5LA 3CHXA 1RXGA 1PVC2 2UYAA 1BMV1 3ME2A 5GLUA 3TOJA 3N3HA 4YRDA 2ZEWA 3ILNA 4DXTA 1JZ7A 2JJ6A 3MIDA 3VN4A 1PVXA 2P4EA 4CEWA 2HWB3 1XRUA 2WFF2 2OW4A 2WT0A 3N36A 1IPSA 5FYCA 4LEJA 3VBOA 2X53S 4LBQB 2VGDA 5DUVA 2QDRA 1YQ6A 2FBEA 4K20A 1WW4A 2AZ5A 2DCYA 3JB8A 2WN3A 1QJEA 2WR9A 1C8M1 3I2GA 1LHNA 3NKTA 3WQ1A 3WQ7A 4A45A 2W92A 5FY0A 2W87A 5A7PA 4ET7A 1OPMA 3WG1A 3KF3A 3Q8EA 3BTXA 4R4ZA 5A33B 2XVLA 1XPWA 3CL1A 3FLPA 3WT3A 5LATA 1IKQA 3ZXEA 2R072 4AHXA 4QM9A 4QM8A 1K12A 5JXIA 1KXGA 1YC61 2J1VA 3M3OA 3ITQA 3L9JT 4OHXA 5A3LA 5AY9A 1T6GC 2WNVC 3SC7X 1FI2A 3K2OA 2JDHA 4HSJA 4YM2A 3GM8A 3HJRA 2B7YA 5FZEA 3VB9A 1A6CA 5FZFA 4AE2A 5TSWA 3VHOA 4RGKA 2KXLA 1FOD3 2ZXQA 1RUJ1 1ZBA3 3VZMA 3VSFA 3CKHA 1ACCA 3P3PA 4BPZA 2WQ4A 4IE6A 4QGNA 1ONAA 2WZR2 3WHTA 1V9U2 4COZA 1YLLA 2C4XA 3CMGA 4YZ4A 4HLTA 1W8UA 1COV2 4KCBA 2YB7A 3IZOA 1W6QA 1DU3D 1GZWB 2WC2A 5GZDA 1PHMA 1JXNA 2E63A 4RS5C 1O3RA 3GDBA 1H8VA 2XJVA 4IEXA 4A3ZA 2QQNA 1DZRA 1QH6A 2PXJA 2RR12 2X09A 3H1YA 5LBBA 4MUVA 5FR3A 2ZMNA 4QQ2A 4D6SA 3RI8A 4N53A 1I5PA 2ET1A 3POWA 1VALA 1QNWA 4FOQA 2D97A 4GWNA 3WP3A 4CCKA 4ZPIA 1F2NA 2PELA 3RSJA 4ARXA 1QQP3 3H8XA 3ACFA 4GWJA 5FXVA 4FOVA 3WD5A 1ZZ6A 1AYN2 3VBFC 2B45X 2VZPA 2JDUA 4Q0UA 1W8TA 1CVNA 3VBUB 1ULCA 4Q4V3 3D8CA 1HRI3 5JXJA 3B7MA 4AFDA 1H8TA 2F4LA 3DL3A 3RZZA 1QJY2 1S0DA 5CFCC 1V6NA 1OFSA 3M1HA 3AKRA 2XJRA 3PU3A 4AFMA 4C91A 3LF7A 3B3QE 4M3CF 1W06A 3RS6A 3V0AA 4BIFA 2D98A 1LHWA 4XQWA 2D6MA 5FXXA 3S30A 1ZZ7A 3ACLA 3ZR5A 3AP9A 2JD9A 1RGSA 4W6XA 4KH9A 3MIGA 2WBKA 4JKKA 2J7MA 2ORXA 2W1QA 3IDBB 1GSLA 3CIHA 4UDIA 2VG9A 2BOIA 2PHWA 3WZ1A 1OA3A 1MS4A 1VMFA 3ASIA 3HN3A 1W39A 4N43B 4PT6A 4XJWA 5L73A 4R9CA 3ZLIA 3P5BA 4AHZA 3POGA 3I2HA 2LROA 4J6GA 2Q1FA 4N53C 2HYXA 4FFIA 1JYCA 1MQTB 2XMLA 5JOWA 3H8RA 1FATA 5HCHA 2IZWA 4H2AA 1W99A 1YQ5A 2WT1A 3FC0A 4Y5TA 4B1LA 1ASJ1 5E8AA 4EQVA 2KA3A 3C8XA 5IT6A 1BZWA 1OF3A 1LODA 4XIOA 3ZM8A 3RRDA 2AEYA 3PJYA 1CIYA 4BHPA 3MF6A 2QCSB 1JU4A 3KQ4B 1MS0A 3GALA 4QWNA 4OHYA 4DY3A 1EYBA 2A75A 5CZKA 1JYWA 1CGPA 5FK8A 4Y26A 1DCSA 2JECA 5DPNA 5FUNA 3M8LA 1SDWA 4MHRA 1WZXA 3P3NA 5DUWA 1EPZA 1B35A 2IXHA 1AX2A 1NUKA 1MS1A 1RYYA 1PZ8A 2JD4A 4XCAA 3IDEA 1H6YA 1ZZ9A 4EN6B 2R16A 4XUTA 5A3UA 2PHLA 1OA4A 4BZ4A 4DS0A 3TEWA 2Z69A 4FI9A 3RZGA 5HCFA 2RM22 3KCCA 3N9MA 1ZNPA 2JXAA 4LBMA 2BZDA 3IPVA 1RUH2 1QY4A 1VBD2 2RMU1 2YV8A 2J1TA 2RMU3 3I7DA 3K3NA 3HNBM 3LPFA 4OHZA 3A4UA 4CCJA 5KBFA 2DCKA 1BVP1 2BU9A 2ZGQA 2ZGUA 3L2HA 4KWJA 1A78A 2D7FA 1YCIA 2K46A 3DECA 2VZOA 3SKJE 1TMF1 2A3YA 4OZOA 4NIHA 1LEDA 5KXBA 4AEDB 2VQAA 5JSRA 4FFHA 3P2NA 2YDEA 2ZHMA 3SISA 5IVJA 4AK7A 1DLLA 3ELNA 4YZ5A 1CONA 2XBO3 4QPWA 3FX3A 2RS31 1FMD2 3POSA 2WA4A 4DIQA 1R082 4QU1A 4AHWA 4XFBA 1WKYA 1GYEB 3VD9A 5F6LB 2JB8A 2DUQA 2GDFA 2VZTA 4M00A 2O8QA 3OUIA 3FLRA 2BWAA 5EHDA 4AVCA 4CDWC 4Q8KA 1FOD2 3N9LA 4KBBA 1UIKA 1Y43B 2OQ7A 4FPOB 5FO9B 3O0XA 5LA2A 3LIHA 1OQ1A 3UGGA 1QDOA 2CGPA 4L11A 2JE9A 3GBWA 2VCMA 4HOOA 4RD7A 1BMV2 5H9PA 3BGAA 4X6QB 3V64A 1UOGA 1DGLA 3ZXGA 4BQ3A 2IXLA 4W65A 2DURA 2R1DA 5BYNA 1HQNA 2XHKA 1DIWA 2XH6A 3TWIA 4O7XA 4Q4V1 5JZGC 5FY7A 1XNBA 5C71A 2B9UA 3WCRA 4EZ4A 5KXEA 1GU3A 2JENA 4YFWA 4XF3A 1PMJX 3CJIC 2VBPA 4OI4A 2ZHKA 2GAUA 1CN1A 4XMIA 3ZFEC 1POV1 2JDNA 2ZPXA 3PURA 1JYIA 3R0RA 1ENXA 4LE4A 3POYA 5FYTA 4ATEA 1UOJA 5M0TA 1G7YA 1HKDA 4P9IA 4QQLA 4RR3A 4YGDA 3D61A 3ZFFA 4UDJA 3HOBA 2VTFA 2QZ3A 1GKBA 3J9SA 4XF0A 4Y22A 4EN0A 5EQUA 4CXYA 4AEJA 1NOVA 2CNAA 4COYA 2PHRA 3ZSKA 3NV4A 2GMPA 4R9DA 3AKSA 4JTNA 2YROA 3LEIA 3WF0A 1KDKA 3GJBA 2HWC2 5L36A 4EN7B 3C2UA 4RS5A 2HWD3 2J22A 2IVIB 5IFPA 1JZ5A 1QF3A 3VBSA 2WNUB 1X82A 3ETQA 5FPAA 1GNZA 3AMQA 3HN1A 3CU9A 4CEWC 2K2SA 3R4YA 1DYPA 1PX4A 3FE5A 5T54A 3VZNA 4XAAA 5GLVA 4DXSA 3BALA 3O1RA 4N2ZA 4EN9B 2QQMA 3ZXJA 1DDLA 4OHVA 2ZX4A 3H42B 2WLQA 1IZ3A 1PGW2 4Y1XA 4B29A 3T30A 4WVVA 2JE8A 4QXBA 5A7WA 1L7RA 4Q26A 4UFLA 5KHJA 3I59A 4IGPA 4LOTA 1PO23 4JGZB 4EYUA 1W2NA 1SACA 1ODMA 4G4FA 4LLFA 4KG8A 5EJ3A 1SLIA 1Z7S1 5EYXA 2GMEA 3HR9A 4F7ZA 5A6QA 2DU1A 1TNRA 3PIJA 2ZX2A 1QXPA 4MGIE 3U10A 3LA7A 1W6PB 3ENRA 5FPBA 1GFF2 2R063 1O8PA 4XAEA 4E27A 3UJOA 2DWRA 1TNFA 4IDZA 4XOGA 3RPQA 3PDQA 1H6XA 5KHGA 3KCYA 2Y33A 4GH4A 1J58A 1GUIA 1TME2 2YFTA 5IHRA 2E53A 3N9PA 5A8DA 1CX4A 1WLCA 1QHDA 2RDRA 1W2UA 2KD7A 3LIGA 4GQ7A 4GULA 4QPYA 1GANA 4URTA 1P8JA 3U11A 2HEVF 2YU1A 1OSGA 4BQ1A 3ZX7A 4ITCA 2OKXA 3FBYA 5FQ0A 3HVDA 5IAXA 2RE9A 1DYKA 1H1IA 4K3UA 1QJZA 5A7VB 1C8NA 1SPPB 3SH4A 1GR3A 5GM0A 3KSCA 4BQYA 1HV1A 4P9LA 1UY1A 1EUUA 1L7QA 3AFGA 2GNBA 3WG3A 5GLLA 4HKOA 2GC0A 4XMAA 1PK6A 3DCQA 3DYPA 2YUEA 1LTEA 4FPGA 1UU5A 1YXWA 3JZVA 2R073 5JI7A 3VV1A 4EN8B 5L7OA 4AI0A 4DMIA 3AKFA 1F15A 2RHPA 1NZCA 4KQ7A 1OBNA 1DQ6A 4ZXKA 3LD8A 4Q4W1 4AHYA 5FY9A 5JR2A 2NP0A 4GWMA 3T2TA 3ZOIA 1ASJ2 1MPXA 2R1BA 2CU5A 3ACHA 1XYNA 1YI7A 3H7JA 3PVNA 4M01A 3USUB 2VM9A 4E8DA 4UDKA 4Y4RA 4LQRA 3GNEA 1W8WA 5C4WC 1AJOA 4HK9A 4IGQA 1I5ZA 3PUAA 3SEPA 3IMNA 3TN92 1R092 5C4WB 4Y1UA 5A33A 2W91A 3PHMA 5BNPA 3B01A 4EJRA 2ARCA 5CFCB 5C70A 4AQTA 4NIDA 4KC7A 1UY4A 2ID4A 2QZ2A 3K51A 4K1YA 5FJKA 4A44A 1TQ5A 3DPRC 4LHNA 4YVWA 2XG3A 3QEFA 1VMJA 5B6TA 3POIA 3THPA 1IGOA 3BN6A 1M06G 2LM3A 3UL2A 1WA4A 3H8OA 3R67A 1VBB1 5IVVA 4KL1A 1N1YA 4HBNA 2P3IA 1VBE3 2PHTA 3GZUC 4UAPA 3T0AA 1KJLA 2HYKA 1UIJA 2D5HA 2VQ0A 3TNPB 5AFEA 2CWSA 2Y8KA 1QJX3 4AWDA 3UESA 2EIBA 3BODA 4GZ9A 1OQDA 2IXCA 2VTXJ 1NQJA 2PYTA 2RR13 1NXMA 3WN0A 1GZWA 1PO22 2WL1A 4LMFA 4NPRA 1RXFA 4UFHA 3ZYJB 3ZFFB 5FP8A 1PIV2 2WS91 3DKQA 3U4SA 1CZTA 4DO0A 3GZEA 3OM6A 1NAEA 3NV3A 1ZA4A 5CADA 2D6KA 2EICA 3I2KA 3S5AA 1FNZA 1LNSA 5L7OC 2LTNA 2VUDA 2GMMA 4OULA 3WX5A 4L2NA 4K6BA 5GLZA 5CG8A 2R042 4FPHA 4DPNA 1ND2B 5HI0A 1VBC3 3ZIXA 1PO13 4AVSA 1W6NB 5FZ6A 5FYVA 1QWRA 4YZ1A 3OGGA 3C7FA 4HN1A 5F5QA 1IQAA 1O6UA 5F2SA 3ZVXA 5GLTA 3S5QA 4CXXA 1IG3A 2OPKA 5FIXA 3JD71 2XQXA 4DNYA 1OOPC 1RIRA 1V9U1 2Y6FA 3M3IA 2DTWA 4A2UA 1A34A 3W9AA 3X29B 5L9VA 1PGL2 3ETPA 1V6OA 1W6MA 4CCOA 1J1LA 2XLAA 1V70A 4U6BA 4QKBA 1OOPB 1VP6A 1MR5A 1JS9A 1LENA 3AVSA 3FHQA 1TMF3 3H0OA 2Y60A 4META 1SCSA 4M3CB 4XF9A 1NCQC 1WMDA 3KF5A 5F6KA 4P9XA 3LEKA 2DDUA 3WPVA 4RR3C 3I3MA 3MI8A 3Q9OA 3USSA 3OF1A 4NMIA 4AQ6A 4COWA 3A22A 2X8FA 1U5XA 4YG3A 1REDA 3BOWA 5DQ0A 4GWIA 5LWBA 2VE1A 3FLTA 2PHXA 3LFMA 3LSEA 4XBLA 3GF6A 5D1IA 3H3ZA 2QQUA 5HV0A 2ORZA 1J3QA 1VB4A 1KFUL 3CBNA 4FAHA 2HWB2 3OBAA 2R043 5FAXA 3H3UA 2X5IB 4XQ4A 4TZDA 1ZZ8A 2Y6LA 3VSSA 1AJKA 3NWKA 4S2HA 4YW5A 5CG9A 1J3PA 3PVBB 5FOJB 4CU6A 1MQTA 4HETA 4P5HA 5T50A 2TBVA 3LGRA 3UJQA 4E2QA 1QGLA 4PIXA 5CISA 1G9BA 2MEV2 5FMOL 5J37A 3O1OA 3VBFA 2QUOA 2Y0IA 3N35A 5JVVA 4GKYA 2B4WA 4TLGA 2NPIA 3O1SA 3WG4A 1QQP2 2Y38A 4TXWA 1GYDB 4MH0E 2GN7A 3ZO0B 2O1QA 1NX9A 3ZYIB 5T5OA 3LAGA 2VU9A 2UY9A 1UPIA 2YBKA 3KT4A 3QEDA 3ZXFA 5F5AA 3WUCA 4UDKE 2E32A 5H9QA 1JW6A 5A6XA 4QX0A 3D0JA 4BH9A 4NOTA 5FPXA 4LBKA 3FHAA 5A7QA 5JZGB 3RWKX 4C1XA 3KV6A 4XZPA 4XDQA 4HPKA 3EJKA 1COV1 5IW0A 3T09A 1QOSA 2CTVA 1W03A 2PA7A 3HPNA 5EJ1B 4FXKB 3THTA 1E5RA 1AR61 5G05L 1RVF1 2VUCA 3BPSA 4LLOA 1JBCA 4RQPB 4CP0A 2B46X 1V6KA 5FJHA 5FZ1A 3OEAA 1DZQA 3BTAA 1UO9A 4MXWB 1WW7A 2R0HA 4EZHA 3AJYA 3JUUA 2W08A 5FPUA 5C3OA 5FXWA 3Q8CA 5A7NA 2ZGNA 4C0HA 4CDWB 4CCMA 3KQRA 4FBFA 1VE0A 4BA6A 5A32A 1W9FA 2IC1A 2XJPA 4CU9A 4D7TA 2K0GA 2W3JA 4LHLA 3NJYA 1R1A2 3OYWA 2EXIA 4FXGB 1UZ0A 4GKXA 5A1AA 1VBC1 3E5XA 3T2PA 5FP9A 4XFFA 4ZONA 5JOXA 3WNKA 2CV6A 4A3XA 3JBG1 3QOPA 2X8TA 5IVEA 1BYHA 2P1BA 4Y3OA 3I3DA 4IE0A 3MPPG 3OCPA 5FBZA 5FXZA 4DOUA 1CAXA 1UNBA 2XJTA 2ZBJA 4WBBA 1WMXA 5F5IA 4A41A 3A21A 3GJAA 2SBAA 3EYPA 4NIGA 1F4AA 3VBRB 1DZTA 1ULOA 3LPGA 2O8OA 2W9XA 4DEQA 3JBG3 2R7EB 1ZZCA 2GNTA 3BPZA 3ES1A 1TL2A 2VZVA 4FQZA 1YEWA 4XF4A 5DZFA 4TSVA 1OPOA 3R4DB 4Y1VA 4HANA 1XU2A 5ACA3 3BUCA 1XOYA 4IV1C 1D2QA 2JG9B 4QB6A 1XYPA 3D3AA 5BY5A 2DYCA 3QBQA 4QX5A 4IESA 1LOCA 3B9IA 3VD4A 3I2JA 1AR82 1CAWA 4FQ4A 2PLV3 2Q1MA 4XFIA 5FPVA 5CKMA 3O1TA 1S0IA 1AYN3 2JE7A 2VL4A 4XJ8A 5GZCA 1UYPA 2RS52 3AYDA 1UWWA 1J59A 2XHNA 1RUG2 4A7KA 3WN2A 4NHYA 2PQSA 3VBOC 1IHMA 4FFGA 2OPWA 5FO7B 2OX0A 1ZYBA 2D93A 3AFKA 2VMCA 4NO4A 1MZFA 1R083 5A80A 1FT9A 2WO3A 1NKGA 3GYDA 1LESA 1PK6C 4RHV1 3TBDA 5IVBA 4QDSA 2QTWB 4Y1ZA 4NRPA 4XFGA 4Y5Z0 4COTA 2WNUC 1YIFA 2Y6GA 4I0BA 4Q4V2 4E2SA 5DN2A 5AYEA 4JV4A 3ZXKA 3V0BA 4MGSA 3RI9A 3W59A 3NJZA 1BBT1 1K45A 2H0VA 1MS9A 5DUUA 5H9SA 4GMP1 5G04L 1NCRA 4BQXA 3AKQA 3O14A 3I3BA 4G9SB 4OQ9A 3JU9A 3RYKA 1AR71 2IFRA 3TYJA 3OSDA 1HX6A 4PQ9A 1XYOA 5J36A 3VHPA 4JDOA 3ZXLA 5HXMA 4DUWA 1IPKA 5T5JA 4BQ4A 5GLMA 3T4VA 4HT1T 4YVWC 4NVPA 3FL7A 4FPEA 3VL8A 4LHKA 1EPWA 2BP6A 4OLLA 3ZFEA 4FOYA 3S7IA 5GZFA 1CR7A 2LUWA 3JB4C 4JZRA 5LRRA 1FMD1 4QXHA 3VDDA 5F5CA 4EE2A 4DXZA 2D43A 5A6ZA 4ZU5A 4XXPA 1EAH1 2WYSA 3LA3A 1N3QA 4PDWB 2QKDA 1UF2C 1HXS2 2YMZA 3LOBA 3VZOA 5CEHA 1YO8A 2RDNA 2YY1A 4R9AA 4LO7A 5F9TA 1A8DA 4DEVA 3PTRB 2RJKA 1ODNA 4IV3C 4ONUA 4H14A 3DXTA 1XC6A 2W0XA 1MS5A 2GNDA 2BTVC 3OM7A 4WM7C 3H3LA 3N9QA 4M0HA 3ZXDA 5DZGA 2JKXA 3OJBA 4IEUA 1WMEA 3VBOB 4Q4W2 1TEIA 2CAVA 5LK5A 2FCTA 4BQ5A 2RM21 5ANQA 5DMYA 1YFUA 1URXA 2FMYA 4K21A 3KT7A 3RYPA 5FMBA 4I3GA 3DEMA 1RUC2 3ZYBA 4YW4A 3KVAA 1HIXA 1AX0A 4QMAA 4Q5OA 4RN5A 4Q4X1 2P5BA 2ZGKA 1KS4A 2HWE3 3QC2A 2P6HA 4CXWA 5IATA 1AR83 2VMIA 4QDQA 4UBHA 2XVGA 4OMCA 2ADDA 5FZIA 2ERFA 2F4PA 5L7OB 2NYYA 1YFYA 3K3OA 2QQLA 3W5MA 1AR91 1JOJA 3HEIA 2W52A 3J7MA 4OHWA 3VBRC 4M4PA 3I97A 4W6YA 1Q5OA 1RUC3 5DDJ3 2UWBA 4CDXC 2PHUA 5FY5A 1OMIA 1GP5A 4FFFA 1SEFA 4LXLA 5LBFA 1OHFA 2CY6A 1ZRIA 4K9SA 1YFWA 1W2TA 3PTYA 5FZLA 4A4AA 5I0RA 1RUG1 2A1XA 2B39A 4ZS2A 2PLV2 3PNAA 4QT6A 5AC92 2A6XA 5FZ9A 1O4TA 1VB2A 2HWE1 1GLHA 2CDOA 4O61A 4XILA 3ZKYA 1W6QB 2GP5A 1SDDB 1X33A 3OD0A 1C57A 1X36A 5LB6A 2J1SA 3WXPA 5A1LA 4KCAA 2GH8A 4KWUA 2WAAA 4IEVA 3WY6A 1QH7A 2A70A 1WCSA 2I45A 1W3VA 1WMFA 5HV4A 1SLBA 1V00A 3ECQA 5FZOB 3LB9A 3WR0A 4JRAA 3J7HA 1C1FA 3OUJA 4N7IA 1CIWA 2JDMA 2WWUA 5F8PA 3K1UA 4WM8C 5KC6A 3KVBA 4DZGA 5JPNB 3AKIA 4JCKA 1RUE1 1MEC3 2CHHA 3K75B 3UKNA 1PMHX 2W39A 5FZ8A 2VAUA 2JG8A 3BVCA 4QX2A 3OB8A 3I2IA 4JHZA 4Q4Y1 2A6ZA 1AL22 2FZ1A 3ZSJA 5FV3A 1EAH3 4AGVA 5GLQA 4P00B 2QQIA 1TME3 4CCCA 4Y20A 3GBFA 4WVWA 5FP3A 1QXRA 2ZGTA 2HWC1 4ISQA 2DV9A 2E9QA 4S2DA 2YPJA 4D6RA 4EROA 5I0TA 2H6CA 3UGFA 2ZGPA 1JZ4A 4N2RA 1NZIA 1E5IA 1RJ7A 3RGBA 4HMZA 2V5DA 3MO4A 4XHXA 1LGNA 4MG2A 2C26A 1R091 1HW5A 3AP7A 2BNMA 4LO8A 1DHKB 3AZXA 1XBFA 2HWF1 2HBTA 3B00A 3ZFGC 1ZREA 1FNYA 5F39A 1W6MB 4V1PA 3ACIA 5CIRA 1X9PA 3WW3A 3FZ3A 2C9AA 3K4ZA 1YQ8A 2VMHA 3M3QA 2XKPA 3QACA 4IEWA 4PF1A 3J26N 2VH9A 3VBUC 4LA2A 2VZSA 4HVQA 4YZ3A 2VBBA 3U75A 5IK5A 2VZ1A 3C7EA 3K77A 1W6OA 3CZUA 2PN5A 1SZBA 4WV8A 4YVSA 4LA3A 3WF3A 3ZPYA 2D3PA 4BQWA 4I02A 1LJ7A 5CA6A 1WCQA 1UCXA 2VXJA 3JBG2 3VSZA 3HBZA 4NIAA 1R1ZA 2ZX1A 1NCQB 3ZYRA 2FDIA 1VBA1 5DAPA 4CSWA 3I3QA 4OYUA 2UURA 3RNSA 4AVAA 2XQRA 3AKGA 4NHMA 4JTOA 1F5JA 3AYAA 3JCIA 2OVUA 4K1ZA 3WDXA 2X5IA 1J84A 3CNAA 4LBLA 3VZJA 3FJSA 4FVVA 4C1WA 1JYVA 5EYYA 1D4M1 2CDPA 4OZXA 2WNOA 4XJZA 1DGWX 1W9WA 4AI1A 4UDGA 2DTYA 2E7TA 1O3QA 1YJLA 1K5JA 2IXKA 2SLIA 4IW3A 4LKDA 2Q8EA 2XPJA 1N47A 1NCRC 3C7GA 3TN93 1FV3A 4AW7A 3PVOA 1TE1B 1WBFA 1NLRA 2YBPA 2ZGLA 4RSUA 1LHVA 3V65A 3VHNA 5H9RA 3T3YA 2H6BA 4YGEA 1AYM2 1DQ5A 2C9KA 5I8YA 3AC0A 3OOXA 5GLPA 3O0VA 5HCBA 3BU0A 2PFWA 1W8FA 1OURA 1UOBA 4ASKA 4Z2AA 1TMF2 4AI2A 5BV6A 2VNVA 3DGTA 1ZRFA 5FZ3A 4S2FA 3QH7A 4B3NA 1YQCA 2WT2A 2H0BA 1QKQA 5LCWL 5AYDA 2RS11 1HJFA 5FZ0A 1SBFA 1RUOA 2V72A 2W47A 4I30A 4ZY9A 3AKTA 3GXUA 1YNAA 3HT1A 2OYZA 1UL9A 4CCLA 4IEZA 4LBQA 2MEV1 4YFZA 4IV3A 3WNNA 1YRZA 3ZSMA 4COUA 1WBLA 4BLIA 2YFZA 4CDUB 3KWVA 2GNMA 5JOYA 1F4HA 2HKXA 4NN0A 5EZWA 4L0PA 4MGYE 3T2QA 1QOOA 2YGLA 1RUD2 2RJLA 4QPIB 5FOBB 5A32B 3AMMA 2WRAA 3NNGA 4GAZA 5ANNA 4E9KA 5ISLA 4FAGA 1Q43A 1DQ2A 2MEV3 1DLCA 3PUSA 3EO6A 2BNOA 1LU2A 1GWMA 5C9AC 1JYXA 4BK5A 2WSVA 3OUHA 2G9FA 4GALA 4AI9A 1PM4A 2X5IC 4LOSA 5ABJC 5BNPC 4E2GA 2HWE2 2Q1ZB 2FDHA 4YG0A 4DRRA 4Z2WA 3BB6A 3A0NA 3IT8A 1IS4A 2WDBA 3GHMA 3HAGA 3MYXA 4FPYA 5BNNA 1W8NA 3UGHA 1GICA 1HRI2 4OUMA 5DXDA 4YW7A 1H4HA 5JLVA 4DRVA 2EAKA 4HVOA 2JX9A 4M4RA 1CAXB 3M7AA 5BNOA 3PMSA 4XUOA 1RMU1 3VDAA 4I3PA 3LEMA 4PIZA 2ATFA 4LKSA 4RA0A 5FWEA 4GJZA 1JYNA 5GZEA 2UWAA 3FN9A 2P17A 1GYHA 2XR4A 3DF0A 1UOFA 2ZKNA 3HBKA 4CRQA 1CPNA 5JSOA 4XZUG 4ORFA 4XW3A 1RB8G 2BDRA 3PLQA 3SMHA 2UY8A 1NA1B 1JOPA 5FZAA 4GB31 2L9LA 4NRQA 4NJ4A 2A6VA 1DQ0A 3U4XA 4J1XA 3PMEA 3IDAA 1RUI3 3N9OA 2Q8CA 5C3QA 2W5FA 4WVMA 5JUVA 4X8NA 3PUHA 1VBA3 1KITA 1PGW1 4LBQD 3POFA 5AC91 4BWOA 1RUF1 4C90A 4CP1A 5ABJA 3LWCA 3MUZ1 1XNCA 3H8UA 5LA0A 5I91A 2KR2A 3KHBA 1WUVA 1ND3A 2D44A 4D8MA 2A7AA 3OGJA 3SXWA 3AKHA 3V56A 1C4RA 2Y6KA 4MZUA 3W21A 5A3MA 5AVPA 1YHFA 1VKDA 4JHTA 4FO9A 3AKPA 4DUXA 4RFRB 4B4RA 3ZR6A 4CVUA 1NCQA 3H50A 3J8F3 4LO5B 2VMDA 2BGCA 3VD7A 1S0FA 4UFJA 1ZRRA 3WCSA 2UYBA 3T2OA 4QX7A 3ZIWA 3B9CA 2QQPA 1XU1A 1BEV1 3B69A 1HV0A 1T2XA 2AACA 2YPDA 3N9NA 3R05A 4MGQA 2VMFA 2XLFA 4B4PA 3QD6A 4IEPA 4NWWA 3WF4A 4DB5A 4SLIA 4CU8A 1KFXL 4BCUA 2A6YA 1TME1 5C7GA 3MLJA 1QMJA 1MS8A 1HRV2 2WLPA 5JI9A 2XJSA 1H2KA 4BM8A 1X50A 3D82A 1LU1A 4NAMA 2YFRA 4IE5A 4AFBA 5FWJA 3NNMA 5I0DA 2ZAAA 1XE0A 2UWCA 3B94A 5FK7A 1RHI2 4CP2A 3O0WA 5DG1A 3VDDB 4XYXA 3EB7A 4BXSV 4INDA 2YC4A 1WW6A 2CGOA 3C3VA 4WM8A 4YW6A 2VVEA 4IQPA 4PDWA 3KGLA 4D0QA 1AZDA 1X7NA 1W0PA 4XUQA 3DXUA 5FP7A 4D7SA 2RR11 5B2GB 1HDKA 2QQOA 3POEA 5IUQA 3F95A 2YC0A 1B35B 4LHSA 4LIUA 4CDQA 1U0AA 2OUHA 1LOEA 3AL5A 3LSDA 4MGTA 1I3HA 3J7NA 2VBDA 1PIV1 1HB1A 1XXNA 3AMPA 4Q8LA 3BYJA 4ATFA 3RVHA 1JODA 1S0GA 2YZ4A 3M3CA 1YYNA 3HQUA 5L9BA 1PGSA 3WPZA 4LE3A 4O9EA 3W5NA 3ZN6A 1D0GA 1T6BX 4A7YA 1OUXA 1RITA 2VUAA 3ABZA 5J48A 5A3PA 3T0BA 1GOFA 4XUNA 4CDUA 3PUIA 2J42A 4CDXB 4EWDA 5BPXA 1Y9GA 1POV3 1H2LA 3MW3A 2V5YA 1BEV2 3WPUA 4RFT0 5DABA 4AEDA 3FMGA 2XLGA 2BFUL 4AK6A 5K0UC 5K7PA 2AENA 4AQ2A 3BYLA 4RYDA 4BK4A 4WM7A 4R4XA 3MBWA 4UT5A 1CAVA 2BYVE 2VXRA 2BRTA 3U1XA 5LRSA 3E1F1 5C0PA 5KHKA 3SHRA 1RINA 3WDVA 2WNEA 4JQRA 1ENSA 4ES9A 3WQBA 2IUWA 2WZ8A 4YW2A 4FTSA 1SHWB 5LBEA 1AYM3 1GOGA 1XJAA 1IPJA 2PAEA 4XE9A 2FDKA 2Z5WA 1UYXA 3CO2A 1GYKA 4FPFA 1FPN2 4QXKA 1HB2A 5FTTC 4KMQA 1TG7A 2YC2A 3HNMA 5FZ4A 2VW0A 4IV1B 3VL9A 2ET7A 1UXZA 3ZMNA 2FHRA 1BQPA 1PMIA 2D6OX 1WD4A 3MIFA 4TLFA 2DF7A 4X6RB 1ND2C 3WW2A 1LGBA 1OLRA 1ENQA 1EV13 1FMD3 1GWLA 1G9FA 1UZYA 1K3IA 2OS2A 3GZTB 3ZN5A 4PLNA 3O1UA 1CAUA 4Y5SA 2RS33 5A7SA 2X8KA 1JMUB 1BEV3 5FY4A 3IAPA 3D5OA 1TZOA 2P37A 3IAQA 2VECA 3QCWA 2VJXA 4V2VA 3S7EA 1E5SA 1JU3A 4PHZA 4YM3A 4PVIA 4MHUA 4QKNA 3J8F1 4HK8A 1EP0A 3UETA 2VMEA 2ZTNA 1VLNA 3EXUA 3NO8A 4OMDA 4E4DX 4B7KA 1CWPA 1UMIA 1OI6A 3CJIA 1C1LA 3MFAA 3M3EA 1LOFC 2RG4A 4LT5A 2JIJA 4GA9A 1BHGA 2WWSA 2G9ZA 5C5UA 5FZCA 3OEBA 2EXHA 2WAOA 1MACA 2WO2A 1GP4A 3KGZA 4I0WB 1BK1A 2JB4A 4Y24A 4QB2A 2R6QA 4LNVA 1R093 4P9WA 3TNQA 4UFIA 1H4GA 1KRIA 1SBDA 2XUMA 2A71A 1AX1A 4MGZE 2P3YA 4BMEA 4X8PA 4IEQA 5A70A 4O9GA 5F32A 1UZZA 5FZ7A 3PVEA 1VRH1 2A5ZA 2CYFA 4Q2FA 4IERA 2WNUA 4CA9A 1LHOA 4FPCA 4W4ZA 3ROUA 1AL21 3JQWA 3OTFA 3HIFA 3WVJA 2HWC3 4AXOA 4LBOA 2BW8A 3VBSC 2NQYA 2G4IA 5C2MA 3NMBA 1NYWA 4QXCA 3VBHB 1GV9A 5DAWA 3SCGA 1YUDA 1SBEA 5FPLA 2VDTA 4NHKA 2WWJA 4NROA 1L7LA 1RJ8A 2NLRA 4QX8A 1FPN1 1GZCA 3MDPA 1JZ6A 3BIEA 4XABA 3ZXAC 4NPMA 4RHV3 4BMBA 3WNMA 1O3SA 4OI2A 4YGBA 3I59B 2BQPA 2QVSB 1MEC1 4JGZA 3TAYA 4GJYA 4AYUA 3U07A 1R081 3VBHC 4UFMA 3ATGA 5DZEA 3J8F2 1AVBA 1ZBA2 5ACA1 1SQ4A 1OYGA 1YIPA 3N7KA 1W9SA 3K48A 4PLOA 4WM8B 3MIBA 5CYYA 5LEKA 3C7OA 3U0ZA 5E89A 1FXZA 3SH3A 5B4NA 2JG9C 5DUXA 1FV2A 2BOJA 4CDQB 2AREA 1DQ1A 5JMOA 2JICA 4LKEA 5A8CA 1NQDA 1UN1A 2VOVA 1DP0A 5FYHA 4BLJA 2YBSA 3BI3A 1AR72 4GH4C 5FYBA 3RQ0A 3AX4A 2VTXA 3BTYA 2JDPA 1ULPA 1YWKA 3WSOA 4OQ8A 4XJUA 1LEMA 2PHDA 3RZMA 3E5QA 4RQPA 4AK3A 1K5MB 3BKZA 5FQ0B 5ERLA 1SFNA 3ZYPA 1Q8PA 2ZMKA 3ZSLA 4D94A 2Q5TA 4CDWA 3AYEA 4XPVA 3WMYA 2EXJA 4HKWA 5JXGA 2P2KA 3OGRA 2BGPA 5DAXA 3EHKA 3OYWB 2WNVA 4LORA 2XVKA 4IL7A 4JGZC 3N4MA 2E26A 3POJA 1SLLA 3LV4A 4U2AA 2JEMA 4Q4X3 4WM7B 2GU9A 1V6LA 3MV11 4QQOA 3LA2A 4R52A 3FUQA 3VKNA 2XDVA 4U36A 3Q8FA 4ZKTB 4XETA 4IV3B 1XSRA 3MPBA 3FBMA 2VMGA 3USUA 5C8CC 1RMU2 1WA6X 1RVF2 3WP6A 4A6SA 5CBLA 3NQHA 1G9AA 3VBRA 4XJ9A 1AF9A 4UF0B 2XBO1 4HFSA 3LOIA 2RDQA 1I1EA 3BTZA 2BBVA 2B42B 2HWF2 2ZMLA 5E16A 5C4WA 1JZ2A 4GXLA 2XJUA 1AR63 5BNPB 2DVBA 1N3PA 1AXYA 2BUKA 3AP5A 4HVRA 1YQ2A 1GBGA 3Q8BA 1EV12 3BYNA 2JG9A 3WATA 1CJPA 1ZM1A 4YVWB 4UW5A 4C0BA 2ZGRA 5ACA2 4NWVA 1S55A 3J7LA 2ZX3A 1AL23 5I8TA 5EP9A 1LULA 4XXAA 1CAWB 2JDAA 5BNNB 4O8NA 4YNIA 3QLQA 1W8HA 5A1FA 2DVAA 4MO3M 4Q0VA 1AL0G 4LIVA 4A7ZA 5GLKA 5FUIA 5JIAA 5T3NA 3K46A 4QKDA 4G3YC 3RMXA 4Z07A 4EWAA 5FYZA 3MIHA 2ZHNA 1RUH1 3VKLA 2Y26A 4HKLA 5FYIA 3CJIB 4AL9A 4NHLA 2B8MA 4YYOA 3ZN4A 4AVTA 2AH2A 1JHNA 1H8TB 4TN7A 1H8TC 5KR7A 2D6NA 1XE7A 1XQNA 5C9AA 2WJSA 1O8SA 1PNGA 3IIAA 4HSLA 4UYBA 2QFEA 3RWNA 2HWB1 4CEYB 4U6DA 1H9PA 5D8AC 4HG6B 3VDBA 1O4ZA 3M4FA 1R1A3 3KV4A 2HWF3 4N9IA 1G86A 2XUEA 2Z2SB 4HONA 1ND2A 1US3A 3MHZA 2R041 4Q4Y3 3RFRA 3WW1A 1IG0A 1DG6A 3KHCA 1Z0HA 2GSYA 2VC9A 2ZOEB 4WVMB 3WHUA 3D6EA 4GB32 3WUDA 2JDKA 1RUE3 2W1SA 4IE7A 2QQVA 2CAUA 4LJHA 2VOXA 2WYFA 3JD73 4AGGA 1XNTA 1NCRB 4HL0A 2WFF3 2ZABA 2ZA9A 1WLDA 3ZYGA 1GZTA 4AF9A 1MZEA 1PO21 3BOPA 1UU6A 4PBPA 4NOVA 2VOWA 2J1AA 3CZJA 2XBO2 1Y9MA 4QX1A 2ZS6B 1PO11 1D4M2 5F3CA 1QJY3 1H1MA 1OOPA 2VQUA 3CJXA 3S0MA 3ALQA 2P6CA 1RUF2 5KHIA 2I74A 3CU7A 4P02B 1OF4A 1Q3EA 1XNDA 2XONA 2QQJA 2W68A 5A3TA 1K42A 2WA3A 1M4WA 1Q8VA 3VSRA 5C8CB 2WS93 3UKVA 5KWRA 2WZPP 4H55A 5BNQA 5J09A 3HMYA 1F31A 2WIIB 1H2MA 1NY72 1VBD3 4YVSC 5GLOA 4AFCA 5GZGA 3NKGA 1RUD1 1Y4WA 1OKQA 2EVXA 4RL7A 4LITA 2IFWA 4XFHA 2ADEA 2C24A 5GLNA 1O91A 4PF5A 5KXCA 1F8VA 4D47A 5IFTA 1DFQA 1RUC1 4CUBA 3NL1A 1BVVA 3LDRA 1VBE1 4BQ2A 2D5FA 2R0FA 1AR93 1LB2A 1QU0A 3AZZA 1EUTA 2BV4A 1RUD3 1ZVFA 2GP3A 3LCPA 3OY8B 4N90A 1NT0A 4QU2A 2KM2A 3O7OA 4FCAA 4L92A 3SEEA 3MW2A 1E5HA 2ARAA 2W1UA 2JKBA 1OLMA 3ORJA 5DAVA 1LOBA 3QH6A 4Q0PA 5EV7A 3D60A 4LBNA 5T5PA 5LK7B 3IBMA 1SFYA 3SNMA 4CZSA 1H30A 1XNAA 1D0HA 2C1FA 5FZMA 4QHOA 2BVBA 3OPZA 4EV0A 1ZX5A 3LZZA 1N1TA 2NM1A 3W58A 3U37A 4TYSA 4B1MA 1CZVA 4UW4A 1EAH2 1ZBE3 2E7QA 1GQHA 2WZEA 4XIKA 3LDBA 1RL3A 2ZCWA 4QD2A 3NSTA 4NRMA 1VBD1 1MS3A 1ZBA1 4HXCA 3ZFGA 4CEWB 3O12A 5CFDC 1HQWA 2LW8A 3HWJA 5LBCA 4CCNA 4CE8A 2DFBA 1MEC2 3I4IA 1JN2P 3O1MA 1CQ9A 3ZN6B 2AR6A 2WZR1 3K4AA 3SITA 2CL2A 3R4UA 1U12A 1RVF3 3IWZA 1S0JA 1WCDJ 1RUI2 4XBQA 2V73A 2BVVA 1H2NA 3TB0A 5LW9A 1ULGA 4B7EA 2K9ZA 1UZVA 4ZZ8A 2Y0OA 4CUAA 2WINB 5DG2A 4QAWA 1PM7A 2CGNA 1S2KA 2XB6C 5LA9A 4DY5A 1GQPA 2HEYF 2VW2A 4EWEA 2B4KA 2X05A 1C8M3 1JYTA 4PIYA 2Z4FA 3S57A 3UYJA 1RHI1 3NNLA 3E5UA 1DGRN 4XTPA 3LEGA 2N7GA 5CVRA 1J1TA 2P34A 1B09A 5APAA 3WF1A 4A42A 4K8RB 1AXZA 2AGSA 5AYCA 2GN3A 2OXBA 1SMVA 4JDMA 3CEWA 2HWD2 2PAKA 2F17A 1LECA 4UW6A 1WLTA 2VOTA 4MLOA 1VBE2 1R64A 4NHXA 1VBB2 3VZKA 5EXOA 1UKGA 2IVJA 1UYYA 3KLSA 2RS32 4BIOA 2JDYA 1ZRDA 4Q27A 5IVCA 2G9GA 4QQPA 4RR3B 5BNNC 5K0UA 3VT2A 3PIGA 1ULFA 2ZGOA 1RTVA 2AC1A 4BOWA 5HBAA 5FLHA 4JQTA 4KMIA 4OI1A 2RS51 2RS12 4Y20B 3WDYA 5JAXA 1BJQA 4XACA 5A6YA 2C6SA 1GMMA 1DYOA 1POQA 1UMZA 3WNLA 4N1IA 5FY8A 5CB7A 4RS5B 3I2DA 1W90A 3ZSEA 5IVYA 2XL9A 4FPKA 5I93A 2DCZA 2QNKA 1O7FA 4TWTA 5F1RA 1DQ4A 3AM2A 3OD4A 4I0AA 1AYM1 5A3OA 4GB33 1D7PM 2Q30A 5JDBA 5K8SA 4AVVA 1MZ6A 2W95A 4LO6B 4KGQA 5FMCA 5FRAA 4Y4YA 2DVDA 5J1XA 1AYN1 1UYZA 2JIGA 5IJRA 2B9VA 4AOCA 3KS7A 5FP4A 3VDCA 3MW4A 1U5YA 2W2IA 1VIWB 4AFAA 4CPBA 1D4VB 2A73B 2VW1A 3FUOA 4L8QA 1QJU2 4PLMA 4XEZA 2ZKLA 3IN9A 4PCRA 3FFQA 2O14A 1IQDC 2VCAA 4P14A 4Y1YA 3VD5A 3WNXA 1C3HA 5FYSA 3VKMA 3ZYHA 3V0AB 2X8SA 1TVGA 4ASMB 3WLUA 3WN1A 1VAMA 4FP3A 1QDCA 2TNFA 2VCCA 4JC1A 4D6QA 4DXRA 5C8CA 5JPMB 4HZFA 5C5TA 5EIYB 1IOAA 4JDNA 1IS3A 3GBGA 4QDRA 1K5MC 2PLV1 3SQOA 4ZU4A 4JAAA 1ND3C 1O4YA 3S6PA 3VD3A 3WEZA 1KGYA 1RUNA 2E51A 4N43A 1JTZX 2Y6JA 1Z78A 3BU7A 4ZU7A 5E6HA 4GH4B 1W8OA 1OD5A 2RS13 1Y3TA 4IEYA 3AP4A 4NIIA 4W6WA 1GNYA 4XF1A 3U14A 3T1MA 2ZZQA 1PIV3 5D8AB 5FCCA 1S0CA 1SLAA 3AP6A 1W04A 1QNYA 3IMMA 3OY8A 3RJRA 1HRI1 4YPJA 5D21A 2IWGB 2GC2A 3ZFEB 5C6CA 3THDA 5HXVA 4FTEA 1REFA 4XDPA 2GALA 4JVAA 1HXS1 1S2BA 4KWLA 3VDDC 4L97A 4A6OA 3D5ZA 2LALA 4D69A 3WDTA 3A23A 2PHFA 2G1MA 2PMWB 4I01A 1JZ8A 4MYEA 5A3NA 2ZGMA 2ILMA 2YGMA 2VR4A 5I8SA 5FLWA 4BDVB 1SCRA 2DU0A 1PK6B 5C3PA 1EY2A 1QJY1 2UU8A 2J1EA 1NLSA 1CX1A 1KJRA 1GP6A 1JZ3A 3DPRB 1ULEA 1COV3 4E4ZA 1S4CA 1VRBA 5K9YA 3PU8A 3AVRA 1HLCA 4XC9A 4ZHNA 2WFF1 4AVBA 3LQCA 1UX7A 4J1WA 1OD3A 4N8MA 3TEYA 3I49A 3IPVB 2O0OA 1VRH3 1K5MA 4PI2A 5J3UA 1WLWA 1HQLA 1RUJ3 4UBGA 2VD7A 1HJGA 5CU1A 1W0OA 4AK5A 3O1VA 3WPYA 3SCFA 4Q4W3 3KZ4C 4UFKA 3ACGA 1Q56A 3E6DA 4L9BA 3MZHA 1CD3G 4WZCA 2VNOA 2FCUA 5FZDA 1ZZBA 1JH5A 2WO1A 3AK0A 2GH2A 3ILRA 4DUVA 3E6CC 4AEDC 2WQ8A 3H9AA 1ST8A 1KD7A 2LRPA 2BPA2 4ZS3A 1ZBE2 1N1SA 4IGOA 5JWPA 3OPWA 1U5IA 2XL7A 5L9RA 3AJZA 4N4BA 3JXSA 3NNFA 2DBIA 1CJDA 1H0BA 1W0NA 4XFAA 5E88A 4ZXEA 3R4ZA 1UW8A 2B5HA 3WG2A 1N3OA 5CFDA 4OUEA 3WQ0A 3DN7A 3SH5A 4KGGA 4MADA 4NAOA 3A0KA 3H1WA 3ILFA 1V0AA 2GC1A 3UK9A 3UNPA 3NRUA 5T55A 5FY1A 1XNKA 5B4XA 3RMYA 3I54A 1UY3A 1GNHA 2QQKA 5FYYA 4KU8A 3T4HB 1NA1A 4QB1A 3URFA 5CKQA 1G9DA 2ZEXA 5FZOA 1PNFA 1NE4A 3WW4A 1I6XA 5IK8A 1ZRCA 2PAMA 1HN1A 3A7QA 5IWFA 2EAAA 1Z7S3 3PUQA 1ENRA 1LRHA 1W6NA 3WASA 5A3WA 3ZYFA 4LK7A 4YM1A 4AR2A 4ARYA 2R49A 2OZJA 3VT1A 5D2AA 2OIIA 4XURA 3VZLA 3MLLA 4KU7A 5ABJB 1UQXA 4NE9A 1W05A 4YARA 1LGCA 1J83A 4FT8A 3LFIA 1J3RA 4D7YA 4P08A 2OQ6A 4MVTA 1F35A 1OA2A 2FMDA 5IAVA 4CPBD 3HNYM 1POV0 3ZPOA 1NG0A 4NR1A 2VUJA 2BBAA 3D0SA 3NV2A 2CWMA 4OCTA 3WNPA 4CEYA 2JDZA 1OH3A 4SBVA 1WWYA 1V9U3 3OPTA 4M3CA 4CUGA 1Q8SA 5CNAA 2VNRA 5CKNA 1F9KA 1REEA 2QDNA 4K7JA 4TTGA 4MGKE 2DCTA 3IIIA 1HXS3 2G19A 1OFNA 2Z79A 4QPGC 3HQXA 1CESA 2WO7A 4J25A 5BNOC 2OT7A 1LOAA 2BWCA 4ONZA 2ENRA 5LA1A 1WD3A 3VBSB 4UI9L 5B6SA 2XXZA 2DVGA 3RZLA 1QJX1 3DUIA 3R4SA 4DINB 3G6JB 1RC6A 2VQTA 2RMU2 2MPFA 4XDOA 1W3XA 5KXDA 3NVCA 1UKRA 1UPSA 4P9YA 5FLIA 5HPOA 2A3XA 4QQSA 4H7MA 4LK6A 4O65A 4XTMA 1C8M2 1LOGA 2AYHA 4F3JA 5FYMA 4Z8BA 4PVAA 2XWJB 1YI9A 3BYWA 5D8AA 1H9WA 1UY0A 4Q0SA 5C3SA 4I2OA 1B35C 3WF2A 4FTBA 5FZHA 1UZWA 3VBFB 3RJ2X 4QKFA 3WNOA 1MVEA 2A3WA 1BCXA 1F5FA 1WCKA 1L3JA 4QX3A 4QPGB 2EIDA 3NV1A 2Y6HA 4PBOA 2QQWA 2VZRA 5IYYA 5LY2A 3DYOA 1BBT2 2YFUA 3EQEA 3INAA 1S0BA 5CAZA 5LZ6A 5FFOC 1W6PA 1VBC2 4S2GA 1Q8QA 4CCDA 5C9AB 2FDJA 2RJ2A 3B02A 1G8WA 3I2FA 1FOD1 4W8JA 1QJFA 1V6JA 2ZHLA 3OGSA 4XFCA 4F8AA 5JZGA 1Y9QA 2VOKA 3MFCA 4RHV2 1HRV1 2ZAHA 1S2EA 1X9TA 1LOFA 2W46A 3DPRA 4HPKB 5T5LA 3WV6A 4ZZ5A 4KI5M 3Q8AA 2VZQA 2NZ9A 5FLJA 1GOHA 2QBXA 3GGLA 4FPJA 2CSGA 1AR62 5AFBA 4CP9B 4AAPA 3MUY1 3BYKA 3VKOA 5SV5A 1LAJA 1BK0A 4CDXA 3I3EA 5F3EA 4MXWA 2VVDA 2VO5A 1OT5A 1UAIA 1JHJA 5BUVA 4IXLA 4D3WA 3HT2A 2XKOA 5GJ6A 2Q8DA 4AAXA 2I2SA 1PVC1 4AQSA 2FD8A 5I0UA 1U5ZA 4Q0QA 4ASLA 4B4QA 4AG4A 1QEXA 2R071 3P1IA 3VKFC 3OBZA 3OBTA 4LUMA 4P9GA 4MV2A 3IB3A 3ZFGB 3KB5A 5EWSA 4JKLA 1W2AX 1KDMA 1OXCA 3GHNA 2P3KA 2ARBA 2HH9A 1LKNA 4JGYB 2FDFA 4XBNA 2V4VA 2QJVA 2IXIA 4WVZA 3VUOA 2XGXA 1RUI1 2MHFA 3JD72 3U78A 3BCWA 3BIWE 5A7OA 1KS5A 3VGIA 1BBT3 2VVFA 4E4SA 2W1WA 4I09A 4IE4A 5K4LA 1G9CA 3H1MA 2D40A 3UKTA 5JCTA 1RHI3 4LPLA 4QPIA 1UXXX 1PX3A 1I9RA 1RUH3 3AB0A 3AL6A 3GZAA 4IV1A 4MSVA 2YXSA 1RUF3 4R9BA 4IEOA 1VPHA 1HB3A 3EMRA 3F2ZA 5JMCA 1AR73 4COVA 5CFCA 4KC8A 2JG8C 4B8EA 4O8PA 3I2OA 1EV11 1QJU3 1O59A 3H7YA 4GMP3 3N7MA 2ES3A 4LO4B 3UV9A 1CPMA 3I8TA 1VJ2A 3N7LA 4Q29A 1GQGA 2DBNA 2V09A 2R061 4N53B 4OFGA 2WN2A 1UX6A 1XB9A 2WABA 1FX5A 2BFUS 4R8HA 1IS6A 3RYRA 4F83A 2J1UA 2WZR3 1D2SA 2YG0A 5BNOB 4PJYA 4BISA 3AYCA 1RUJ2 4Q4Y2 3ZDVA 1VR3A 1ASJ3 4KNCA 1NE6A 4M3CE 4O8OA 2EA7A 4RQPC 3APBA 4AEKA 3ZKUA 1UU4A 2HWD1 2Y64A 3AXEA 1ZBE1 1W9YA 4YG6A 1C28A 3L2YA 2E31A 1APNA 3RG0A 3W20A 4AGRA 2YFSA 1LCLA 3IM0A 3E97A 5C3RA 3EBRA 1OC1A 5F37A 1O3TA 3RZJA 5GALA 3FFZA 1PZ9A 1X8MA 1SLCA 3LE0A 1S1AA 3NNJA 4AI3A 5F7UA 3O1PA 1PT2A 2VULA 3ZDSA 1V6MA 5GLRA 3NW4A 5C33A 4URAA 3HQRA 5I0SA 1AXKA 4QPIC 1OQEA 5BXXA 1DGWA 4ES8A 1C5HA 3G7DA 4YGCA 3WDWA 2VY0A 1JI6A 4E4HA 4YLZA 1ZA7A 3MF9A 4N9HA 1RUG3 4Y33A 1MZ5A 3OBRA 5DDJ2 4RGAA 4MXVA 3WOGA 2WS92 1JUHA 3P6BA 2VPVA 1IS5A 1BKZA 3SCHA 1UD1A 2YU2A 4PQQA 2ZZJA 2XWBB 1FYUA 2IXJA 2ETEA 1E57A 2ZACA 1GZ9A 3O5SA 2P3JA 2HLEA 4Z82A 4BJ0A 1ND3B 3FHIB 4W50A 5KHHA 3WINE 3RDIA 2HBUA 2R062 1QOTA 2OZ6A 4H3WA 3B93A 3DKWA 1AR81 2WFPA 1C5IA 3CF6E 5F2WA 4QHZA 2DFCA 1DBNA 1A8MA 4XUPA 2R32A 3CLPA 4KG0A 1SG3A 1Z7S2 3KMHA 1DGRA 2RVAA 2I07B 3J4UH 4FP2A 3THCA 4YSFA 2Z42A 4ISRA 5FO8B 1AUYA 2TEPA 2A6WA 2ZJCA 3TN91 4QGMA 3ST7A 4Q4X2 5KC5A 2RDSA 2RM23 2V4AA 4LUKA 3KD4A 5FZGA 5JR7B 1CZSA 1D4M3 5FKBA 3DV8A 2XOMA 3UT0A 3NAPA 4BE3A 4CCEA 3MIEA 3DYMA 4GIQA 4IETA 1YFXA 1NA1C 3ON7A 5IK4A 2BGOA 4PDWC 3CQOA 2DCJA 3VLBB 3D4KA 5JXHA 5FUPA 4E8CA 1RUE2 4CP9A 4P5YA 5FZKA 4WZFA 3PL0A 5LASA 4AEMA 1FPN3 4BB3A 5GKAC 4LR4A 5HCAA 3LKJA 2E7AA 4L99A 4QGLA 2XJQA 2DVFA 4AI8A 3OM5A 3M2MA 1LR5A 1R1A1 1SLTA 1NLQA 2VZ3A 1YJKA 2WQZC 5EFUA 4Z92B 1WW5A 1GWKA 1VMHA 3AMNA 3T08A 2D3RA 1NY71 5AVAA 3JQXA 4FSJA 4H7LA 4JKMA 3PJQA 2WNVB 1QJU1 1DF0A 3OGVA 4JX0A 2VNGA 4KWKA 3OM4A 2Q4SA 5T52A 4YZ2A 3KV5A 4CEYC 2EIGA 5FKCA 4CDQC 3ZFFC 1OKOA 3KCXA 4M0NA 5AC93 4JGYA 4FOWA 4QHBA 4BYYA 3WP4A 1LHUA 5EJZB 4QQHA 4AZZA 2D3SA 2AUYA 2D6LX 4YWAA 4UF0A 1KEXA 4OI0A 4XHBA 2FQPA 2VCBA 3POBA 4IUGA 2BNNA 1QIQA 2F6BA 1BXHA 2WKKA 2DUPA 4LTAA 4YW3A 4CDUC 4K8FA 1AR92 1UMHA 5FDBA 3NJVA 3OM2A 3KT1A 4P9JA 4NPLA 1OVSA 2ZGSA 5J7MA 1IKPA 5FMDA 2LS6A 4C8DA 3GCWA 4Z1VA 2W94A 1X8EA 3B5LB 4OUSA 2BEOA 3M70A 1STMA 4CUCA 1CAVB 1N1VA 3NAPC 1PVC3 1ULDA 1PZ7A 2BJSA 3GCXA 3KV9A 4MLGA 2Q0AA 2DUOA 3AMHA 1KQRA 4NUBA 4GD4A 5JSPA 2TUNA 3QZ4A 4UXAA 2GZWA 3VT0A 1RMU3 3AZYA 4BU2A 3TEXA 4V2WA 5CFDB 1VAKA 3AZWA 3OG2A 1XSQA 3AZVA 4GMP0 3C7HA 5FZBA 3E6BA 3T1LA 2JG8B 3WP5A 2RV9A 3NJXA 4KBZA 2ZEYA 4UWDA 1JUIA 1HB4A 1Q8OA 2EALA 1S0EA 1HRV3 3ES4A 3R6SA 5LEJA 4Y22B 3QEEA 1CAUB 2NMOA 1NXD1 3D5YA 5K0UB 1A3KA 1SFPA 4PI0A 1Y7BA 3RZHA 2EF6A 2QE3A 2NN8A 2ARXA 2WSUA
chains in the Genus database with same CATH topology
3VSRA 3VSZA 3R4ZA 3VSFA 3TAWA 3PIJA 5FMBA 5GLOA 3C7FA 1Y4WA 3WMZA 2XQRA 3S5QA 3AKGA 5FIXA 2ADEA 3WMYA 2EXJA 5GLNA 3QC2A 5FMCA 4KCBA 4D47A 4FFHA 3P2NA 4U6BA 3LDRA 4AK7A 5FKBA 2ADDA 2YFTA 4CCEA 4UDGA 5A8DA 3AKHA 3LV4A 3LIGA 3C7GA 2X8SA 3BYNA 4O8PA 3KF5A 3WN1A 3WPVA 1UYPA 1W18A 4FFFA 1GYEB 3D60A 4PVIA 2X8FA 5JOZA 3ZR6A 3NQHA 3WASA 1W2TA 1WL7A 3WN2A 3OM5A 5GLPA 4FFGA 5A7VB 4UFJA 3VT1A 2QQUA 3LIHA 3UGGA 5GLLA 2AEZA 4B1MA 3LFIA 3VSSA 2EXHA 4KC8A 4KCAA 5AYDA 3WATA 3U14A 3OM4A 4HXCA 2EXKA 3AKFA 3LF7A 3WAUA 5FKCA 3IMMA 4COTA 4UFIA 1VKDA 2YFRA 4O8NA 1YIFA 3KSTA 4UDKA 1YI7A 3ZR5A 5AYEA 1YRZA 5FK7A 3ZXKA 2B4WA 4ONZA 1GYDB 5GLKA 4AZZA 3D5ZA 1UV4A 3K1UA 5JOYA 5B6SA 3AKIA 5A7VA 4O8OA 4UDIA 3QEDA 3LDKA 5ANNA 4QQSA 4UDKE 3NMBA 2VDTA 5FLWA 2YFSA 3OM2A 3D61A 3OSDA 4UDJA 4KC7A 3RWKX 4PVAA 5FMDA 3ZXLA 4FFIA 5GLQA 5JOWA 4CCCA 4U6DA 5GLMA 3QEFA 4B1LA 3BYJA 1PT2A 5B6TA 4EQVA 3UGHA 4MLGA 3WPZA 3C2UA 5GLRA 3UGFA 4UFMA 3R67A 3QZ4A 5AYCA 4N2RA 2AEYA 2OXBA 3VT0A 1OYGA 2QQWA 3LEMA 4AK5A 3CU9A 1Y9GA 2QQVA 3WPYA 3R4YA 4UFKA 4CCDA 3C7OA 5FK8A 3KF3A 1GYHA 3C7HA 3WPUA 3HBKA 4N2ZA 4NOVA 3WN0A 3ZXJA 4UFHA 1Y9MA 4AK6A 2EXIA 3VT2A 3PIGA 2AC1A 4N4BA 3OM6A 4JQTA 3BYLA 3QEEA 4KMIA 5A8CA 1ST8A 3OM7A 5AY9A 3H3LA 4UFLA 5JOXA 3U75A 2X8TA 3D5YA 3C7EA 3SC7X 5C0PA 3U1XA 4N1IA 1Y7BA 4QHZA 3BYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSR A;  3VSZ A;  3R4Z A;  3VSF A;  3TAW A;  3PIJ A;  5FMB A;  5GLO A;  3C7F A;  1Y4W A;  3WMZ A;  2XQR A;  3S5Q A;  3AKG A;  5FIX A;  2ADE A;  3WMY A;  2EXJ A;  5GLN A;  3QC2 A;  5FMC A;  4KCB A;  4D47 A;  4FFH A;  3P2N A;  4U6B A;  3LDR A;  4AK7 A;  5FKB A;  2ADD A;  2YFT A;  4CCE A;  4UDG A;  5A8D A;  3AKH A;  3LV4 A;  3LIG A;  3C7G A;  2X8S A;  3BYN A;  4O8P A;  3KF5 A;  3WN1 A;  3WPV A;  1UYP A;  1W18 A;  4FFF A;  1GYE B;  3D60 A;  4PVI A;  2X8F A;  5JOZ A;  3ZR6 A;  3NQH A;  3WAS A;  1W2T A;  1WL7 A;  3WN2 A;  3OM5 A;  5GLP A;  4FFG A;  5A7V B;  4UFJ A;  3VT1 A;  2QQU A;  3LIH A;  3UGG A;  5GLL A;  2AEZ A;  4B1M A;  3LFI A;  3VSS A;  2EXH A;  4KC8 A;  4KCA A;  5AYD A;  3WAT A;  3U14 A;  3OM4 A;  4HXC A;  2EXK A;  3AKF A;  3LF7 A;  3WAU A;  5FKC A;  3IMM A;  4COT A;  4UFI A;  1VKD A;  2YFR A;  4O8N A;  1YIF A;  3KST A;  4UDK A;  1YI7 A;  3ZR5 A;  5AYE A;  1YRZ A;  5FK7 A;  3ZXK A;  2B4W A;  4ONZ A;  1GYD B;  5GLK A;  4AZZ A;  3D5Z A;  1UV4 A;  3K1U A;  5JOY A;  5B6S A;  3AKI A;  5A7V A;  4O8O A;  4UDI A;  3QED A;  3LDK A;  5ANN A;  4QQS A;  4UDK E;  3NMB A;  2VDT A;  5FLW A;  2YFS A;  3OM2 A;  3D61 A;  3OSD A;  4UDJ A;  4KC7 A;  3RWK X;  4PVA A;  5FMD A;  3ZXL A;  4FFI A;  5GLQ A;  5JOW A;  4CCC A;  4U6D A;  5GLM A;  3QEF A;  4B1L A;  3BYJ A;  1PT2 A;  5B6T A;  4EQV A;  3UGH A;  4MLG A;  3WPZ A;  3C2U A;  5GLR A;  3UGF A;  4UFM A;  3R67 A;  3QZ4 A;  5AYC A;  4N2R A;  2AEY A;  2OXB A;  3VT0 A;  1OYG A;  2QQW A;  3LEM A;  4AK5 A;  3CU9 A;  1Y9G A;  2QQV A;  3WPY A;  3R4Y A;  4UFK A;  4CCD A;  3C7O A;  5FK8 A;  3KF3 A;  1GYH A;  3C7H A;  3WPU A;  3HBK A;  4N2Z A;  4NOV A;  3WN0 A;  3ZXJ A;  4UFH A;  1Y9M A;  4AK6 A;  2EXI A;  3VT2 A;  3PIG A;  2AC1 A;  4N4B A;  3OM6 A;  4JQT A;  3BYL A;  3QEE A;  4KMI A;  5A8C A;  1ST8 A;  3OM7 A;  5AY9 A;  3H3L A;  4UFL A;  5JOX A;  3U75 A;  2X8T A;  3D5Y A;  3C7E A;  3SC7 X;  5C0P A;  3U1X A;  4N1I A;  1Y7B A;  4QHZ A;  3BYK A; 
#chains in the Genus database with same CATH topology
 4UOJ A;  2ZX0 A;  4JGY C;  2YHJ A;  3WDU A;  5SV8 A;  3TAW A;  4OVE A;  3IDC B;  3MV0 1;  2HJI A;  3CDZ B;  1AHS A;  3AXD A;  4LUL A;  3K4D A;  5E1R A;  5IK7 A;  2FDG A;  3WMZ A;  1PO1 2;  2E6V A;  2X10 A;  3MGU A;  1PGL 1;  2PTM A;  1BLZ A;  2WUH A;  5F3G A;  3VBU A;  1OLQ A;  2MNG A;  2Y34 A;  1G6N A;  1OVP A;  5DAQ A;  5FPZ A;  2OUJ A;  4YM0 A;  5FBJ A;  3TRS B;  1OLM E;  4CYD A;  2GC3 A;  2C0Z A;  4YW1 A;  4MX3 A;  3MLK A;  3SKV A;  5A7W B;  2Q8O A;  1JOB A;  4XQD A;  4Q1P A;  3SLI A;  1W6O B;  3ZMO A;  1ALY A;  3N7J A;  1H1A A;  5DDJ 1;  4LBJ A;  1WCU A;  2R30 A;  4YVS B;  5EPA A;  1W8Z A;  3MIC A;  3IKW A;  1UY2 A;  5L19 A;  4JRL A;  2PQQ A;  5GLW A;  5F3I A;  3V0B B;  1VBB 3;  1W18 A;  4Q1R A;  1V6I A;  2EIE A;  5JOZ A;  1VRH 2;  1QQP 1;  1VBA 2;  5J98 B;  4CTE A;  1WL7 A;  3FWE A;  3VHR A;  1XE8 A;  4FPL A;  2FZ2 A;  4CU7 A;  5FRE A;  1OH4 A;  4N7U A;  1MQT C;  3VBH A;  1WGP A;  5C8W A;  5FMO S;  1W2O A;  2AEZ A;  1OUS A;  2HEW F;  5FYU A;  1W9T A;  3NAP B;  4HN0 A;  1O5U A;  4N43 C;  2EXK A;  5IVF A;  3TEZ A;  3WAU A;  4K40 A;  4DFS A;  4LKF A;  4MOA A;  1W28 A;  3T0D A;  2JWP A;  1VAV A;  2FCV A;  1FAY A;  1US2 A;  3HD8 B;  4DQA A;  5J96 B;  5LY1 A;  1QJX 2;  3KST A;  4UW3 A;  4QPG A;  2X29 A;  2BER A;  2YYO A;  1UV4 A;  1MVQ A;  2C5D A;  2RS5 3;  4BXF A;  2J1R A;  4XCB A;  3RZK A;  2VZU A;  1HN0 A;  5A7V A;  3MEP A;  4XJA A;  2D6P A;  4XVH A;  2NMN A;  1SPP A;  3KM5 A;  2E33 A;  1QXJ A;  2OA2 A;  4RGG A;  2ZEZ A;  3LDK A;  5JIU A;  1O5L A;  3CHX A;  1RXG A;  1PVC 2;  2UYA A;  1BMV 1;  3ME2 A;  5GLU A;  3TOJ A;  3N3H A;  4YRD A;  2ZEW A;  3ILN A;  4DXT A;  1JZ7 A;  2JJ6 A;  3MID A;  3VN4 A;  1PVX A;  2P4E A;  4CEW A;  2HWB 3;  1XRU A;  2WFF 2;  2OW4 A;  2WT0 A;  3N36 A;  1IPS A;  5FYC A;  4LEJ A;  3VBO A;  2X53 S;  4LBQ B;  2VGD A;  5DUV A;  2QDR A;  1YQ6 A;  2FBE A;  4K20 A;  1WW4 A;  2AZ5 A;  2DCY A;  3JB8 A;  2WN3 A;  1QJE A;  2WR9 A;  1C8M 1;  3I2G A;  1LHN A;  3NKT A;  3WQ1 A;  3WQ7 A;  4A45 A;  2W92 A;  5FY0 A;  2W87 A;  5A7P A;  4ET7 A;  1OPM A;  3WG1 A;  3KF3 A;  3Q8E A;  3BTX A;  4R4Z A;  5A33 B;  2XVL A;  1XPW A;  3CL1 A;  3FLP A;  3WT3 A;  5LAT A;  1IKQ A;  3ZXE A;  2R07 2;  4AHX A;  4QM9 A;  4QM8 A;  1K12 A;  5JXI A;  1KXG A;  1YC6 1;  2J1V A;  3M3O A;  3ITQ A;  3L9J T;  4OHX A;  5A3L A;  5AY9 A;  1T6G C;  2WNV C;  3SC7 X;  1FI2 A;  3K2O A;  2JDH A;  4HSJ A;  4YM2 A;  3GM8 A;  3HJR A;  2B7Y A;  5FZE A;  3VB9 A;  1A6C A;  5FZF A;  4AE2 A;  5TSW A;  3VHO A;  4RGK A;  2KXL A;  1FOD 3;  2ZXQ A;  1RUJ 1;  1ZBA 3;  3VZM A;  3VSF A;  3CKH A;  1ACC A;  3P3P A;  4BPZ A;  2WQ4 A;  4IE6 A;  4QGN A;  1ONA A;  2WZR 2;  3WHT A;  1V9U 2;  4COZ A;  1YLL A;  2C4X A;  3CMG A;  4YZ4 A;  4HLT A;  1W8U A;  1COV 2;  4KCB A;  2YB7 A;  3IZO A;  1W6Q A;  1DU3 D;  1GZW B;  2WC2 A;  5GZD A;  1PHM A;  1JXN A;  2E63 A;  4RS5 C;  1O3R A;  3GDB A;  1H8V A;  2XJV A;  4IEX A;  4A3Z A;  2QQN A;  1DZR A;  1QH6 A;  2PXJ A;  2RR1 2;  2X09 A;  3H1Y A;  5LBB A;  4MUV A;  5FR3 A;  2ZMN A;  4QQ2 A;  4D6S A;  3RI8 A;  4N53 A;  1I5P A;  2ET1 A;  3POW A;  1VAL A;  1QNW A;  4FOQ A;  2D97 A;  4GWN A;  3WP3 A;  4CCK A;  4ZPI A;  1F2N A;  2PEL A;  3RSJ A;  4ARX A;  1QQP 3;  3H8X A;  3ACF A;  4GWJ A;  5FXV A;  4FOV A;  3WD5 A;  1ZZ6 A;  1AYN 2;  3VBF C;  2B45 X;  2VZP A;  2JDU A;  4Q0U A;  1W8T A;  1CVN A;  3VBU B;  1ULC A;  4Q4V 3;  3D8C A;  1HRI 3;  5JXJ A;  3B7M A;  4AFD A;  1H8T A;  2F4L A;  3DL3 A;  3RZZ A;  1QJY 2;  1S0D A;  5CFC C;  1V6N A;  1OFS A;  3M1H A;  3AKR A;  2XJR A;  3PU3 A;  4AFM A;  4C91 A;  3LF7 A;  3B3Q E;  4M3C F;  1W06 A;  3RS6 A;  3V0A A;  4BIF A;  2D98 A;  1LHW A;  4XQW A;  2D6M A;  5FXX A;  3S30 A;  1ZZ7 A;  3ACL A;  3ZR5 A;  3AP9 A;  2JD9 A;  1RGS A;  4W6X A;  4KH9 A;  3MIG A;  2WBK A;  4JKK A;  2J7M A;  2ORX A;  2W1Q A;  3IDB B;  1GSL A;  3CIH A;  4UDI A;  2VG9 A;  2BOI A;  2PHW A;  3WZ1 A;  1OA3 A;  1MS4 A;  1VMF A;  3ASI A;  3HN3 A;  1W39 A;  4N43 B;  4PT6 A;  4XJW A;  5L73 A;  4R9C A;  3ZLI A;  3P5B A;  4AHZ A;  3POG A;  3I2H A;  2LRO A;  4J6G A;  2Q1F A;  4N53 C;  2HYX A;  4FFI A;  1JYC A;  1MQT B;  2XML A;  5JOW A;  3H8R A;  1FAT A;  5HCH A;  2IZW A;  4H2A A;  1W99 A;  1YQ5 A;  2WT1 A;  3FC0 A;  4Y5T A;  4B1L A;  1ASJ 1;  5E8A A;  4EQV A;  2KA3 A;  3C8X A;  5IT6 A;  1BZW A;  1OF3 A;  1LOD A;  4XIO A;  3ZM8 A;  3RRD A;  2AEY A;  3PJY A;  1CIY A;  4BHP A;  3MF6 A;  2QCS B;  1JU4 A;  3KQ4 B;  1MS0 A;  3GAL A;  4QWN A;  4OHY A;  4DY3 A;  1EYB A;  2A75 A;  5CZK A;  1JYW A;  1CGP A;  5FK8 A;  4Y26 A;  1DCS A;  2JEC A;  5DPN A;  5FUN A;  3M8L A;  1SDW A;  4MHR A;  1WZX A;  3P3N A;  5DUW A;  1EPZ A;  1B35 A;  2IXH A;  1AX2 A;  1NUK A;  1MS1 A;  1RYY A;  1PZ8 A;  2JD4 A;  4XCA A;  3IDE A;  1H6Y A;  1ZZ9 A;  4EN6 B;  2R16 A;  4XUT A;  5A3U A;  2PHL A;  1OA4 A;  4BZ4 A;  4DS0 A;  3TEW A;  2Z69 A;  4FI9 A;  3RZG A;  5HCF A;  2RM2 2;  3KCC A;  3N9M A;  1ZNP A;  2JXA A;  4LBM A;  2BZD A;  3IPV A;  1RUH 2;  1QY4 A;  1VBD 2;  2RMU 1;  2YV8 A;  2J1T A;  2RMU 3;  3I7D A;  3K3N A;  3HNB M;  3LPF A;  4OHZ A;  3A4U A;  4CCJ A;  5KBF A;  2DCK A;  1BVP 1;  2BU9 A;  2ZGQ A;  2ZGU A;  3L2H A;  4KWJ A;  1A78 A;  2D7F A;  1YCI A;  2K46 A;  3DEC A;  2VZO A;  3SKJ E;  1TMF 1;  2A3Y A;  4OZO A;  4NIH A;  1LED A;  5KXB A;  4AED B;  2VQA A;  5JSR A;  4FFH A;  3P2N A;  2YDE A;  2ZHM A;  3SIS A;  5IVJ A;  4AK7 A;  1DLL A;  3ELN A;  4YZ5 A;  1CON A;  2XBO 3;  4QPW A;  3FX3 A;  2RS3 1;  1FMD 2;  3POS A;  2WA4 A;  4DIQ A;  1R08 2;  4QU1 A;  4AHW A;  4XFB A;  1WKY A;  1GYE B;  3VD9 A;  5F6L B;  2JB8 A;  2DUQ A;  2GDF A;  2VZT A;  4M00 A;  2O8Q A;  3OUI A;  3FLR A;  2BWA A;  5EHD A;  4AVC A;  4CDW C;  4Q8K A;  1FOD 2;  3N9L A;  4KBB A;  1UIK A;  1Y43 B;  2OQ7 A;  4FPO B;  5FO9 B;  3O0X A;  5LA2 A;  3LIH A;  1OQ1 A;  3UGG A;  1QDO A;  2CGP A;  4L11 A;  2JE9 A;  3GBW A;  2VCM A;  4HOO A;  4RD7 A;  1BMV 2;  5H9P A;  3BGA A;  4X6Q B;  3V64 A;  1UOG A;  1DGL A;  3ZXG A;  4BQ3 A;  2IXL A;  4W65 A;  2DUR A;  2R1D A;  5BYN A;  1HQN A;  2XHK A;  1DIW A;  2XH6 A;  3TWI A;  4O7X A;  4Q4V 1;  5JZG C;  5FY7 A;  1XNB A;  5C71 A;  2B9U A;  3WCR A;  4EZ4 A;  5KXE A;  1GU3 A;  2JEN A;  4YFW A;  4XF3 A;  1PMJ X;  3CJI C;  2VBP A;  4OI4 A;  2ZHK A;  2GAU A;  1CN1 A;  4XMI A;  3ZFE C;  1POV 1;  2JDN A;  2ZPX A;  3PUR A;  1JYI A;  3R0R A;  1ENX A;  4LE4 A;  3POY A;  5FYT A;  4ATE A;  1UOJ A;  5M0T A;  1G7Y A;  1HKD A;  4P9I A;  4QQL A;  4RR3 A;  4YGD A;  3D61 A;  3ZFF A;  4UDJ A;  3HOB A;  2VTF A;  2QZ3 A;  1GKB A;  3J9S A;  4XF0 A;  4Y22 A;  4EN0 A;  5EQU A;  4CXY A;  4AEJ A;  1NOV A;  2CNA A;  4COY A;  2PHR A;  3ZSK A;  3NV4 A;  2GMP A;  4R9D A;  3AKS A;  4JTN A;  2YRO A;  3LEI A;  3WF0 A;  1KDK A;  3GJB A;  2HWC 2;  5L36 A;  4EN7 B;  3C2U A;  4RS5 A;  2HWD 3;  2J22 A;  2IVI B;  5IFP A;  1JZ5 A;  1QF3 A;  3VBS A;  2WNU B;  1X82 A;  3ETQ A;  5FPA A;  1GNZ A;  3AMQ A;  3HN1 A;  3CU9 A;  4CEW C;  2K2S A;  3R4Y A;  1DYP A;  1PX4 A;  3FE5 A;  5T54 A;  3VZN A;  4XAA A;  5GLV A;  4DXS A;  3BAL A;  3O1R A;  4N2Z A;  4EN9 B;  2QQM A;  3ZXJ A;  1DDL A;  4OHV A;  2ZX4 A;  3H42 B;  2WLQ A;  1IZ3 A;  1PGW 2;  4Y1X A;  4B29 A;  3T30 A;  4WVV A;  2JE8 A;  4QXB A;  5A7W A;  1L7R A;  4Q26 A;  4UFL A;  5KHJ A;  3I59 A;  4IGP A;  4LOT A;  1PO2 3;  4JGZ B;  4EYU A;  1W2N A;  1SAC A;  1ODM A;  4G4F A;  4LLF A;  4KG8 A;  5EJ3 A;  1SLI A;  1Z7S 1;  5EYX A;  2GME A;  3HR9 A;  4F7Z A;  5A6Q A;  2DU1 A;  1TNR A;  3PIJ A;  2ZX2 A;  1QXP A;  4MGI E;  3U10 A;  3LA7 A;  1W6P B;  3ENR A;  5FPB A;  1GFF 2;  2R06 3;  1O8P A;  4XAE A;  4E27 A;  3UJO A;  2DWR A;  1TNF A;  4IDZ A;  4XOG A;  3RPQ A;  3PDQ A;  1H6X A;  5KHG A;  3KCY A;  2Y33 A;  4GH4 A;  1J58 A;  1GUI A;  1TME 2;  2YFT A;  5IHR A;  2E53 A;  3N9P A;  5A8D A;  1CX4 A;  1WLC A;  1QHD A;  2RDR A;  1W2U A;  2KD7 A;  3LIG A;  4GQ7 A;  4GUL A;  4QPY A;  1GAN A;  4URT A;  1P8J A;  3U11 A;  2HEV F;  2YU1 A;  1OSG A;  4BQ1 A;  3ZX7 A;  4ITC A;  2OKX A;  3FBY A;  5FQ0 A;  3HVD A;  5IAX A;  2RE9 A;  1DYK A;  1H1I A;  4K3U A;  1QJZ A;  5A7V B;  1C8N A;  1SPP B;  3SH4 A;  1GR3 A;  5GM0 A;  3KSC A;  4BQY A;  1HV1 A;  4P9L A;  1UY1 A;  1EUU A;  1L7Q A;  3AFG A;  2GNB A;  3WG3 A;  5GLL A;  4HKO A;  2GC0 A;  4XMA A;  1PK6 A;  3DCQ A;  3DYP A;  2YUE A;  1LTE A;  4FPG A;  1UU5 A;  1YXW A;  3JZV A;  2R07 3;  5JI7 A;  3VV1 A;  4EN8 B;  5L7O A;  4AI0 A;  4DMI A;  3AKF A;  1F15 A;  2RHP A;  1NZC A;  4KQ7 A;  1OBN A;  1DQ6 A;  4ZXK A;  3LD8 A;  4Q4W 1;  4AHY A;  5FY9 A;  5JR2 A;  2NP0 A;  4GWM A;  3T2T A;  3ZOI A;  1ASJ 2;  1MPX A;  2R1B A;  2CU5 A;  3ACH A;  1XYN A;  1YI7 A;  3H7J A;  3PVN A;  4M01 A;  3USU B;  2VM9 A;  4E8D A;  4UDK A;  4Y4R A;  4LQR A;  3GNE A;  1W8W A;  5C4W C;  1AJO A;  4HK9 A;  4IGQ A;  1I5Z A;  3PUA A;  3SEP A;  3IMN A;  3TN9 2;  1R09 2;  5C4W B;  4Y1U A;  5A33 A;  2W91 A;  3PHM A;  5BNP A;  3B01 A;  4EJR A;  2ARC A;  5CFC B;  5C70 A;  4AQT A;  4NID A;  4KC7 A;  1UY4 A;  2ID4 A;  2QZ2 A;  3K51 A;  4K1Y A;  5FJK A;  4A44 A;  1TQ5 A;  3DPR C;  4LHN A;  4YVW A;  2XG3 A;  3QEF A;  1VMJ A;  5B6T A;  3POI A;  3THP A;  1IGO A;  3BN6 A;  1M06 G;  2LM3 A;  3UL2 A;  1WA4 A;  3H8O A;  3R67 A;  1VBB 1;  5IVV A;  4KL1 A;  1N1Y A;  4HBN A;  2P3I A;  1VBE 3;  2PHT A;  3GZU C;  4UAP A;  3T0A A;  1KJL A;  2HYK A;  1UIJ A;  2D5H A;  2VQ0 A;  3TNP B;  5AFE A;  2CWS A;  2Y8K A;  1QJX 3;  4AWD A;  3UES A;  2EIB A;  3BOD A;  4GZ9 A;  1OQD A;  2IXC A;  2VTX J;  1NQJ A;  2PYT A;  2RR1 3;  1NXM A;  3WN0 A;  1GZW A;  1PO2 2;  2WL1 A;  4LMF A;  4NPR A;  1RXF A;  4UFH A;  3ZYJ B;  3ZFF B;  5FP8 A;  1PIV 2;  2WS9 1;  3DKQ A;  3U4S A;  1CZT A;  4DO0 A;  3GZE A;  3OM6 A;  1NAE A;  3NV3 A;  1ZA4 A;  5CAD A;  2D6K A;  2EIC A;  3I2K A;  3S5A A;  1FNZ A;  1LNS A;  5L7O C;  2LTN A;  2VUD A;  2GMM A;  4OUL A;  3WX5 A;  4L2N A;  4K6B A;  5GLZ A;  5CG8 A;  2R04 2;  4FPH A;  4DPN A;  1ND2 B;  5HI0 A;  1VBC 3;  3ZIX A;  1PO1 3;  4AVS A;  1W6N B;  5FZ6 A;  5FYV A;  1QWR A;  4YZ1 A;  3OGG A;  3C7F A;  4HN1 A;  5F5Q A;  1IQA A;  1O6U A;  5F2S A;  3ZVX A;  5GLT A;  3S5Q A;  4CXX A;  1IG3 A;  2OPK A;  5FIX A;  3JD7 1;  2XQX A;  4DNY A;  1OOP C;  1RIR A;  1V9U 1;  2Y6F A;  3M3I A;  2DTW A;  4A2U A;  1A34 A;  3W9A A;  3X29 B;  5L9V A;  1PGL 2;  3ETP A;  1V6O A;  1W6M A;  4CCO A;  1J1L A;  2XLA A;  1V70 A;  4U6B A;  4QKB A;  1OOP B;  1VP6 A;  1MR5 A;  1JS9 A;  1LEN A;  3AVS A;  3FHQ A;  1TMF 3;  3H0O A;  2Y60 A;  4MET A;  1SCS A;  4M3C B;  4XF9 A;  1NCQ C;  1WMD A;  3KF5 A;  5F6K A;  4P9X A;  3LEK A;  2DDU A;  3WPV A;  4RR3 C;  3I3M A;  3MI8 A;  3Q9O A;  3USS A;  3OF1 A;  4NMI A;  4AQ6 A;  4COW A;  3A22 A;  2X8F A;  1U5X A;  4YG3 A;  1RED A;  3BOW A;  5DQ0 A;  4GWI A;  5LWB A;  2VE1 A;  3FLT A;  2PHX A;  3LFM A;  3LSE A;  4XBL A;  3GF6 A;  5D1I A;  3H3Z A;  2QQU A;  5HV0 A;  2ORZ A;  1J3Q A;  1VB4 A;  1KFU L;  3CBN A;  4FAH A;  2HWB 2;  3OBA A;  2R04 3;  5FAX A;  3H3U A;  2X5I B;  4XQ4 A;  4TZD A;  1ZZ8 A;  2Y6L A;  3VSS A;  1AJK A;  3NWK A;  4S2H A;  4YW5 A;  5CG9 A;  1J3P A;  3PVB B;  5FOJ B;  4CU6 A;  1MQT A;  4HET A;  4P5H A;  5T50 A;  2TBV A;  3LGR A;  3UJQ A;  4E2Q A;  1QGL A;  4PIX A;  5CIS A;  1G9B A;  2MEV 2;  5FMO L;  5J37 A;  3O1O A;  3VBF A;  2QUO A;  2Y0I A;  3N35 A;  5JVV A;  4GKY A;  2B4W A;  4TLG A;  2NPI A;  3O1S A;  3WG4 A;  1QQP 2;  2Y38 A;  4TXW A;  1GYD B;  4MH0 E;  2GN7 A;  3ZO0 B;  2O1Q A;  1NX9 A;  3ZYI B;  5T5O A;  3LAG A;  2VU9 A;  2UY9 A;  1UPI A;  2YBK A;  3KT4 A;  3QED A;  3ZXF A;  5F5A A;  3WUC A;  4UDK E;  2E32 A;  5H9Q A;  1JW6 A;  5A6X A;  4QX0 A;  3D0J A;  4BH9 A;  4NOT A;  5FPX A;  4LBK A;  3FHA A;  5A7Q A;  5JZG B;  3RWK X;  4C1X A;  3KV6 A;  4XZP A;  4XDQ A;  4HPK A;  3EJK A;  1COV 1;  5IW0 A;  3T09 A;  1QOS A;  2CTV A;  1W03 A;  2PA7 A;  3HPN A;  5EJ1 B;  4FXK B;  3THT A;  1E5R A;  1AR6 1;  5G05 L;  1RVF 1;  2VUC A;  3BPS A;  4LLO A;  1JBC A;  4RQP B;  4CP0 A;  2B46 X;  1V6K A;  5FJH A;  5FZ1 A;  3OEA A;  1DZQ A;  3BTA A;  1UO9 A;  4MXW B;  1WW7 A;  2R0H A;  4EZH A;  3AJY A;  3JUU A;  2W08 A;  5FPU A;  5C3O A;  5FXW A;  3Q8C A;  5A7N A;  2ZGN A;  4C0H A;  4CDW B;  4CCM A;  3KQR A;  4FBF A;  1VE0 A;  4BA6 A;  5A32 A;  1W9F A;  2IC1 A;  2XJP A;  4CU9 A;  4D7T A;  2K0G A;  2W3J A;  4LHL A;  3NJY A;  1R1A 2;  3OYW A;  2EXI A;  4FXG B;  1UZ0 A;  4GKX A;  5A1A A;  1VBC 1;  3E5X A;  3T2P A;  5FP9 A;  4XFF A;  4ZON A;  5JOX A;  3WNK A;  2CV6 A;  4A3X A;  3JBG 1;  3QOP A;  2X8T A;  5IVE A;  1BYH A;  2P1B A;  4Y3O A;  3I3D A;  4IE0 A;  3MPP G;  3OCP A;  5FBZ A;  5FXZ A;  4DOU A;  1CAX A;  1UNB A;  2XJT A;  2ZBJ A;  4WBB A;  1WMX A;  5F5I A;  4A41 A;  3A21 A;  3GJA A;  2SBA A;  3EYP A;  4NIG A;  1F4A A;  3VBR B;  1DZT A;  1ULO A;  3LPG A;  2O8O A;  2W9X A;  4DEQ A;  3JBG 3;  2R7E B;  1ZZC A;  2GNT A;  3BPZ A;  3ES1 A;  1TL2 A;  2VZV A;  4FQZ A;  1YEW A;  4XF4 A;  5DZF A;  4TSV A;  1OPO A;  3R4D B;  4Y1V A;  4HAN A;  1XU2 A;  5ACA 3;  3BUC A;  1XOY A;  4IV1 C;  1D2Q A;  2JG9 B;  4QB6 A;  1XYP A;  3D3A A;  5BY5 A;  2DYC A;  3QBQ A;  4QX5 A;  4IES A;  1LOC A;  3B9I A;  3VD4 A;  3I2J A;  1AR8 2;  1CAW A;  4FQ4 A;  2PLV 3;  2Q1M A;  4XFI A;  5FPV A;  5CKM A;  3O1T A;  1S0I A;  1AYN 3;  2JE7 A;  2VL4 A;  4XJ8 A;  5GZC A;  1UYP A;  2RS5 2;  3AYD A;  1UWW A;  1J59 A;  2XHN A;  1RUG 2;  4A7K A;  3WN2 A;  4NHY A;  2PQS A;  3VBO C;  1IHM A;  4FFG A;  2OPW A;  5FO7 B;  2OX0 A;  1ZYB A;  2D93 A;  3AFK A;  2VMC A;  4NO4 A;  1MZF A;  1R08 3;  5A80 A;  1FT9 A;  2WO3 A;  1NKG A;  3GYD A;  1LES A;  1PK6 C;  4RHV 1;  3TBD A;  5IVB A;  4QDS A;  2QTW B;  4Y1Z A;  4NRP A;  4XFG A;  4Y5Z 0;  4COT A;  2WNU C;  1YIF A;  2Y6G A;  4I0B A;  4Q4V 2;  4E2S A;  5DN2 A;  5AYE A;  4JV4 A;  3ZXK A;  3V0B A;  4MGS A;  3RI9 A;  3W59 A;  3NJZ A;  1BBT 1;  1K45 A;  2H0V A;  1MS9 A;  5DUU A;  5H9S A;  4GMP 1;  5G04 L;  1NCR A;  4BQX A;  3AKQ A;  3O14 A;  3I3B A;  4G9S B;  4OQ9 A;  3JU9 A;  3RYK A;  1AR7 1;  2IFR A;  3TYJ A;  3OSD A;  1HX6 A;  4PQ9 A;  1XYO A;  5J36 A;  3VHP A;  4JDO A;  3ZXL A;  5HXM A;  4DUW A;  1IPK A;  5T5J A;  4BQ4 A;  5GLM A;  3T4V A;  4HT1 T;  4YVW C;  4NVP A;  3FL7 A;  4FPE A;  3VL8 A;  4LHK A;  1EPW A;  2BP6 A;  4OLL A;  3ZFE A;  4FOY A;  3S7I A;  5GZF A;  1CR7 A;  2LUW A;  3JB4 C;  4JZR A;  5LRR A;  1FMD 1;  4QXH A;  3VDD A;  5F5C A;  4EE2 A;  4DXZ A;  2D43 A;  5A6Z A;  4ZU5 A;  4XXP A;  1EAH 1;  2WYS A;  3LA3 A;  1N3Q A;  4PDW B;  2QKD A;  1UF2 C;  1HXS 2;  2YMZ A;  3LOB A;  3VZO A;  5CEH A;  1YO8 A;  2RDN A;  2YY1 A;  4R9A A;  4LO7 A;  5F9T A;  1A8D A;  4DEV A;  3PTR B;  2RJK A;  1ODN A;  4IV3 C;  4ONU A;  4H14 A;  3DXT A;  1XC6 A;  2W0X A;  1MS5 A;  2GND A;  2BTV C;  3OM7 A;  4WM7 C;  3H3L A;  3N9Q A;  4M0H A;  3ZXD A;  5DZG A;  2JKX A;  3OJB A;  4IEU A;  1WME A;  3VBO B;  4Q4W 2;  1TEI A;  2CAV A;  5LK5 A;  2FCT A;  4BQ5 A;  2RM2 1;  5ANQ A;  5DMY A;  1YFU A;  1URX A;  2FMY A;  4K21 A;  3KT7 A;  3RYP A;  5FMB A;  4I3G A;  3DEM A;  1RUC 2;  3ZYB A;  4YW4 A;  3KVA A;  1HIX A;  1AX0 A;  4QMA A;  4Q5O A;  4RN5 A;  4Q4X 1;  2P5B A;  2ZGK A;  1KS4 A;  2HWE 3;  3QC2 A;  2P6H A;  4CXW A;  5IAT A;  1AR8 3;  2VMI A;  4QDQ A;  4UBH A;  2XVG A;  4OMC A;  2ADD A;  5FZI A;  2ERF A;  2F4P A;  5L7O B;  2NYY A;  1YFY A;  3K3O A;  2QQL A;  3W5M A;  1AR9 1;  1JOJ A;  3HEI A;  2W52 A;  3J7M A;  4OHW A;  3VBR C;  4M4P A;  3I97 A;  4W6Y A;  1Q5O A;  1RUC 3;  5DDJ 3;  2UWB A;  4CDX C;  2PHU A;  5FY5 A;  1OMI A;  1GP5 A;  4FFF A;  1SEF A;  4LXL A;  5LBF A;  1OHF A;  2CY6 A;  1ZRI A;  4K9S A;  1YFW A;  1W2T A;  3PTY A;  5FZL A;  4A4A A;  5I0R A;  1RUG 1;  2A1X A;  2B39 A;  4ZS2 A;  2PLV 2;  3PNA A;  4QT6 A;  5AC9 2;  2A6X A;  5FZ9 A;  1O4T A;  1VB2 A;  2HWE 1;  1GLH A;  2CDO A;  4O61 A;  4XIL A;  3ZKY A;  1W6Q B;  2GP5 A;  1SDD B;  1X33 A;  3OD0 A;  1C57 A;  1X36 A;  5LB6 A;  2J1S A;  3WXP A;  5A1L A;  4KCA A;  2GH8 A;  4KWU A;  2WAA A;  4IEV A;  3WY6 A;  1QH7 A;  2A70 A;  1WCS A;  2I45 A;  1W3V A;  1WMF A;  5HV4 A;  1SLB A;  1V00 A;  3ECQ A;  5FZO B;  3LB9 A;  3WR0 A;  4JRA A;  3J7H A;  1C1F A;  3OUJ A;  4N7I A;  1CIW A;  2JDM A;  2WWU A;  5F8P A;  3K1U A;  4WM8 C;  5KC6 A;  3KVB A;  4DZG A;  5JPN B;  3AKI A;  4JCK A;  1RUE 1;  1MEC 3;  2CHH A;  3K75 B;  3UKN A;  1PMH X;  2W39 A;  5FZ8 A;  2VAU A;  2JG8 A;  3BVC A;  4QX2 A;  3OB8 A;  3I2I A;  4JHZ A;  4Q4Y 1;  2A6Z A;  1AL2 2;  2FZ1 A;  3ZSJ A;  5FV3 A;  1EAH 3;  4AGV A;  5GLQ A;  4P00 B;  2QQI A;  1TME 3;  4CCC A;  4Y20 A;  3GBF A;  4WVW A;  5FP3 A;  1QXR A;  2ZGT A;  2HWC 1;  4ISQ A;  2DV9 A;  2E9Q A;  4S2D A;  2YPJ A;  4D6R A;  4ERO A;  5I0T A;  2H6C A;  3UGF A;  2ZGP A;  1JZ4 A;  4N2R A;  1NZI A;  1E5I A;  1RJ7 A;  3RGB A;  4HMZ A;  2V5D A;  3MO4 A;  4XHX A;  1LGN A;  4MG2 A;  2C26 A;  1R09 1;  1HW5 A;  3AP7 A;  2BNM A;  4LO8 A;  1DHK B;  3AZX A;  1XBF A;  2HWF 1;  2HBT A;  3B00 A;  3ZFG C;  1ZRE A;  1FNY A;  5F39 A;  1W6M B;  4V1P A;  3ACI A;  5CIR A;  1X9P A;  3WW3 A;  3FZ3 A;  2C9A A;  3K4Z A;  1YQ8 A;  2VMH A;  3M3Q A;  2XKP A;  3QAC A;  4IEW A;  4PF1 A;  3J26 N;  2VH9 A;  3VBU C;  4LA2 A;  2VZS A;  4HVQ A;  4YZ3 A;  2VBB A;  3U75 A;  5IK5 A;  2VZ1 A;  3C7E A;  3K77 A;  1W6O A;  3CZU A;  2PN5 A;  1SZB A;  4WV8 A;  4YVS A;  4LA3 A;  3WF3 A;  3ZPY A;  2D3P A;  4BQW A;  4I02 A;  1LJ7 A;  5CA6 A;  1WCQ A;  1UCX A;  2VXJ A;  3JBG 2;  3VSZ A;  3HBZ A;  4NIA A;  1R1Z A;  2ZX1 A;  1NCQ B;  3ZYR A;  2FDI A;  1VBA 1;  5DAP A;  4CSW A;  3I3Q A;  4OYU A;  2UUR A;  3RNS A;  4AVA A;  2XQR A;  3AKG A;  4NHM A;  4JTO A;  1F5J A;  3AYA A;  3JCI A;  2OVU A;  4K1Z A;  3WDX A;  2X5I A;  1J84 A;  3CNA A;  4LBL A;  3VZJ A;  3FJS A;  4FVV A;  4C1W A;  1JYV A;  5EYY A;  1D4M 1;  2CDP A;  4OZX A;  2WNO A;  4XJZ A;  1DGW X;  1W9W A;  4AI1 A;  4UDG A;  2DTY A;  2E7T A;  1O3Q A;  1YJL A;  1K5J A;  2IXK A;  2SLI A;  4IW3 A;  4LKD A;  2Q8E A;  2XPJ A;  1N47 A;  1NCR C;  3C7G A;  3TN9 3;  1FV3 A;  4AW7 A;  3PVO A;  1TE1 B;  1WBF A;  1NLR A;  2YBP A;  2ZGL A;  4RSU A;  1LHV A;  3V65 A;  3VHN A;  5H9R A;  3T3Y A;  2H6B A;  4YGE A;  1AYM 2;  1DQ5 A;  2C9K A;  5I8Y A;  3AC0 A;  3OOX A;  5GLP A;  3O0V A;  5HCB A;  3BU0 A;  2PFW A;  1W8F A;  1OUR A;  1UOB A;  4ASK A;  4Z2A A;  1TMF 2;  4AI2 A;  5BV6 A;  2VNV A;  3DGT A;  1ZRF A;  5FZ3 A;  4S2F A;  3QH7 A;  4B3N A;  1YQC A;  2WT2 A;  2H0B A;  1QKQ A;  5LCW L;  5AYD A;  2RS1 1;  1HJF A;  5FZ0 A;  1SBF A;  1RUO A;  2V72 A;  2W47 A;  4I30 A;  4ZY9 A;  3AKT A;  3GXU A;  1YNA A;  3HT1 A;  2OYZ A;  1UL9 A;  4CCL A;  4IEZ A;  4LBQ A;  2MEV 1;  4YFZ A;  4IV3 A;  3WNN A;  1YRZ A;  3ZSM A;  4COU A;  1WBL A;  4BLI A;  2YFZ A;  4CDU B;  3KWV A;  2GNM A;  5JOY A;  1F4H A;  2HKX A;  4NN0 A;  5EZW A;  4L0P A;  4MGY E;  3T2Q A;  1QOO A;  2YGL A;  1RUD 2;  2RJL A;  4QPI B;  5FOB B;  5A32 B;  3AMM A;  2WRA A;  3NNG A;  4GAZ A;  5ANN A;  4E9K A;  5ISL A;  4FAG A;  1Q43 A;  1DQ2 A;  2MEV 3;  1DLC A;  3PUS A;  3EO6 A;  2BNO A;  1LU2 A;  1GWM A;  5C9A C;  1JYX A;  4BK5 A;  2WSV A;  3OUH A;  2G9F A;  4GAL A;  4AI9 A;  1PM4 A;  2X5I C;  4LOS A;  5ABJ C;  5BNP C;  4E2G A;  2HWE 2;  2Q1Z B;  2FDH A;  4YG0 A;  4DRR A;  4Z2W A;  3BB6 A;  3A0N A;  3IT8 A;  1IS4 A;  2WDB A;  3GHM A;  3HAG A;  3MYX A;  4FPY A;  5BNN A;  1W8N A;  3UGH A;  1GIC A;  1HRI 2;  4OUM A;  5DXD A;  4YW7 A;  1H4H A;  5JLV A;  4DRV A;  2EAK A;  4HVO A;  2JX9 A;  4M4R A;  1CAX B;  3M7A A;  5BNO A;  3PMS A;  4XUO A;  1RMU 1;  3VDA A;  4I3P A;  3LEM A;  4PIZ A;  2ATF A;  4LKS A;  4RA0 A;  5FWE A;  4GJZ A;  1JYN A;  5GZE A;  2UWA A;  3FN9 A;  2P17 A;  1GYH A;  2XR4 A;  3DF0 A;  1UOF A;  2ZKN A;  3HBK A;  4CRQ A;  1CPN A;  5JSO A;  4XZU G;  4ORF A;  4XW3 A;  1RB8 G;  2BDR A;  3PLQ A;  3SMH A;  2UY8 A;  1NA1 B;  1JOP A;  5FZA A;  4GB3 1;  2L9L A;  4NRQ A;  4NJ4 A;  2A6V A;  1DQ0 A;  3U4X A;  4J1X A;  3PME A;  3IDA A;  1RUI 3;  3N9O A;  2Q8C A;  5C3Q A;  2W5F A;  4WVM A;  5JUV A;  4X8N A;  3PUH A;  1VBA 3;  1KIT A;  1PGW 1;  4LBQ D;  3POF A;  5AC9 1;  4BWO A;  1RUF 1;  4C90 A;  4CP1 A;  5ABJ A;  3LWC A;  3MUZ 1;  1XNC A;  3H8U A;  5LA0 A;  5I91 A;  2KR2 A;  3KHB A;  1WUV A;  1ND3 A;  2D44 A;  4D8M A;  2A7A A;  3OGJ A;  3SXW A;  3AKH A;  3V56 A;  1C4R A;  2Y6K A;  4MZU A;  3W21 A;  5A3M A;  5AVP A;  1YHF A;  1VKD A;  4JHT A;  4FO9 A;  3AKP A;  4DUX A;  4RFR B;  4B4R A;  3ZR6 A;  4CVU A;  1NCQ A;  3H50 A;  3J8F 3;  4LO5 B;  2VMD A;  2BGC A;  3VD7 A;  1S0F A;  4UFJ A;  1ZRR A;  3WCS A;  2UYB A;  3T2O A;  4QX7 A;  3ZIW A;  3B9C A;  2QQP A;  1XU1 A;  1BEV 1;  3B69 A;  1HV0 A;  1T2X A;  2AAC A;  2YPD A;  3N9N A;  3R05 A;  4MGQ A;  2VMF A;  2XLF A;  4B4P A;  3QD6 A;  4IEP A;  4NWW A;  3WF4 A;  4DB5 A;  4SLI A;  4CU8 A;  1KFX L;  4BCU A;  2A6Y A;  1TME 1;  5C7G A;  3MLJ A;  1QMJ A;  1MS8 A;  1HRV 2;  2WLP A;  5JI9 A;  2XJS A;  1H2K A;  4BM8 A;  1X50 A;  3D82 A;  1LU1 A;  4NAM A;  2YFR A;  4IE5 A;  4AFB A;  5FWJ A;  3NNM A;  5I0D A;  2ZAA A;  1XE0 A;  2UWC A;  3B94 A;  5FK7 A;  1RHI 2;  4CP2 A;  3O0W A;  5DG1 A;  3VDD B;  4XYX A;  3EB7 A;  4BXS V;  4IND A;  2YC4 A;  1WW6 A;  2CGO A;  3C3V A;  4WM8 A;  4YW6 A;  2VVE A;  4IQP A;  4PDW A;  3KGL A;  4D0Q A;  1AZD A;  1X7N A;  1W0P A;  4XUQ A;  3DXU A;  5FP7 A;  4D7S A;  2RR1 1;  5B2G B;  1HDK A;  2QQO A;  3POE A;  5IUQ A;  3F95 A;  2YC0 A;  1B35 B;  4LHS A;  4LIU A;  4CDQ A;  1U0A A;  2OUH A;  1LOE A;  3AL5 A;  3LSD A;  4MGT A;  1I3H A;  3J7N A;  2VBD A;  1PIV 1;  1HB1 A;  1XXN A;  3AMP A;  4Q8L A;  3BYJ A;  4ATF A;  3RVH A;  1JOD A;  1S0G A;  2YZ4 A;  3M3C A;  1YYN A;  3HQU A;  5L9B A;  1PGS A;  3WPZ A;  4LE3 A;  4O9E A;  3W5N A;  3ZN6 A;  1D0G A;  1T6B X;  4A7Y A;  1OUX A;  1RIT A;  2VUA A;  3ABZ A;  5J48 A;  5A3P A;  3T0B A;  1GOF A;  4XUN A;  4CDU A;  3PUI A;  2J42 A;  4CDX B;  4EWD A;  5BPX A;  1Y9G A;  1POV 3;  1H2L A;  3MW3 A;  2V5Y A;  1BEV 2;  3WPU A;  4RFT 0;  5DAB A;  4AED A;  3FMG A;  2XLG A;  2BFU L;  4AK6 A;  5K0U C;  5K7P A;  2AEN A;  4AQ2 A;  3BYL A;  4RYD A;  4BK4 A;  4WM7 A;  4R4X A;  3MBW A;  4UT5 A;  1CAV A;  2BYV E;  2VXR A;  2BRT A;  3U1X A;  5LRS A;  3E1F 1;  5C0P A;  5KHK A;  3SHR A;  1RIN A;  3WDV A;  2WNE A;  4JQR A;  1ENS A;  4ES9 A;  3WQB A;  2IUW A;  2WZ8 A;  4YW2 A;  4FTS A;  1SHW B;  5LBE A;  1AYM 3;  1GOG A;  1XJA A;  1IPJ A;  2PAE A;  4XE9 A;  2FDK A;  2Z5W A;  1UYX A;  3CO2 A;  1GYK A;  4FPF A;  1FPN 2;  4QXK A;  1HB2 A;  5FTT C;  4KMQ A;  1TG7 A;  2YC2 A;  3HNM A;  5FZ4 A;  2VW0 A;  4IV1 B;  3VL9 A;  2ET7 A;  1UXZ A;  3ZMN A;  2FHR A;  1BQP A;  1PMI A;  2D6O X;  1WD4 A;  3MIF A;  4TLF A;  2DF7 A;  4X6R B;  1ND2 C;  3WW2 A;  1LGB A;  1OLR A;  1ENQ A;  1EV1 3;  1FMD 3;  1GWL A;  1G9F A;  1UZY A;  1K3I A;  2OS2 A;  3GZT B;  3ZN5 A;  4PLN A;  3O1U A;  1CAU A;  4Y5S A;  2RS3 3;  5A7S A;  2X8K A;  1JMU B;  1BEV 3;  5FY4 A;  3IAP A;  3D5O A;  1TZO A;  2P37 A;  3IAQ A;  2VEC A;  3QCW A;  2VJX A;  4V2V A;  3S7E A;  1E5S A;  1JU3 A;  4PHZ A;  4YM3 A;  4PVI A;  4MHU A;  4QKN A;  3J8F 1;  4HK8 A;  1EP0 A;  3UET A;  2VME A;  2ZTN A;  1VLN A;  3EXU A;  3NO8 A;  4OMD A;  4E4D X;  4B7K A;  1CWP A;  1UMI A;  1OI6 A;  3CJI A;  1C1L A;  3MFA A;  3M3E A;  1LOF C;  2RG4 A;  4LT5 A;  2JIJ A;  4GA9 A;  1BHG A;  2WWS A;  2G9Z A;  5C5U A;  5FZC A;  3OEB A;  2EXH A;  2WAO A;  1MAC A;  2WO2 A;  1GP4 A;  3KGZ A;  4I0W B;  1BK1 A;  2JB4 A;  4Y24 A;  4QB2 A;  2R6Q A;  4LNV A;  1R09 3;  4P9W A;  3TNQ A;  4UFI A;  1H4G A;  1KRI A;  1SBD A;  2XUM A;  2A71 A;  1AX1 A;  4MGZ E;  2P3Y A;  4BME A;  4X8P A;  4IEQ A;  5A70 A;  4O9G A;  5F32 A;  1UZZ A;  5FZ7 A;  3PVE A;  1VRH 1;  2A5Z A;  2CYF A;  4Q2F A;  4IER A;  2WNU A;  4CA9 A;  1LHO A;  4FPC A;  4W4Z A;  3ROU A;  1AL2 1;  3JQW A;  3OTF A;  3HIF A;  3WVJ A;  2HWC 3;  4AXO A;  4LBO A;  2BW8 A;  3VBS C;  2NQY A;  2G4I A;  5C2M A;  3NMB A;  1NYW A;  4QXC A;  3VBH B;  1GV9 A;  5DAW A;  3SCG A;  1YUD A;  1SBE A;  5FPL A;  2VDT A;  4NHK A;  2WWJ A;  4NRO A;  1L7L A;  1RJ8 A;  2NLR A;  4QX8 A;  1FPN 1;  1GZC A;  3MDP A;  1JZ6 A;  3BIE A;  4XAB A;  3ZXA C;  4NPM A;  4RHV 3;  4BMB A;  3WNM A;  1O3S A;  4OI2 A;  4YGB A;  3I59 B;  2BQP A;  2QVS B;  1MEC 1;  4JGZ A;  3TAY A;  4GJY A;  4AYU A;  3U07 A;  1R08 1;  3VBH C;  4UFM A;  3ATG A;  5DZE A;  3J8F 2;  1AVB A;  1ZBA 2;  5ACA 1;  1SQ4 A;  1OYG A;  1YIP A;  3N7K A;  1W9S A;  3K48 A;  4PLO A;  4WM8 B;  3MIB A;  5CYY A;  5LEK A;  3C7O A;  3U0Z A;  5E89 A;  1FXZ A;  3SH3 A;  5B4N A;  2JG9 C;  5DUX A;  1FV2 A;  2BOJ A;  4CDQ B;  2ARE A;  1DQ1 A;  5JMO A;  2JIC A;  4LKE A;  5A8C A;  1NQD A;  1UN1 A;  2VOV A;  1DP0 A;  5FYH A;  4BLJ A;  2YBS A;  3BI3 A;  1AR7 2;  4GH4 C;  5FYB A;  3RQ0 A;  3AX4 A;  2VTX A;  3BTY A;  2JDP A;  1ULP A;  1YWK A;  3WSO A;  4OQ8 A;  4XJU A;  1LEM A;  2PHD A;  3RZM A;  3E5Q A;  4RQP A;  4AK3 A;  1K5M B;  3BKZ A;  5FQ0 B;  5ERL A;  1SFN A;  3ZYP A;  1Q8P A;  2ZMK A;  3ZSL A;  4D94 A;  2Q5T A;  4CDW A;  3AYE A;  4XPV A;  3WMY A;  2EXJ A;  4HKW A;  5JXG A;  2P2K A;  3OGR A;  2BGP A;  5DAX A;  3EHK A;  3OYW B;  2WNV A;  4LOR A;  2XVK A;  4IL7 A;  4JGZ C;  3N4M A;  2E26 A;  3POJ A;  1SLL A;  3LV4 A;  4U2A A;  2JEM A;  4Q4X 3;  4WM7 B;  2GU9 A;  1V6L A;  3MV1 1;  4QQO A;  3LA2 A;  4R52 A;  3FUQ A;  3VKN A;  2XDV A;  4U36 A;  3Q8F A;  4ZKT B;  4XET A;  4IV3 B;  1XSR A;  3MPB A;  3FBM A;  2VMG A;  3USU A;  5C8C C;  1RMU 2;  1WA6 X;  1RVF 2;  3WP6 A;  4A6S A;  5CBL A;  3NQH A;  1G9A A;  3VBR A;  4XJ9 A;  1AF9 A;  4UF0 B;  2XBO 1;  4HFS A;  3LOI A;  2RDQ A;  1I1E A;  3BTZ A;  2BBV A;  2B42 B;  2HWF 2;  2ZML A;  5E16 A;  5C4W A;  1JZ2 A;  4GXL A;  2XJU A;  1AR6 3;  5BNP B;  2DVB A;  1N3P A;  1AXY A;  2BUK A;  3AP5 A;  4HVR A;  1YQ2 A;  1GBG A;  3Q8B A;  1EV1 2;  3BYN A;  2JG9 A;  3WAT A;  1CJP A;  1ZM1 A;  4YVW B;  4UW5 A;  4C0B A;  2ZGR A;  5ACA 2;  4NWV A;  1S55 A;  3J7L A;  2ZX3 A;  1AL2 3;  5I8T A;  5EP9 A;  1LUL A;  4XXA A;  1CAW B;  2JDA A;  5BNN B;  4O8N A;  4YNI A;  3QLQ A;  1W8H A;  5A1F A;  2DVA A;  4MO3 M;  4Q0V A;  1AL0 G;  4LIV A;  4A7Z A;  5GLK A;  5FUI A;  5JIA A;  5T3N A;  3K46 A;  4QKD A;  4G3Y C;  3RMX A;  4Z07 A;  4EWA A;  5FYZ A;  3MIH A;  2ZHN A;  1RUH 1;  3VKL A;  2Y26 A;  4HKL A;  5FYI A;  3CJI B;  4AL9 A;  4NHL A;  2B8M A;  4YYO A;  3ZN4 A;  4AVT A;  2AH2 A;  1JHN A;  1H8T B;  4TN7 A;  1H8T C;  5KR7 A;  2D6N A;  1XE7 A;  1XQN A;  5C9A A;  2WJS A;  1O8S A;  1PNG A;  3IIA A;  4HSL A;  4UYB A;  2QFE A;  3RWN A;  2HWB 1;  4CEY B;  4U6D A;  1H9P A;  5D8A C;  4HG6 B;  3VDB A;  1O4Z A;  3M4F A;  1R1A 3;  3KV4 A;  2HWF 3;  4N9I A;  1G86 A;  2XUE A;  2Z2S B;  4HON A;  1ND2 A;  1US3 A;  3MHZ A;  2R04 1;  4Q4Y 3;  3RFR A;  3WW1 A;  1IG0 A;  1DG6 A;  3KHC A;  1Z0H A;  2GSY A;  2VC9 A;  2ZOE B;  4WVM B;  3WHU A;  3D6E A;  4GB3 2;  3WUD A;  2JDK A;  1RUE 3;  2W1S A;  4IE7 A;  2QQV A;  2CAU A;  4LJH A;  2VOX A;  2WYF A;  3JD7 3;  4AGG A;  1XNT A;  1NCR B;  4HL0 A;  2WFF 3;  2ZAB A;  2ZA9 A;  1WLD A;  3ZYG A;  1GZT A;  4AF9 A;  1MZE A;  1PO2 1;  3BOP A;  1UU6 A;  4PBP A;  4NOV A;  2VOW A;  2J1A A;  3CZJ A;  2XBO 2;  1Y9M A;  4QX1 A;  2ZS6 B;  1PO1 1;  1D4M 2;  5F3C A;  1QJY 3;  1H1M A;  1OOP A;  2VQU A;  3CJX A;  3S0M A;  3ALQ A;  2P6C A;  1RUF 2;  5KHI A;  2I74 A;  3CU7 A;  4P02 B;  1OF4 A;  1Q3E A;  1XND A;  2XON A;  2QQJ A;  2W68 A;  5A3T A;  1K42 A;  2WA3 A;  1M4W A;  1Q8V A;  3VSR A;  5C8C B;  2WS9 3;  3UKV A;  5KWR A;  2WZP P;  4H55 A;  5BNQ A;  5J09 A;  3HMY A;  1F31 A;  2WII B;  1H2M A;  1NY7 2;  1VBD 3;  4YVS C;  5GLO A;  4AFC A;  5GZG A;  3NKG A;  1RUD 1;  1Y4W A;  1OKQ A;  2EVX A;  4RL7 A;  4LIT A;  2IFW A;  4XFH A;  2ADE A;  2C24 A;  5GLN A;  1O91 A;  4PF5 A;  5KXC A;  1F8V A;  4D47 A;  5IFT A;  1DFQ A;  1RUC 1;  4CUB A;  3NL1 A;  1BVV A;  3LDR A;  1VBE 1;  4BQ2 A;  2D5F A;  2R0F A;  1AR9 3;  1LB2 A;  1QU0 A;  3AZZ A;  1EUT A;  2BV4 A;  1RUD 3;  1ZVF A;  2GP3 A;  3LCP A;  3OY8 B;  4N90 A;  1NT0 A;  4QU2 A;  2KM2 A;  3O7O A;  4FCA A;  4L92 A;  3SEE A;  3MW2 A;  1E5H A;  2ARA A;  2W1U A;  2JKB A;  1OLM A;  3ORJ A;  5DAV A;  1LOB A;  3QH6 A;  4Q0P A;  5EV7 A;  3D60 A;  4LBN A;  5T5P A;  5LK7 B;  3IBM A;  1SFY A;  3SNM A;  4CZS A;  1H30 A;  1XNA A;  1D0H A;  2C1F A;  5FZM A;  4QHO A;  2BVB A;  3OPZ A;  4EV0 A;  1ZX5 A;  3LZZ A;  1N1T A;  2NM1 A;  3W58 A;  3U37 A;  4TYS A;  4B1M A;  1CZV A;  4UW4 A;  1EAH 2;  1ZBE 3;  2E7Q A;  1GQH A;  2WZE A;  4XIK A;  3LDB A;  1RL3 A;  2ZCW A;  4QD2 A;  3NST A;  4NRM A;  1VBD 1;  1MS3 A;  1ZBA 1;  4HXC A;  3ZFG A;  4CEW B;  3O12 A;  5CFD C;  1HQW A;  2LW8 A;  3HWJ A;  5LBC A;  4CCN A;  4CE8 A;  2DFB A;  1MEC 2;  3I4I A;  1JN2 P;  3O1M A;  1CQ9 A;  3ZN6 B;  2AR6 A;  2WZR 1;  3K4A A;  3SIT A;  2CL2 A;  3R4U A;  1U12 A;  1RVF 3;  3IWZ A;  1S0J A;  1WCD J;  1RUI 2;  4XBQ A;  2V73 A;  2BVV A;  1H2N A;  3TB0 A;  5LW9 A;  1ULG A;  4B7E A;  2K9Z A;  1UZV A;  4ZZ8 A;  2Y0O A;  4CUA A;  2WIN B;  5DG2 A;  4QAW A;  1PM7 A;  2CGN A;  1S2K A;  2XB6 C;  5LA9 A;  4DY5 A;  1GQP A;  2HEY F;  2VW2 A;  4EWE A;  2B4K A;  2X05 A;  1C8M 3;  1JYT A;  4PIY A;  2Z4F A;  3S57 A;  3UYJ A;  1RHI 1;  3NNL A;  3E5U A;  1DGR N;  4XTP A;  3LEG A;  2N7G A;  5CVR A;  1J1T A;  2P34 A;  1B09 A;  5APA A;  3WF1 A;  4A42 A;  4K8R B;  1AXZ A;  2AGS A;  5AYC A;  2GN3 A;  2OXB A;  1SMV A;  4JDM A;  3CEW A;  2HWD 2;  2PAK A;  2F17 A;  1LEC A;  4UW6 A;  1WLT A;  2VOT A;  4MLO A;  1VBE 2;  1R64 A;  4NHX A;  1VBB 2;  3VZK A;  5EXO A;  1UKG A;  2IVJ A;  1UYY A;  3KLS A;  2RS3 2;  4BIO A;  2JDY A;  1ZRD A;  4Q27 A;  5IVC A;  2G9G A;  4QQP A;  4RR3 B;  5BNN C;  5K0U A;  3VT2 A;  3PIG A;  1ULF A;  2ZGO A;  1RTV A;  2AC1 A;  4BOW A;  5HBA A;  5FLH A;  4JQT A;  4KMI A;  4OI1 A;  2RS5 1;  2RS1 2;  4Y20 B;  3WDY A;  5JAX A;  1BJQ A;  4XAC A;  5A6Y A;  2C6S A;  1GMM A;  1DYO A;  1POQ A;  1UMZ A;  3WNL A;  4N1I A;  5FY8 A;  5CB7 A;  4RS5 B;  3I2D A;  1W90 A;  3ZSE A;  5IVY A;  2XL9 A;  4FPK A;  5I93 A;  2DCZ A;  2QNK A;  1O7F A;  4TWT A;  5F1R A;  1DQ4 A;  3AM2 A;  3OD4 A;  4I0A A;  1AYM 1;  5A3O A;  4GB3 3;  1D7P M;  2Q30 A;  5JDB A;  5K8S A;  4AVV A;  1MZ6 A;  2W95 A;  4LO6 B;  4KGQ A;  5FMC A;  5FRA A;  4Y4Y A;  2DVD A;  5J1X A;  1AYN 1;  1UYZ A;  2JIG A;  5IJR A;  2B9V A;  4AOC A;  3KS7 A;  5FP4 A;  3VDC A;  3MW4 A;  1U5Y A;  2W2I A;  1VIW B;  4AFA A;  4CPB A;  1D4V B;  2A73 B;  2VW1 A;  3FUO A;  4L8Q A;  1QJU 2;  4PLM A;  4XEZ A;  2ZKL A;  3IN9 A;  4PCR A;  3FFQ A;  2O14 A;  1IQD C;  2VCA A;  4P14 A;  4Y1Y A;  3VD5 A;  3WNX A;  1C3H A;  5FYS A;  3VKM A;  3ZYH A;  3V0A B;  2X8S A;  1TVG A;  4ASM B;  3WLU A;  3WN1 A;  1VAM A;  4FP3 A;  1QDC A;  2TNF A;  2VCC A;  4JC1 A;  4D6Q A;  4DXR A;  5C8C A;  5JPM B;  4HZF A;  5C5T A;  5EIY B;  1IOA A;  4JDN A;  1IS3 A;  3GBG A;  4QDR A;  1K5M C;  2PLV 1;  3SQO A;  4ZU4 A;  4JAA A;  1ND3 C;  1O4Y A;  3S6P A;  3VD3 A;  3WEZ A;  1KGY A;  1RUN A;  2E51 A;  4N43 A;  1JTZ X;  2Y6J A;  1Z78 A;  3BU7 A;  4ZU7 A;  5E6H A;  4GH4 B;  1W8O A;  1OD5 A;  2RS1 3;  1Y3T A;  4IEY A;  3AP4 A;  4NII A;  4W6W A;  1GNY A;  4XF1 A;  3U14 A;  3T1M A;  2ZZQ A;  1PIV 3;  5D8A B;  5FCC A;  1S0C A;  1SLA A;  3AP6 A;  1W04 A;  1QNY A;  3IMM A;  3OY8 A;  3RJR A;  1HRI 1;  4YPJ A;  5D21 A;  2IWG B;  2GC2 A;  3ZFE B;  5C6C A;  3THD A;  5HXV A;  4FTE A;  1REF A;  4XDP A;  2GAL A;  4JVA A;  1HXS 1;  1S2B A;  4KWL A;  3VDD C;  4L97 A;  4A6O A;  3D5Z A;  2LAL A;  4D69 A;  3WDT A;  3A23 A;  2PHF A;  2G1M A;  2PMW B;  4I01 A;  1JZ8 A;  4MYE A;  5A3N A;  2ZGM A;  2ILM A;  2YGM A;  2VR4 A;  5I8S A;  5FLW A;  4BDV B;  1SCR A;  2DU0 A;  1PK6 B;  5C3P A;  1EY2 A;  1QJY 1;  2UU8 A;  2J1E A;  1NLS A;  1CX1 A;  1KJR A;  1GP6 A;  1JZ3 A;  3DPR B;  1ULE A;  1COV 3;  4E4Z A;  1S4C A;  1VRB A;  5K9Y A;  3PU8 A;  3AVR A;  1HLC A;  4XC9 A;  4ZHN A;  2WFF 1;  4AVB A;  3LQC A;  1UX7 A;  4J1W A;  1OD3 A;  4N8M A;  3TEY A;  3I49 A;  3IPV B;  2O0O A;  1VRH 3;  1K5M A;  4PI2 A;  5J3U A;  1WLW A;  1HQL A;  1RUJ 3;  4UBG A;  2VD7 A;  1HJG A;  5CU1 A;  1W0O A;  4AK5 A;  3O1V A;  3WPY A;  3SCF A;  4Q4W 3;  3KZ4 C;  4UFK A;  3ACG A;  1Q56 A;  3E6D A;  4L9B A;  3MZH A;  1CD3 G;  4WZC A;  2VNO A;  2FCU A;  5FZD A;  1ZZB A;  1JH5 A;  2WO1 A;  3AK0 A;  2GH2 A;  3ILR A;  4DUV A;  3E6C C;  4AED C;  2WQ8 A;  3H9A A;  1ST8 A;  1KD7 A;  2LRP A;  2BPA 2;  4ZS3 A;  1ZBE 2;  1N1S A;  4IGO A;  5JWP A;  3OPW A;  1U5I A;  2XL7 A;  5L9R A;  3AJZ A;  4N4B A;  3JXS A;  3NNF A;  2DBI A;  1CJD A;  1H0B A;  1W0N A;  4XFA A;  5E88 A;  4ZXE A;  3R4Z A;  1UW8 A;  2B5H A;  3WG2 A;  1N3O A;  5CFD A;  4OUE A;  3WQ0 A;  3DN7 A;  3SH5 A;  4KGG A;  4MAD A;  4NAO A;  3A0K A;  3H1W A;  3ILF A;  1V0A A;  2GC1 A;  3UK9 A;  3UNP A;  3NRU A;  5T55 A;  5FY1 A;  1XNK A;  5B4X A;  3RMY A;  3I54 A;  1UY3 A;  1GNH A;  2QQK A;  5FYY A;  4KU8 A;  3T4H B;  1NA1 A;  4QB1 A;  3URF A;  5CKQ A;  1G9D A;  2ZEX A;  5FZO A;  1PNF A;  1NE4 A;  3WW4 A;  1I6X A;  5IK8 A;  1ZRC A;  2PAM A;  1HN1 A;  3A7Q A;  5IWF A;  2EAA A;  1Z7S 3;  3PUQ A;  1ENR A;  1LRH A;  1W6N A;  3WAS A;  5A3W A;  3ZYF A;  4LK7 A;  4YM1 A;  4AR2 A;  4ARY A;  2R49 A;  2OZJ A;  3VT1 A;  5D2A A;  2OII A;  4XUR A;  3VZL A;  3MLL A;  4KU7 A;  5ABJ B;  1UQX A;  4NE9 A;  1W05 A;  4YAR A;  1LGC A;  1J83 A;  4FT8 A;  3LFI A;  1J3R A;  4D7Y A;  4P08 A;  2OQ6 A;  4MVT A;  1F35 A;  1OA2 A;  2FMD A;  5IAV A;  4CPB D;  3HNY M;  1POV 0;  3ZPO A;  1NG0 A;  4NR1 A;  2VUJ A;  2BBA A;  3D0S A;  3NV2 A;  2CWM A;  4OCT A;  3WNP A;  4CEY A;  2JDZ A;  1OH3 A;  4SBV A;  1WWY A;  1V9U 3;  3OPT A;  4M3C A;  4CUG A;  1Q8S A;  5CNA A;  2VNR A;  5CKN A;  1F9K A;  1REE A;  2QDN A;  4K7J A;  4TTG A;  4MGK E;  2DCT A;  3III A;  1HXS 3;  2G19 A;  1OFN A;  2Z79 A;  4QPG C;  3HQX A;  1CES A;  2WO7 A;  4J25 A;  5BNO C;  2OT7 A;  1LOA A;  2BWC A;  4ONZ A;  2ENR A;  5LA1 A;  1WD3 A;  3VBS B;  4UI9 L;  5B6S A;  2XXZ A;  2DVG A;  3RZL A;  1QJX 1;  3DUI A;  3R4S A;  4DIN B;  3G6J B;  1RC6 A;  2VQT A;  2RMU 2;  2MPF A;  4XDO A;  1W3X A;  5KXD A;  3NVC A;  1UKR A;  1UPS A;  4P9Y A;  5FLI A;  5HPO A;  2A3X A;  4QQS A;  4H7M A;  4LK6 A;  4O65 A;  4XTM A;  1C8M 2;  1LOG A;  2AYH A;  4F3J A;  5FYM A;  4Z8B A;  4PVA A;  2XWJ B;  1YI9 A;  3BYW A;  5D8A A;  1H9W A;  1UY0 A;  4Q0S A;  5C3S A;  4I2O A;  1B35 C;  3WF2 A;  4FTB A;  5FZH A;  1UZW A;  3VBF B;  3RJ2 X;  4QKF A;  3WNO A;  1MVE A;  2A3W A;  1BCX A;  1F5F A;  1WCK A;  1L3J A;  4QX3 A;  4QPG B;  2EID A;  3NV1 A;  2Y6H A;  4PBO A;  2QQW A;  2VZR A;  5IYY A;  5LY2 A;  3DYO A;  1BBT 2;  2YFU A;  3EQE A;  3INA A;  1S0B A;  5CAZ A;  5LZ6 A;  5FFO C;  1W6P A;  1VBC 2;  4S2G A;  1Q8Q A;  4CCD A;  5C9A B;  2FDJ A;  2RJ2 A;  3B02 A;  1G8W A;  3I2F A;  1FOD 1;  4W8J A;  1QJF A;  1V6J A;  2ZHL A;  3OGS A;  4XFC A;  4F8A A;  5JZG A;  1Y9Q A;  2VOK A;  3MFC A;  4RHV 2;  1HRV 1;  2ZAH A;  1S2E A;  1X9T A;  1LOF A;  2W46 A;  3DPR A;  4HPK B;  5T5L A;  3WV6 A;  4ZZ5 A;  4KI5 M;  3Q8A A;  2VZQ A;  2NZ9 A;  5FLJ A;  1GOH A;  2QBX A;  3GGL A;  4FPJ A;  2CSG A;  1AR6 2;  5AFB A;  4CP9 B;  4AAP A;  3MUY 1;  3BYK A;  3VKO A;  5SV5 A;  1LAJ A;  1BK0 A;  4CDX A;  3I3E A;  5F3E A;  4MXW A;  2VVD A;  2VO5 A;  1OT5 A;  1UAI A;  1JHJ A;  5BUV A;  4IXL A;  4D3W A;  3HT2 A;  2XKO A;  5GJ6 A;  2Q8D A;  4AAX A;  2I2S A;  1PVC 1;  4AQS A;  2FD8 A;  5I0U A;  1U5Z A;  4Q0Q A;  4ASL A;  4B4Q A;  4AG4 A;  1QEX A;  2R07 1;  3P1I A;  3VKF C;  3OBZ A;  3OBT A;  4LUM A;  4P9G A;  4MV2 A;  3IB3 A;  3ZFG B;  3KB5 A;  5EWS A;  4JKL A;  1W2A X;  1KDM A;  1OXC A;  3GHN A;  2P3K A;  2ARB A;  2HH9 A;  1LKN A;  4JGY B;  2FDF A;  4XBN A;  2V4V A;  2QJV A;  2IXI A;  4WVZ A;  3VUO A;  2XGX A;  1RUI 1;  2MHF A;  3JD7 2;  3U78 A;  3BCW A;  3BIW E;  5A7O A;  1KS5 A;  3VGI A;  1BBT 3;  2VVF A;  4E4S A;  2W1W A;  4I09 A;  4IE4 A;  5K4L A;  1G9C A;  3H1M A;  2D40 A;  3UKT A;  5JCT A;  1RHI 3;  4LPL A;  4QPI A;  1UXX X;  1PX3 A;  1I9R A;  1RUH 3;  3AB0 A;  3AL6 A;  3GZA A;  4IV1 A;  4MSV A;  2YXS A;  1RUF 3;  4R9B A;  4IEO A;  1VPH A;  1HB3 A;  3EMR A;  3F2Z A;  5JMC A;  1AR7 3;  4COV A;  5CFC A;  4KC8 A;  2JG8 C;  4B8E A;  4O8P A;  3I2O A;  1EV1 1;  1QJU 3;  1O59 A;  3H7Y A;  4GMP 3;  3N7M A;  2ES3 A;  4LO4 B;  3UV9 A;  1CPM A;  3I8T A;  1VJ2 A;  3N7L A;  4Q29 A;  1GQG A;  2DBN A;  2V09 A;  2R06 1;  4N53 B;  4OFG A;  2WN2 A;  1UX6 A;  1XB9 A;  2WAB A;  1FX5 A;  2BFU S;  4R8H A;  1IS6 A;  3RYR A;  4F83 A;  2J1U A;  2WZR 3;  1D2S A;  2YG0 A;  5BNO B;  4PJY A;  4BIS A;  3AYC A;  1RUJ 2;  4Q4Y 2;  3ZDV A;  1VR3 A;  1ASJ 3;  4KNC A;  1NE6 A;  4M3C E;  4O8O A;  2EA7 A;  4RQP C;  3APB A;  4AEK A;  3ZKU A;  1UU4 A;  2HWD 1;  2Y64 A;  3AXE A;  1ZBE 1;  1W9Y A;  4YG6 A;  1C28 A;  3L2Y A;  2E31 A;  1APN A;  3RG0 A;  3W20 A;  4AGR A;  2YFS A;  1LCL A;  3IM0 A;  3E97 A;  5C3R A;  3EBR A;  1OC1 A;  5F37 A;  1O3T A;  3RZJ A;  5GAL A;  3FFZ A;  1PZ9 A;  1X8M A;  1SLC A;  3LE0 A;  1S1A A;  3NNJ A;  4AI3 A;  5F7U A;  3O1P A;  1PT2 A;  2VUL A;  3ZDS A;  1V6M A;  5GLR A;  3NW4 A;  5C33 A;  4URA A;  3HQR A;  5I0S A;  1AXK A;  4QPI C;  1OQE A;  5BXX A;  1DGW A;  4ES8 A;  1C5H A;  3G7D A;  4YGC A;  3WDW A;  2VY0 A;  1JI6 A;  4E4H A;  4YLZ A;  1ZA7 A;  3MF9 A;  4N9H A;  1RUG 3;  4Y33 A;  1MZ5 A;  3OBR A;  5DDJ 2;  4RGA A;  4MXV A;  3WOG A;  2WS9 2;  1JUH A;  3P6B A;  2VPV A;  1IS5 A;  1BKZ A;  3SCH A;  1UD1 A;  2YU2 A;  4PQQ A;  2ZZJ A;  2XWB B;  1FYU A;  2IXJ A;  2ETE A;  1E57 A;  2ZAC A;  1GZ9 A;  3O5S A;  2P3J A;  2HLE A;  4Z82 A;  4BJ0 A;  1ND3 B;  3FHI B;  4W50 A;  5KHH A;  3WIN E;  3RDI A;  2HBU A;  2R06 2;  1QOT A;  2OZ6 A;  4H3W A;  3B93 A;  3DKW A;  1AR8 1;  2WFP A;  1C5I A;  3CF6 E;  5F2W A;  4QHZ A;  2DFC A;  1DBN A;  1A8M A;  4XUP A;  2R32 A;  3CLP A;  4KG0 A;  1SG3 A;  1Z7S 2;  3KMH A;  1DGR A;  2RVA A;  2I07 B;  3J4U H;  4FP2 A;  3THC A;  4YSF A;  2Z42 A;  4ISR A;  5FO8 B;  1AUY A;  2TEP A;  2A6W A;  2ZJC A;  3TN9 1;  4QGM A;  3ST7 A;  4Q4X 2;  5KC5 A;  2RDS A;  2RM2 3;  2V4A A;  4LUK A;  3KD4 A;  5FZG A;  5JR7 B;  1CZS A;  1D4M 3;  5FKB A;  3DV8 A;  2XOM A;  3UT0 A;  3NAP A;  4BE3 A;  4CCE A;  3MIE A;  3DYM A;  4GIQ A;  4IET A;  1YFX A;  1NA1 C;  3ON7 A;  5IK4 A;  2BGO A;  4PDW C;  3CQO A;  2DCJ A;  3VLB B;  3D4K A;  5JXH A;  5FUP A;  4E8C A;  1RUE 2;  4CP9 A;  4P5Y A;  5FZK A;  4WZF A;  3PL0 A;  5LAS A;  4AEM A;  1FPN 3;  4BB3 A;  5GKA C;  4LR4 A;  5HCA A;  3LKJ A;  2E7A A;  4L99 A;  4QGL A;  2XJQ A;  2DVF A;  4AI8 A;  3OM5 A;  3M2M A;  1LR5 A;  1R1A 1;  1SLT A;  1NLQ A;  2VZ3 A;  1YJK A;  2WQZ C;  5EFU A;  4Z92 B;  1WW5 A;  1GWK A;  1VMH A;  3AMN A;  3T08 A;  2D3R A;  1NY7 1;  5AVA A;  3JQX A;  4FSJ A;  4H7L A;  4JKM A;  3PJQ A;  2WNV B;  1QJU 1;  1DF0 A;  3OGV A;  4JX0 A;  2VNG A;  4KWK A;  3OM4 A;  2Q4S A;  5T52 A;  4YZ2 A;  3KV5 A;  4CEY C;  2EIG A;  5FKC A;  4CDQ C;  3ZFF C;  1OKO A;  3KCX A;  4M0N A;  5AC9 3;  4JGY A;  4FOW A;  4QHB A;  4BYY A;  3WP4 A;  1LHU A;  5EJZ B;  4QQH A;  4AZZ A;  2D3S A;  2AUY A;  2D6L X;  4YWA A;  4UF0 A;  1KEX A;  4OI0 A;  4XHB A;  2FQP A;  2VCB A;  3POB A;  4IUG A;  2BNN A;  1QIQ A;  2F6B A;  1BXH A;  2WKK A;  2DUP A;  4LTA A;  4YW3 A;  4CDU C;  4K8F A;  1AR9 2;  1UMH A;  5FDB A;  3NJV A;  3OM2 A;  3KT1 A;  4P9J A;  4NPL A;  1OVS A;  2ZGS A;  5J7M A;  1IKP A;  5FMD A;  2LS6 A;  4C8D A;  3GCW A;  4Z1V A;  2W94 A;  1X8E A;  3B5L B;  4OUS A;  2BEO A;  3M70 A;  1STM A;  4CUC A;  1CAV B;  1N1V A;  3NAP C;  1PVC 3;  1ULD A;  1PZ7 A;  2BJS A;  3GCX A;  3KV9 A;  4MLG A;  2Q0A A;  2DUO A;  3AMH A;  1KQR A;  4NUB A;  4GD4 A;  5JSP A;  2TUN A;  3QZ4 A;  4UXA A;  2GZW A;  3VT0 A;  1RMU 3;  3AZY A;  4BU2 A;  3TEX A;  4V2W A;  5CFD B;  1VAK A;  3AZW A;  3OG2 A;  1XSQ A;  3AZV A;  4GMP 0;  3C7H A;  5FZB A;  3E6B A;  3T1L A;  2JG8 B;  3WP5 A;  2RV9 A;  3NJX A;  4KBZ A;  2ZEY A;  4UWD A;  1JUI A;  1HB4 A;  1Q8O A;  2EAL A;  1S0E A;  1HRV 3;  3ES4 A;  3R6S A;  5LEJ A;  4Y22 B;  3QEE A;  1CAU B;  2NMO A;  1NXD 1;  3D5Y A;  5K0U B;  1A3K A;  1SFP A;  4PI0 A;  1Y7B A;  3RZH A;  2EF6 A;  2QE3 A;  2NN8 A;  2ARX A;  2WSU A; 
#chains in the Genus database with same CATH homology
 3VSR A;  3VSZ A;  3R4Z A;  3VSF A;  3TAW A;  3PIJ A;  5FMB A;  5GLO A;  3C7F A;  1Y4W A;  3WMZ A;  2XQR A;  3S5Q A;  3AKG A;  5FIX A;  2ADE A;  3WMY A;  2EXJ A;  5GLN A;  3QC2 A;  5FMC A;  4KCB A;  4D47 A;  4FFH A;  3P2N A;  4U6B A;  3LDR A;  4AK7 A;  5FKB A;  2ADD A;  2YFT A;  4CCE A;  4UDG A;  5A8D A;  3AKH A;  3LV4 A;  3LIG A;  3C7G A;  2X8S A;  3BYN A;  4O8P A;  3KF5 A;  3WN1 A;  3WPV A;  1UYP A;  1W18 A;  4FFF A;  1GYE B;  3D60 A;  4PVI A;  2X8F A;  5JOZ A;  3ZR6 A;  3NQH A;  3WAS A;  1W2T A;  1WL7 A;  3WN2 A;  3OM5 A;  5GLP A;  4FFG A;  5A7V B;  4UFJ A;  3VT1 A;  2QQU A;  3LIH A;  3UGG A;  5GLL A;  2AEZ A;  4B1M A;  3LFI A;  3VSS A;  2EXH A;  4KC8 A;  4KCA A;  5AYD A;  3WAT A;  3U14 A;  3OM4 A;  4HXC A;  2EXK A;  3AKF A;  3LF7 A;  3WAU A;  5FKC A;  3IMM A;  4COT A;  4UFI A;  1VKD A;  2YFR A;  4O8N A;  1YIF A;  3KST A;  4UDK A;  1YI7 A;  3ZR5 A;  5AYE A;  1YRZ A;  5FK7 A;  3ZXK A;  2B4W A;  4ONZ A;  1GYD B;  5GLK A;  4AZZ A;  3D5Z A;  1UV4 A;  3K1U A;  5JOY A;  5B6S A;  3AKI A;  5A7V A;  4O8O A;  4UDI A;  3QED A;  3LDK A;  5ANN A;  4QQS A;  4UDK E;  3NMB A;  2VDT A;  5FLW A;  2YFS A;  3OM2 A;  3D61 A;  3OSD A;  4UDJ A;  4KC7 A;  3RWK X;  4PVA A;  5FMD A;  3ZXL A;  4FFI A;  5GLQ A;  5JOW A;  4CCC A;  4U6D A;  5GLM A;  3QEF A;  4B1L A;  3BYJ A;  1PT2 A;  5B6T A;  4EQV A;  3UGH A;  4MLG A;  3WPZ A;  3C2U A;  5GLR A;  3UGF A;  4UFM A;  3R67 A;  3QZ4 A;  5AYC A;  4N2R A;  2AEY A;  2OXB A;  3VT0 A;  1OYG A;  2QQW A;  3LEM A;  4AK5 A;  3CU9 A;  1Y9G A;  2QQV A;  3WPY A;  3R4Y A;  4UFK A;  4CCD A;  3C7O A;  5FK8 A;  3KF3 A;  1GYH A;  3C7H A;  3WPU A;  3HBK A;  4N2Z A;  4NOV A;  3WN0 A;  3ZXJ A;  4UFH A;  1Y9M A;  4AK6 A;  2EXI A;  3VT2 A;  3PIG A;  2AC1 A;  4N4B A;  3OM6 A;  4JQT A;  3BYL A;  3QEE A;  4KMI A;  5A8C A;  1ST8 A;  3OM7 A;  5AY9 A;  3H3L A;  4UFL A;  5JOX A;  3U75 A;  2X8T A;  3D5Y A;  3C7E A;  3SC7 X;  5C0P A;  3U1X A;  4N1I A;  1Y7B A;  4QHZ A;  3BYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...