2AEYA

Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with 2,5 dideoxy-2,5-immino-d-mannitol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
537
structure length
537
Chain Sequence
QIEQPYRTGYHFQPPSNWMNDPNGPMLYQGVYHFFYQYNPYAATFGDVIIWGHAVSYDLVNWIHLDPAIYPTQEADSKSCWSGSATILPGNIPAMLYTGSDSKSRQVQDLAWPKNLSDPFLREWVKHPKNPLITPPEGVKDDCFRDPSTAWLGPDGVWRIVVGGDRDNNGMAFLYQSTDFVNWKRYDQPLSSADATGTWECPDFYPVPLNSTNGLDTSVYGGSVRHVMKAGFEGHDWYTIGTYSPDRENFLPQNGLSLTGSTLDLRYDYGQFYASKSFFDDAKNRRVLWAWVPETDSQADDIEKGWAGLQSFPRALWIDRNGKQLIQWPVEEIEELRQNQVNLQNKNLKPGSVLEIHGIAASQADVTISFKLEGLKEAEVLDTTLVDPQALCNERGASSRGALGPFGLLAMASKDLKEQSAIFFRVFQNQLGRYSVLMCSDLSRSTVRSNIDTTSYGAFVDIDPRSEEISLRNLIDHSIIESFGAGGKTCITSRIYPKFVNNEEAHLFVFNNGTQNVKISEMSAWSMKNAKFVVDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords fructan 1-exohydrolase IIa
publication title Insights into the fine architecture of the active site of chicory fructan 1-exohydrolase: 1-kestose as substrate vs sucrose as inhibitor.
pubmed doi rcsb
source organism Cichorium intybus
total genus 128
structure length 537
sequence length 537
ec nomenclature ec 3.2.1.153: Fructan beta-(2,1)-fructosidase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 2aeyA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2aeyA01
4B1MA 4N1IA 3WN0A 5GLLA 3WN1A 4UFMA 4QHZA 5JOXA 3D61A 3QZ4A 4QQSA 4U6DA 3KF3A 2YFSA 1VKDA 5C0PA 3KF5A 3VT0A 3WMYA 1GYEB 3QEFA 4PVIA 3VSSA 2X8SA 3U14A 2AEYA 4PVAA 1GYHA 2EXKA 5A8CA 3QEDA 3BYNA 3OM7A 1Y7BA 3C7OA 4CCCA 4COTA 1UV4A 4KCBA 3ZXLA 1OYGA 3LIHA 4MLGA 4AK7A 2QQWA 4HXCA 1Y9GA 4KMIA 3BYJA 3KSTA 4U6BA 4UFIA 4EQVA 3LEMA 3LV4A 4ONZA 3WPUA 5JOWA 3H3LA 3D5YA 5GLQA 5JOZA 4B1LA 4AK5A 4FFHA 3OM4A 5AYCA 5B6SA 4AZZA 3ZR5A 3C7GA 4AK6A 3OM6A 2B4WA 3P2NA 5A7VB 3VT2A 3UGFA 1YRZA 5FLWA 1ST8A 3SC7X 5FIXA 4O8NA 3IMMA 3QEEA 4FFGA 5AYEA 3U1XA 3D5ZA 3ZXJA 4UFKA 2XQRA 3NQHA 3R4YA 1WL7A 3R67A 3WPZA 3BYLA 3WMZA 3AKFA 5FK7A 5FK8A 3AKGA 4N2RA 3VSRA 3LIGA 3WPVA 3UGGA 5FMCA 5A7VA 2EXHA 3UGHA 3PIJA 4O8OA 4CCDA 4UDGA 5GLMA 3HBKA 5GLRA 3WASA 2X8FA 1W18A 2EXIA 4UDIA 3WAUA 4UFHA 4FFFA 4UDKA 4UDKE 2AEZA 1Y9MA 4N2ZA 5B6TA 3LF7A 3U75A 3PIGA 2VDTA 4KC8A 1YI7A 2YFRA 3K1UA 3LFIA 5GLOA 3OSDA 5JOYA 1GYDB 1W2TA 3ZR6A 3WN2A 4N4BA 3OM5A 4KCAA 4NOVA 2YFTA 5AYDA 3WPYA 4CCEA 3BYKA 3RWKX 3S5QA 4JQTA 3C2UA 3OM2A 3QC2A 2ADDA 5FKBA 2QQUA 2OXBA 2AC1A 5FKCA 1Y4WA 2QQVA 5FMBA 3AKHA 3D60A 3TAWA 3VSFA 3WATA 5ANNA 3AKIA 2X8TA 1UYPA 4FFIA 3VT1A 5A8DA 3ZXKA 3NMBA 3C7HA 1PT2A 5FMDA 3R4ZA 4O8PA 4UDJA 3C7FA 3LDRA 5GLPA 5GLKA 3LDKA 4UFLA 4UFJA 3VSZA 2EXJA 3C7EA 4D47A 1YIFA 2ADEA 3CU9A 5GLNA 4KC7A 5AY9A
chains in the Genus database with same CATH superfamily
4Z1VA 1QU0A 3VHOA 4YFWA 4D7YA 4GWNA 1LR5A 2PHUA 1MS9A 1RUH1 2IXHA 3D61A 1T2XA 4HK9A 3ZKUA 2JECA 3H3ZA 4ZU5A 1S0BA 4OVEA 1W2AX 5CFCB 3O1SA 3QEFA 3S30A 4BXFA 1MEC2 2JXAA 3RJRA 2QQKA 3GZAA 4QB2A 3MFCA 2WWUA 3ST7A 1SPPA 1RUE2 3I2IA 5C70A 1UY2A 2HKXA 2XVGA 3ZXLA 2EF6A 3K4ZA 1L3JA 1LRHA 2BOIA 1NXMA 3WZ1A 2R043 2CU5A 2VUCA 1REFA 2X8KA 2AYHA 3CKHA 4QU1A 4YVSA 5DUXA 3VBHC 4EN7B 3GALA 4YW3A 1GMMA 1RVF1 4AVSA 1VBC1 5IFPA 2A6ZA 4KL1A 3ZYJB 3BYWA 4EWDA 3FFQA 2GMPA 4CRQA 4QX7A 5GLQA 1UZVA 2CYFA 2VZ1A 2ZZJA 5L7OC 1VR3A 3DYMA 4LHNA 1SBEA 3AMNA 3I2JA 5F1RA 3AKRA 3GHNA 4XXPA 3MO4A 4BXSV 5DZGA 1AX0A 3O0VA 3B01A 5FJHA 3ZFGB 2D3SA 3VBUC 3WXPA 3BOWA 2P3KA 4SLIA 3I54A 4AVCA 1C4RA 2D43A 3BIWE 2CGOA 2CHHA 2YROA 3AP4A 3U1XA 3KHBA 2UY9A 1YJLA 1YI9A 4OZOA 1NQJA 4ASKA 3PUSA 3ILNA 5FZEA 3DEMA 3AKFA 2VVEA 5CKNA 5KHIA 1W6NB 3A7QA 3RYPA 1RUJ3 5LBBA 2Y6FA 3IMNA 1GFF2 2A6XA 5FYIA 2QJVA 4QDQA 3B00A 3I2HA 1KGYA 3ROUA 3TN93 2HWE1 5GALA 5CKQA 3PJQA 1PX3A 1TMF3 2ORXA 2OT7A 3AMMA 3VD4A 1K42A 3OEAA 3VBSC 4BLIA 2YFUA 5FZAA 4GH4C 4UW6A 1R1A3 1TEIA 2PFWA 4PT6A 1UKGA 5I0UA 1RUG1 4CCNA 4R4XA 5FY0A 2FZ2A 2QQNA 2QTWB 5EFUA 4XJAA 3VL9A 4C1XA 4HKOA 1Z7S2 3VDAA 1LECA 5HCHA 1V6IA 4XW3A 2VNOA 4NWVA 4CEYB 2YMZA 1YQCA 1NOVA 4GALA 2OKXA 5FO9B 2V09A 2R062 4Q0SA 1ZRCA 3EB7A 1QXJA 1XNCA 4IDZA 5KBFA 1JU4A 4X6RB 4FTSA 5LZ6A 3AZZA 3IPVB 2G19A 2PQSA 3FWEA 4NJ4A 1I5ZA 1VBB3 3U0ZA 1UXXX 5EV7A 5FMOL 2C5DA 1LB2A 4K3UA 2VZOA 2WN2A 1VBE3 3ZIWA 4FPJA 2YPJA 3T1LA 4C91A 5A6YA 1VAKA 2XQXA 5IK4A 4CXXA 4O9GA 1ZZ9A 3N7KA 4BA6A 4KG0A 1KITA 4OUSA 4QM9A 1N1TA 2AH2A 1IHMA 1TNFA 3NAPB 3QD6A 4FPOB 4JDOA 4OCTA 2G9FA 1A8DA 5BNOB 3K46A 3TN92 4ZZ5A 1DLCA 4PDWA 4UW4A 4QX1A 2R0HA 1FYUA 2ZHLA 3BU7A 1TMF2 3OY8B 3BTYA 3WN0A 4UFMA 4R9BA 1WKYA 1EPWA 3PVOA 4RHV2 3CBNA 3SEPA 1G9DA 4Q0VA 1IQDC 1VB2A 2W1WA 3HIFA 1F4AA 1NCRB 4EWAA 4W4ZA 4HSJA 2YPDA 3MUY1 1Y7BA 1QOSA 1SBDA 1XNDA 4E27A 3RDIA 1W9FA 4FPFA 3WX5A 2FHRA 1E5RA 4IV1C 5BPXA 4CDXC 3BYJA 4EZHA 4IGQA 2WA4A 3ACGA 1NXD1 2VUJA 1AJKA 4Q4X1 2KXLA 1WMEA 4YYOA 4AVBA 5BNNA 1JZ2A 3UJQA 2VOTA 3ZO0B 1RUC3 3D5YA 2ZGUA 3IM0A 5HI0A 1JW6A 1NZIA 1OFNA 2A3YA 1NLSA 3AP5A 5A3WA 5J3UA 1WBFA 3N7JA 5FV3A 2B4WA 4QXHA 3KLSA 5CYYA 2RM23 3ELNA 1OF4A 3DKQA 1CAVA 3ACLA 4LLOA 1DYPA 4O8NA 2GC3A 1CIYA 3WEZA 4XJ9A 1F31A 4UFKA 2BWCA 3KQ4B 4L8QA 1LTEA 1T6GC 3VBOB 2W92A 1B09A 3I3MA 1DF0A 2FD8A 1W04A 1YYNA 4XJWA 5LBCA 3WW1A 5J1XA 2Y34A 2GC1A 2E32A 2D6OX 4C0HA 3I3BA 4GZ9A 2GMMA 3UGGA 3AKTA 1ULGA 3J9SA 5FYSA 3RPQA 2RHPA 4ARYA 4EZ4A 3CLPA 3R0RA 3VZLA 5GLMA 5C8CC 1GQGA 5EHDA 2WAOA 3IDCB 3FC0A 1CPNA 2GP5A 5FYVA 2WO1A 1J1TA 3EJKA 4UDKE 4NE9A 4KH9A 3ACIA 4Z82A 1K5JA 1NY72 4AFCA 4CYDA 5CFDA 1G8WA 4OLLA 1CVNA 1HJGA 4QM8A 3LOBA 1SG3A 4UWDA 3CO2A 4AGVA 2OUJA 4J1XA 4YW5A 2ZCWA 3GF6A 4AEKA 5F9TA 4IE0A 4IV3B 2VZVA 5CEHA 5L9BA 5FQ0B 2JENA 2VQ0A 5ABJC 4TN7A 5AFEA 1H2KA 5CB7A 4V1PA 3GNEA 3FLTA 3FBMA 1K45A 3H7YA 1LOFA 2TUNA 3CZJA 3SITA 3PU3A 4CCEA 2VD7A 1F5FA 4JQTA 1BEV3 2RM22 3ZN6A 3UNPA 1RUI1 5FZOA 1OLQA 5CFCC 1S2KA 2ZHKA 2ZX3A 2BYVE 3DPRC 3NMBA 1GZCA 1RJ7A 5FMDA 1M06G 4A42A 2RE9A 4N7UA 3I8TA 1ONAA 4IEZA 4DXTA 1L7RA 2XHKA 1V6KA 1DQ2A 3T2QA 5A1FA 1TME3 1VBD3 2WC2A 3VSZA 1V6LA 2JJ6A 1W2UA 5KHJA 2YBKA 3CF6E 5IJRA 4BDVB 1PX4A 3T1MA 4WVMB 4C90A 1S0JA 1COV1 3BB6A 3MV01 4BIFA 4XMAA 1OUSA 2XKOA 4UW3A 1US3A 5LBEA 2Q8DA 4FTBA 4U6DA 1OLRA 4OULA 2JG9B 4N8MA 2LUWA 4Q8KA 4XHBA 4BQ2A 1YNAA 3FBYA 4CP1A 3ZFGC 1HXS1 2AREA 1O3RA 4PVAA 1YHFA 3SLIA 2WSVA 1C57A 3OM7A 4A3ZA 1MS5A 3C7OA 3U11A 4LO6B 1OQ1A 1RVF3 5FJKA 1DYOA 1VBC3 3VGIA 4AHYA 4MLGA 1ENXA 1H4GA 2GH8A 3OPWA 4Z2AA 2GNBA 3KV4A 1VRH1 3FE5A 3MEPA 2JIJA 1X82A 1Y43B 2A3WA 2WNUA 2VMHA 1PIV1 1G9FA 2R073 3DKWA 4HONA 2DVDA 4UT5A 3HEIA 2IUWA 1BYHA 3LB9A 4JHTA 1IS5A 2PHFA 3BCWA 3WQ1A 2YBSA 1XNTA 5I0TA 1DU3D 4TLGA 3FHIB 4YGEA 3V0AB 2R6QA 2VGDA 1AF9A 1KXGA 2VAUA 3JUUA 4FPKA 4YGDA 3X29B 4AZZA 5L19A 4JGYC 5CG8A 5AYCA 1ACCA 1PGW2 4E9KA 4QKDA 1HB2A 1C1LA 1W28A 3UGFA 1TME2 2YC4A 1VMJA 4P9IA 3S57A 1LOBA 4NIGA 2G9GA 1LENA 1WCSA 2H0BA 2PTMA 2RMU1 4WM7B 3W59A 3R67A 1I9RA 3MV11 4QX8A 4YM2A 5FZGA 5FY7A 4UAPA 2HWE3 5KXCA 2DU1A 2B45X 4CEYC 5FK8A 4GWMA 4DEQA 5J37A 1OURA 2ES3A 4NHKA 5KXBA 4LPLA 3O1MA 3ZYIB 3WASA 4NMIA 1HDKA 2C9KA 1MACA 3OBRA 4IEWA 5BNPB 5K4LA 5T5PA 2QUOA 1NKGA 2GNDA 4Y22A 1RUG3 1JU3A 4KBZA 5FFOC 5FP9A 4XUTA 1V0AA 1VBC2 4PIZA 5DG1A 1WMXA 3N35A 2VZPA 1WD4A 4UBHA 2R16A 3BOPA 3BTAA 4BH9A 3I3EA 2ZJCA 1SZBA 2OZJA 1YI7A 3NAPC 4OMCA 4RR3B 2MEV1 4OHYA 2R072 3LFIA 1W06A 2DVFA 2XHNA 4GD4A 1O4ZA 1DQ1A 4HBNA 3MLJA 4ES8A 3H50A 2FDGA 1XXNA 4ZONA 3RG0A 2C1FA 5EQUA 4CP9B 4E2QA 3GGLA 3MF6A 2BNOA 3OGGA 3I49A 3SKJE 2IVIB 2XUEA 3FZ3A 4CE8A 3OM2A 5TSWA 4UF0B 1QDOA 4HLTA 3AYDA 1VE0A 5FMBA 2X05A 1W3XA 5C6CA 1NCRC 1IPJA 3VBFB 3ILFA 5A3NA 5BNOA 4DUWA 3IIAA 2KM2A 2YBPA 5DZFA 3SQOA 5HV4A 4A7YA 5F3EA 3AMQA 1JZ6A 3R4ZA 3C7FA 2X09A 3OY8A 5GLKA 2HWE2 1AVBA 3MBWA 3N3HA 4CZSA 1YXWA 4FOQA 2YY1A 3GBFA 5T55A 2BFUS 2EXJA 4XIKA 3SXWA 5J09A 1AHSA 3H8OA 4HETA 1OXCA 2HWC1 2X29A 2R32A 2F6BA 2ZGNA 1NA1A 2XL7A 1HLCA 3T09A 4AGRA 4IEOA 5F6KA 5FBZA 5JXHA 4N1IA 3Q8AA 3WD5A 4Y24A 5FYMA 1TVGA 1RUG2 2LW8A 2OZ6A 2DYCA 4Y26A 2LRPA 3HPNA 3KV9A 3TEYA 4NPMA 4YW2A 5LWBA 2CAVA 1GNHA 3HT1A 4Y33A 3CEWA 1APNA 3PTYA 2RVAA 3G7DA 4B29A 1H1MA 4HANA 1S0IA 1GYHA 2EXKA 1ZZ6A 3ABZA 4AGGA 1GP5A 1H6XA 4XFGA 4E8CA 5LEJA 3WP3A 1OYGA 4Q4X3 5A7NA 1IS4A 5C9AB 2R30A 3OPZA 3IN9A 4N43A 3VBOC 2E26A 4RFT0 2SBAA 1MS4A 4QPIB 4PLNA 2W46A 4YG3A 1NQDA 1CAUB 4XC9A 2NMOA 3HNYM 2BDRA 1HB4A 4LXLA 4AFMA 5L9RA 2VUAA 1W03A 5I93A 3O1RA 2JE9A 3OUJA 1HV0A 2Q5TA 1SLIA 3PVEA 2ZAHA 4A6SA 5KHHA 4GXLA 2WZR2 1EAH1 4MSVA 1IS3A 4DXZA 3OUIA 1JZ4A 1RC6A 3AFKA 5C7GA 4JGZB 5AYEA 5T50A 5E8AA 4H2AA 1D7PM 4Q2FA 1EUTA 4IV3C 2JDKA 4FXKB 3AZWA 2EIBA 4META 2WZ8A 4GWJA 4KNCA 3WV6A 5CVRA 3E6CC 4R8HA 2JB4A 4CUBA 5FP3A 1ODNA 4AW7A 4QX0A 5C3RA 4D69A 1DDLA 2Y33A 2BOJA 1T6BX 3UGHA 4A45A 4B4RA 2K46A 3MZHA 1W6PA 4LBJA 1URXA 2RS32 4XCAA 4NRPA 3CIHA 1W6OB 1O4YA 2ZGOA 2Y38A 4M0HA 4M0NA 3WNXA 4KWKA 3FX3A 1S1AA 3AZXA 1K5MC 1R092 4Q4X2 4W8JA 3K75B 4AAXA 2YC0A 4DUXA 3LF7A 2VBDA 5I8SA 2Y26A 3E97A 5K7PA 3S5AA 1C5HA 1J58A 4GB31 2DUQA 1AYN3 2UWCA 2W95A 5C4WA 4QX5A 4YZ5A 2R1DA 3AZVA 3ZFEA 3GZUC 1IPSA 2HBTA 4LO8A 4IUGA 2GC0A 2I45A 3WR0A 3RZZA 4URTA 1DZTA 3EYPA 3O1VA 1GP6A 4Q8LA 2Z4FA 3QBQA 1RUI3 4U2AA 3USSA 3WNNA 2AACA 2E6VA 3DCQA 3R4DB 3VDBA 4FPCA 2GSYA 4I0BA 5FZKA 5A7QA 4CDUA 3BKZA 1G7YA 2QDNA 3D0SA 4R9AA 4AVTA 1SDWA 1W90A 4CUAA 2W2IA 2W91A 1HJFA 2JG9C 2Q8EA 3V64A 4BMBA 4YSFA 3D60A 2VR4A 3M3IA 2UU8A 1BK1A 1HB3A 1UIJA 1W0NA 5I8TA 1PZ7A 5JVVA 1OVSA 3ZXKA 1JZ8A 1GQPA 2WNVA 2ARBA 5GLPA 4NPRA 5T5JA 1PMJX 1UOFA 2JEMA 4BWOA 4XFFA 3I2KA 5J7MA 3RGBA 3T2PA 5DUVA 2VBPA 4FP3A 3CNAA 4UFLA 5E89A 1F9KA 2WQ8A 1MZFA 3LEIA 2JG9A 3MIDA 3ZYFA 1OT5A 3U37A 1XE8A 1YIFA 1OOPC 4QPGB 1EV11 4UBGA 2Y0IA 1O3SA 4Q4W2 4WZCA 4EN9B 1GLHA 1HRI1 5D1IA 3WN1A 3VKFC 5LB6A 1TE1B 4XPVA 1HXS3 1ZRDA 1C3HA 1OC1A 3JD72 1V9U1 4JDNA 3AMPA 5LA1A 4R9DA 4LOTA 1C8M1 1AYN2 5FXXA 2X8SA 1CIWA 4P02B 4XFBA 4RS5B 4P9JA 3QEDA 4YVWA 1VRH3 1RUD3 1MVQA 2J42A 3ZPYA 1SFPA 3CU7A 3ON7A 3UK9A 2QQWA 4KMIA 4WM7C 5A1LA 3E5QA 3V0AA 5FPVA 2AZ5A 5F5QA 1LKNA 3CHXA 2GU9A 3ZXAC 4HVRA 1QIQA 3OYWB 1XB9A 4XDQA 4E4HA 2FQPA 2NPIA 2ZS6B 3THDA 5BV6A 3ES1A 4A7KA 2ZMNA 3P6BA 3I97A 1GZ9A 3BI3A 4PBPA 4YG6A 2GDFA 1UX6A 3FMGA 1N47A 4Z8BA 2YU2A 5BNPC 1B35B 5D8AA 1SQ4A 5GLUA 2ZEZA 1OKOA 5F6LB 4YGCA 2W1SA 3WUDA 4EJRA 5F5CA 3WY6A 2RMU3 4YM3A 2HWF1 2ZMKA 5A7VB 5FBJA 4UXAA 5FIXA 1F35A 5FUPA 2VM9A 4ASMB 4U36A 2JG8A 4RR3C 3KVAA 1O91A 2VMDA 3O0WA 3POBA 4UI9L 5DUWA 1ND2A 5BNPA 3U07A 3RRDA 4IEYA 3R6SA 3WMZA 2HWB2 4MX3A 2WNOA 5CKMA 2SLIA 3ZDSA 3WPVA 1XE7A 2D98A 3PU8A 4ZZ8A 2DCKA 4YWAA 1W8OA 2OUHA 1CZTA 1PK6A 3DN7A 5FYYA 5GLRA 1CD3G 2V72A 3KGLA 2Z2SB 4RR3A 1DHKB 1ULOA 1WA4A 4NRMA 3VHRA 5AFBA 4FFFA 1RUD2 5LASA 3VBFC 4Q1RA 4OQ9A 4UDKA 2BPA2 2W47A 1NG0A 3PURA 2MEV3 5IWFA 4CP9A 5CADA 4DINB 2XVLA 1JYWA 3U75A 1XYOA 3PIGA 1QQP1 3ASIA 1YQ5A 3KV5A 5ISLA 4FP2A 1S55A 3UETA 4D6QA 5FPUA 5EWSA 5I0SA 4Y5Z0 4D0QA 5ACA1 1XQNA 2RJKA 4XUOA 1G6NA 3SH5A 3I3DA 3D82A 4OZXA 3K3NA 2YFTA 2G1MA 3F95A 4E2GA 3BYKA 1CX4A 3T3YA 2EALA 2C0ZA 3M2MA 3NO8A 3H1WA 2QQVA 5A33B 1SLCA 3NV4A 3TAWA 3I59A 4XACA 1QJFA 2WJSA 1JXNA 1Q8PA 2VE1A 3TOJA 2WLQA 3N9OA 4AR2A 5L36A 1DGLA 1PT2A 3LKJA 3ZYBA 4COUA 2WQZC 1H9WA 1V6JA 3LDRA 2VTXA 2CWSA 5C9AC 5KC6A 3T30A 1AR81 2PHDA 3OJBA 4BQ5A 5FRAA 1QMJA 4HG6B 4QPIC 1KFXL 3GCXA 2WUHA 4KC7A 3Q8EA 3N36A 1QJY1 1ZA4A 3W5MA 3QZ4A 3NJZA 1DIWA 2MEV2 2D5HA 5B4XA 1D4M1 1KJRA 1YQ2A 4CCKA 5JPMB 4PLOA 1ALYA 1YWKA 4OHXA 1ODMA 5LEKA 1CZVA 3U14A 1W6QA 4I2OA 1ENRA 5F39A 2PA7A 3GBWA 2VZTA 4ZXEA 4ZPIA 4XDPA 1JUIA 1CAXA 4CU8A 1UV4A 4JGZC 2ID4A 5FO8B 5BYNA 1QJX1 1D0HA 1GZWB 1ZM1A 4ATEA 3TEZA 2VW0A 2W39A 3SCHA 4IW3A 1D0GA 3EBRA 4YZ2A 1AX2A 1DCSA 5AC91 1REEA 4MADA 1AR91 3ZKYA 5C5TA 1PNFA 2HEWF 2WYSA 3H8XA 4HK8A 2XMLA 5J36A 2WFPA 2YDEA 3BVCA 4A44A 4DEVA 1NX9A 4GAZA 1S0GA 4DMIA 5EPAA 5CISA 3BU0A 4AK5A 2DCYA 3KHCA 1EAH3 3OM4A 3KMHA 3TNPB 4XQ4A 1BLZA 1N3OA 4IETA 1JMUB 1OI6A 4XXAA 1VBA1 3FUOA 3DPRB 2UWBA 4MXWA 4FCAA 4MZUA 2VNVA 3UYJA 1HW5A 5H9RA 3RMYA 2ZZQA 3CDZB 1HQWA 1MS3A 3NJYA 5FWEA 4B4PA 1X36A 1FAYA 2HEYF 3SCGA 4QX3A 1SLTA 2Q8CA 4IEUA 5A32B 5CBLA 4WM8B 1H4HA 4CXWA 2B5HA 4UDGA 2PXJA 3FHAA 2DU0A 3D5OA 4NIDA 1CJDA 2WDBA 4IE6A 2YGLA 1OA2A 2ZGRA 2AGSA 3WINE 3D8CA 4YFZA 1PGL2 4FVVA 4JDMA 1ND3B 1QJZA 2VOVA 4PBOA 4GB33 2JDUA 1S2BA 1N3PA 3THCA 3VBHA 3A21A 4NAMA 4QU2A 2GNMA 1ZBE1 4BIOA 1PM4A 3Q9OA 2FCVA 4AG4A 4KC8A 3PUIA 4AE2A 3NL1A 4Y5TA 4MLOA 1FPN1 4G9SB 2FCTA 5L7OA 4M01A 1CZSA 2VTFA 3BALA 2IC1A 4QPGC 4Q1PA 3ZR6A 1LJ7A 3Q8FA 3QOPA 4MHRA 3AYCA 1WW6A 2ZGLA 5F2SA 1AR61 1QF3A 5IVFA 4DZGA 3VBUA 3MGUA 3E5XA 5F32A 1MPXA 1U0AA 2EAKA 2OQ6A 3B93A 3GJBA 4DNYA 5IYYA 3WW2A 4MGZE 4K1YA 3AKIA 2YUEA 3PUHA 4JGYB 4Q0QA 1JYXA 2PYTA 4RS5C 5GKAC 1RITA 1BKZA 5T54A 1DZQA 2R042 4MGTA 2VNGA 2W94A 3A23A 1EV13 4FPEA 1A3KA 4QDRA 2ZEXA 1UXZA 2DVAA 3NNLA 1HRI3 5LY1A 1BBT1 1JTZX 3H9AA 3VZJA 3ES4A 2ADEA 2D93A 3WDWA 1E5HA 1FATA 1V9U3 3E1F1 3WNOA 2P17A 3VBSA 1ENQA 1S0DA 1CESA 3LOIA 4GH4A 5FZ0A 1CGPA 3WDUA 1UKRA 1UZWA 2XBO1 3HMYA 3NNMA 1Q5OA 5T52A 1B35C 1W39A 3EMRA 2BRTA 2J7MA 1IZ3A 4DS0A 4O61A 1V6OA 1RMU3 2ZX0A 2XWJB 2IFRA 3GZTB 2ZAAA 2DV9A 4LT5A 3WNPA 4KQ7A 2LROA 2Y0OA 4CUGA 3BN6A 2VMIA 2VU9A 3KWVA 1PGSA 1ZRIA 4P9WA 3JU9A 3WG3A 5IVEA 1OPOA 4PI0A 3WQBA 1RUJ2 4RGKA 4MOAA 3VBRB 5IFTA 1ULDA 1O7FA 2P5BA 5FZBA 1NAEA 4PQ9A 2AENA 2F4PA 1H8TB 1GOHA 2MHFA 3KCXA 3RQ0A 3N7LA 5LK5A 1U12A 1GICA 1QOTA 2WZPP 1VP6A 3WCSA 1O8PA 1G9AA 3L2YA 4FQZA 3ZMOA 2HWF3 4LBQD 3MDPA 5FCCA 1MR5A 5JLVA 3H0OA 3ZXDA 3FHQA 5FY5A 2E7QA 4H7LA 1R1A2 4IXLA 1EV12 1W0OA 3MIFA 1WW7A 3N9PA 2ZBJA 1ST8A 1MZEA 1GNZA 1E5SA 1AXZA 1AL0G 1OQEA 1DQ5A 5FXWA 1H6YA 4JTNA 3TEXA 2P3JA 1BCXA 4RA0A 4MO3M 1V9U2 3KM5A 2D7FA 1UWWA 2A70A 4COVA 5F5IA 2FDKA 5FR3A 4IQPA 1SLAA 4TSVA 3MF9A 4QQPA 3LEGA 1ZZ7A 5FZ1A 1YQ6A 2DCJA 1VBB2 5C71A 1RMU2 4BK4A 3SHRA 2X8FA 2WFF1 2PN5A 1WD3A 1VBE2 4FSJA 3J7LA 5KHGA 1ULPA 3NJVA 4XFCA 2A6VA 4BOWA 4IV1A 4CDXA 1AYM1 1LU2A 2AEZA 1AZDA 1BVP1 3KVBA 2I74A 3MW4A 4AAPA 4AK3A 5ACA3 3WF0A 2Q1ZB 2NQYA 2TBVA 2OS2A 3N9LA 4XFAA 4ISRA 5IATA 1GWKA 1LEMA 3R4UA 5DZEA 1UYYA 2Q4SA 5D21A 5APAA 2QNKA 4AI0A 5A33A 1IG3A 1KQRA 2VCCA 4NIHA 2IXKA 2HWF2 4FOVA 2BVBA 4NOVA 3HAGA 4P00B 2TNFA 5AYDA 1KS5A 1PHMA 2HJIA 2WS91 5FYZA 3RWKX 1OA3A 2A6WA 3D6EA 3QH6A 4P14A 4EE2A 1XU2A 2WO3A 4TYSA 1F8VA 4FTEA 4MVTA 4Q4V1 2UY8A 1W8FA 3K2OA 4YW4A 2P1BA 2VVFA 4XHXA 1AR83 4A41A 1UOGA 1XC6A 5K0UB 1WGPA 3ACFA 3ZLIA 5KWRA 3MW2A 4AVVA 4Y20B 4W6YA 3IAPA 2ZXQA 3AP6A 5FPXA 2C6SA 2VOKA 4A3XA 2NM1A 3WCRA 5C8CA 1W6MB 1S4CA 4L99A 4QPYA 5I0DA 1W9SA 4EWEA 4AHXA 2KR2A 1QJY3 3HOBA 2WIIB 4GJZA 3LAGA 1X9TA 1RUC2 5GLNA 1D4M3 1IPKA 3MIGA 1UY3A 5JDBA 3AC0A 4YRDA 5A7OA 1OFSA 3OPTA 1VLNA 4CCMA 3IBMA 3S7EA 4AQ2A 4QQSA 2VO5A 3VZMA 1OF3A 2A6YA 2QCSB 5ACA2 2O0OA 3BUCA 5T3NA 3U10A 1VIWB 3KQRA 4YW6A 4PVIA 2WKKA 1K12A 4C0BA 1BQPA 4E8DA 1GWMA 4OQ8A 2GMEA 2VQTA 2DBNA 1RUF1 2VMCA 5ABJA 4OFGA 1K5MB 1DGWA 4CSWA 1TL2A 4J6GA 2BFUL 4LBQB 5A32A 2YYOA 4MYEA 3O0XA 3LIHA 4AFDA 5IVVA 4KG8A 4AK7A 3NV2A 4DXRA 5KR7A 1SACA 3AYEA 2RS11 2WLPA 4B8EA 1GWLA 1WCQA 2XJVA 2VZ3A 3K48A 2OYZA 1WCDJ 3LV4A 1RUH3 5CFCA 1I1EA 4OHWA 4LO7A 4WM8C 1JZ7A 3DPRA 4AI3A 3CJIC 3NNGA 2BTVC 5JOZA 4B1LA 2B9VA 1VBA3 4G3YC 4LOSA 3UKTA 1ND3C 2ARAA 5AVAA 1GBGA 4I09A 4AK6A 2AR6A 4LKSA 3OM6A 5F8PA 1CAWB 5FMOS 5FZHA 2XPJA 1TZOA 4XJUA 2LS6A 1TNRA 2VMGA 2ZGKA 1FMD1 3D4KA 3HN1A 4LJHA 1AL21 4M3CB 3I7DA 4XF0A 3T0AA 4HL0A 3QEEA 4MHUA 4D6RA 4XUQA 3D5ZA 3P3PA 3AB0A 1D4M2 3MICA 2JICA 3O1UA 3KGZA 1YFWA 4OMDA 4NR1A 1XRUA 4ATFA 1LHVA 1EYBA 1OOPB 2OQ7A 4NHLA 1BEV2 1M4WA 5F3GA 3W21A 2EXHA 1YFYA 1J3QA 3PIJA 3ZFGA 4CCDA 5GLVA 4E2SA 4QKFA 1H9PA 3D3AA 3GM8A 1S0EA 2QVSB 4XQWA 2NMNA 2D6MA 2X10A 2ZKNA 1W2OA 3GJAA 2B4KA 3A0KA 4FOYA 1NYWA 2VY0A 2ZTNA 3HNBM 1OA4A 3ZDVA 1FPN3 1POV0 1ZBA1 2OIIA 3DGTA 4E4SA 1W6NA 3K77A 5JCTA 2HH9A 1QHDA 1VBD2 4COYA 2A5ZA 1Q56A 4QHBA 4XE9A 2CAUA 1OMIA 1RHI1 5FZ7A 1LEDA 1RUH2 5C3OA 3GDBA 4D94A 1JYNA 3JQWA 5JOYA 5IK8A 3WP4A 1N1YA 1UL9A 3J4UH 2R49A 3E6DA 3QH7A 4ZKTB 3WN2A 4JGYA 5FYTA 4HPKB 1VBA2 2B39A 1D2QA 3RYRA 3TAYA 1CX1A 1J3PA 2PLV1 4RQPB 5JI9A 1F5JA 5A6XA 2ZEYA 1NCQB 1ULEA 3OGVA 4RD7A 4B7EA 3UL2A 2Q30A 4OUEA 4XETA 5IVJA 2J1SA 3M3EA 5CU1A 2WL1A 4UOJA 3VN4A 4S2HA 2X8TA 1FI2A 1RVF2 5FAXA 3JBG1 1CWPA 3J7HA 2XG3A 4LNVA 5GZEA 1BBT3 4CEYA 1J59A 2C24A 4I3GA 3ETPA 1PO21 3FN9A 3S7IA 3GBGA 2C4XA 1TG7A 2B8MA 2HWD1 3BIEA 4MXVA 4OHVA 4YZ3A 3VBRC 3WF3A 4IEQA 4UFJA 4DRVA 2ZOEB 3IPVA 1H2NA 1AR71 4LHLA 2XBO3 1DGRN 2QDRA 1DFQA 3LFMA 1H8TC 5EYYA 3AFGA 2HYXA 2WRAA 3POJA 3UJOA 1MS0A 5FO7B 3WF1A 1A78A 1C8NA 4KWJA 4DFSA 5AY9A 4K6BA 2D5FA 1LOEA 2LALA 3FUQA 3KF3A 3WVJA 2VCAA 3KF5A 3NAPA 4XBQA 3JXSA 1GANA 1W9TA 2JE7A 4LIVA 4AOCA 4FAGA 2VMFA 4XUPA 1WCUA 2BGOA 4BISA 3TEWA 2EVXA 2Z42A 4QT6A 3WP6A 5A6ZA 5DDJ1 2VNRA 2O8OA 4Q5OA 3B94A 4JRLA 3IDBB 5IVCA 2P37A 3WP5A 3TYJA 1NCRA 3JB8A 2RDNA 3BGAA 1XOYA 4N9IA 3WG2A 3KS7A 1LGNA 3OBTA 2W1UA 3VZOA 2GAUA 2P6HA 2Z69A 2CY6A 2JX9A 3POWA 1FX5A 1XNAA 2RS51 3LDBA 2DDUA 3C7GA 5JXGA 1IS6A 3WDYA 4CDWC 1X7NA 1XJAA 1MQTB 5GJ6A 5A7SA 4K9SA 3FFZA 3UV9A 4MG2A 4QQOA 1JOJA 5HBAA 1FT9A 3INAA 3WQ0A 2V5DA 5DMYA 2E31A 3ZSJA 2J1EA 1ZZBA 5KHKA 1PO11 1UU5A 1RGSA 1WL7A 3ETQA 4PF5A 2RJ2A 3AJZA 3DXTA 4O7XA 4IEXA 5FZ8A 1GUIA 4N53B 4AXOA 2JD9A 4DQAA 5FK7A 5B4NA 4Y5SA 2R1BA 3NSTA 4DY3A 4RGGA 2P3YA 1MS8A 1RUE1 4QXBA 1PMHX 2LM3A 5FYHA 3M3OA 1XYPA 4HSLA 4I02A 4QGMA 4DIQA 4AEDB 4F8AA 4RFRB 4UFHA 1N1VA 5KC5A 2A75A 1R1ZA 1HV1A 1J83A 3VBOA 1TQ5A 4N2ZA 1SFYA 3KT4A 1KDKA 3QACA 5JSOA 5K0UC 3J7NA 4S2GA 1WWYA 4GKYA 2PAMA 5HXVA 4X8NA 4XF4A 5IAVA 1SLLA 5FPAA 5EYXA 5FOBB 2WS93 3MFAA 2VULA 4N4BA 3RZJA 3LA2A 1O6UA 3WDXA 1C1FA 1HKDA 2D40A 3ZPOA 1XU1A 3V0BB 3PL0A 2MNGA 4H14A 4XF3A 3LA3A 5DABA 2VOXA 2DFCA 2D6KA 4D7TA 5EIYB 4FPHA 1US2A 1JOPA 2ADDA 1XSRA 3HVDA 3KB5A 1X8EA 3HQRA 3AKHA 1AXYA 4IV3A 4KU8A 5FQ0A 1XSQA 5FYCA 3O5SA 3P5BA 3VD5A 5C3SA 1O3TA 5A6QA 5JUVA 3GXUA 2QQIA 2JDHA 3SMHA 3LDKA 4WVWA 1MS1A 4XJZA 4EROA 3JQXA 4LKDA 1O5UA 5F7UA 5H9PA 2YZ4A 4M3CF 4RL7A 4EN6B 1SPPB 4EV0A 1O8SA 1NUKA 4QXCA 1J3RA 3T2OA 4B1MA 5IHRA 1K5MA 2ZGQA 5FZ9A 4BQWA 4CDQC 4LBQA 4NHMA 1RUF3 3PHMA 4YVSB 2YFSA 1Z7S1 2K9ZA 1VKDA 5C0PA 1YQ8A 2D6PA 1ZREA 1W8WA 4N9HA 1GYEB 5GZFA 1DP0A 1GSLA 1XPWA 4V2VA 5HCFA 3VSSA 1S0FA 2AEYA 2R061 3ZYHA 2EIDA 2RS13 3N9NA 3ZSLA 3IDAA 1VB4A 4WVMA 2CGNA 4Q0PA 4AVAA 3OD4A 2WYFA 4HXCA 1UZYA 4XF1A 2V4VA 5LW9A 5DN2A 4I0WB 1COV3 4U6BA 3MLKA 4UFIA 2V73A 2B46X 2W3JA 3KT7A 3RZGA 1QXPA 4HT1T 1WW5A 1BMV1 4G4FA 4LHKA 4LK7A 4IE4A 3MLLA 4PIXA 4BJ0A 2GNTA 4CPBD 1V6NA 1FMD3 1XYNA 4LBOA 3J8F1 5IK7A 2MPFA 1QDCA 4ZXKA 3VHPA 3TN91 2IVJA 1Q8VA 3PMEA 3N9QA 4MGKE 4BMEA 4LORA 4QB1A 3C3VA 4A7ZA 1TMF1 1OOPA 5BNQA 3TRSB 2DTYA 3ZYGA 2O8QA 4PF1A 1AXKA 5A7PA 4J1WA 3IDEA 4INDA 3IAQA 1PIV3 4RHV1 5LRSA 1W8TA 1JYVA 4CEWC 4D6SA 1RUI2 5K9YA 2PHLA 1UOBA 3BYLA 2WO2A 4I0AA 3OCPA 3AL5A 5A3TA 4DO0A 3AKGA 1RUF2 3OUHA 2BEOA 4OYUA 3LIGA 2V5YA 2VVDA 5E88A 1O5LA 3W20A 3RZMA 3KD4A 1UY1A 4RQPC 1HQNA 4RSUA 1NCQC 1ZBA3 4P9GA 3AXDA 4LEJA 3MIEA 2VCBA 3WAUA 5FYBA 2CNAA 2GN7A 4WM7A 4XUNA 4XAEA 1RHI3 4AQTA 1ZZ8A 1BXHA 3T0DA 1SCRA 4HPKA 4ZU7A 4KU7A 1COV2 5FUNA 2YFRA 5J48A 4NWWA 5FZ6A 1LGCA 2BNNA 2XL9A 1SHWB 3ATGA 3KCCA 3NVCA 3AP7A 3RZHA 3SH4A 3VL8A 2JDYA 5K8SA 2XR4A 1HXS2 5FZ4A 4IESA 1FMD2 3OBZA 3T4VA 4Q29A 1NE6A 1RXFA 2Y6KA 5IK5A 3S5QA 4COWA 3JBG3 1SEFA 4LO4B 4BM8A 5I0RA 2OXBA 5DXDA 1Y4WA 1H2MA 2BNMA 1RL3A 1VRH2 2HWD3 3N9MA 4FFIA 4LUKA 4PDWB 3VT1A 2XVKA 5A8DA 5FZ3A 1PIV2 2VZQA 2BERA 1PMIA 4HMZA 4W50A 4UDJA 1AR73 2J1TA 4LR4A 2Q1FA 1GU3A 1PZ8A 3BODA 3E5UA 4BYYA 1GOGA 1REDA 2OVUA 1UZZA 2GC2A 2QZ2A 2WZEA 3B3QE 1UYZA 4GJYA 1LHUA 1NY71 4IERA 4UF0A 4XOGA 5JSPA 1JBCA 1ZBA2 3VBFA 3U4XA 3AKSA 5FUIA 1LCLA 3WHUA 4CXYA 3ZM8A 3KT1A 2IXIA 4LK6A 2WAAA 2HYKA 2A1XA 5LCWL 1YFXA 2XJSA 3ME2A 4GIQA 2RMU2 4JCKA 3VT0A 3UT0A 1MQTC 1UN1A 4IGOA 5BNNB 2WBKA 2E33A 5DDJ3 1QNYA 4XVHA 5G04L 2W1QA 3DECA 3H1MA 2H6BA 3WQ7A 1ZNPA 4ISQA 4CCCA 1X9PA 2HWC3 4K20A 4ZS2A 2B42B 1W2NA 4H55A 4AI9A 4COZA 2NN8A 4XURA 2LTNA 4N53C 1E57A 4HN1A 4Q4Y1 4CU7A 2FDHA 2Z5WA 3JBG2 1CAVB 4XILA 4NOTA 1XNBA 2RS53 5DAXA 4AEDC 4JVAA 5GLWA 2VW1A 1LHWA 2ZEWA 4EN0A 1SDDB 2K2SA 5C9AA 5B6SA 3T2TA 3ZR5A 1AR72 5F3IA 4I3PA 4XJ8A 1KJLA 5JR7B 3B9CA 3GZEA 4TTGA 4YZ1A 1PO13 3RJ2X 4XZPA 3VT2A 4QPIA 1I6XA 1LOGA 1CAUA 2P6CA 4I01A 3VKNA 2X5IB 4QB6A 3B7MA 1RYYA 5F2WA 2A3XA 4NUBA 5J98B 3I2OA 3IWZA 1RUE3 1FOD1 1OLME 4IE7A 4JAAA 5SV8A 1QJU1 4EYUA 4PI2A 5CFDB 2DVBA 4ZHNA 2JDAA 3KSCA 1NZCA 5FP4A 2D6NA 3R4SA 3FJSA 1JHNA 1WMDA 1JYCA 2JB8A 4Q26A 4V2WA 1X33A 5HCAA 3O1PA 1ULCA 2EXIA 5DDJ2 3VKOA 4PCRA 1JZ3A 4JGZA 3LSEA 3PUAA 3B5LB 1VALA 1Q8OA 3T4HB 2PHTA 4NN0A 2H6CA 3POFA 2HWC2 4L97A 4OI2A 4YM1A 1KFUL 2ZGSA 5CZKA 4Y1YA 5FLIA 3SCFA 4D7SA 1XNKA 5FY1A 1AX1A 2ZX4A 1UAIA 1UQXA 4XFIA 5FZOB 1HQLA 3N4MA 3LWCA 2G9ZA 4CCLA 4QQHA 2ARXA 5AVPA 4CU9A 2RS52 3RMXA 3WHTA 2DFBA 3M7AA 3NJXA 4B7KA 1W6OA 5IT6A 5IAXA 2W5FA 3D0JA 3RFRA 3ZVXA 5LBFA 1LODA 1YIPA 5T5OA 4LBKA 4R52A 4IGPA 4ITCA 3CJIB 3MIHA 4NHXA 4W65A 1NT0A 4QGNA 3I3QA 4YVSC 2DURA 2Y6HA 1PO12 1QOOA 5A3MA 2FDFA 2W52A 3AX4A 4YZ4A 1IG0A 1ZYBA 2ERFA 2WT0A 3L2HA 1WLCA 2JIGA 2QE3A 2WWJA 5FP8A 1J84A 3NRUA 4K21A 4M4RA 3C7HA 5DAWA 3ZIXA 5J96B 5JMCA 5FPLA 1BZWA 2ZKLA 3AVRA 2UYAA 2VJXA 3VD3A 2IXLA 1WLDA 4M4PA 2OPKA 3K51A 3P1IA 1OD5A 2YXSA 3PVNA 4HZFA 4P9LA 1V6MA 5GZDA 3HJRA 3WDVA 3AMHA 1JODA 4CVUA 1Z7S3 4OI4A 4BLJA 4PIYA 5LA0A 3SNMA 2B9UA 3SISA 1EAH2 3EO6A 5JOXA 2XXZA 4FBFA 1PVC1 2R071 2ATFA 2E63A 1JHJA 2R063 4TLFA 5H9QA 2W0XA 4DUVA 2WNUB 3LD8A 5IUQA 4JQRA 2FBEA 3DXUA 4RN5A 1UZ0A 1O59A 2NLRA 3M8LA 4WZFA 4JZRA 4QPGA 3WNMA 5A8CA 3BYNA 5FLJA 4CP2A 2RR11 4Y4YA 4BCUA 2Y8KA 5BY5A 2CTVA 4JKKA 5FYUA 4COTA 2BZDA 2JDMA 4Y4RA 1I3HA 1RIRA 4S2DA 2P2KA 3EHKA 2OA2A 5FTTC 3EQEA 3AM2A 4HKLA 3FL7A 1OD3A 3HWJA 4L2NA 3GYDA 1CR7A 1LULA 1WLWA 3J8F3 3NKGA 2FMYA 2DTWA 4P9YA 1BVVA 4RS5A 2PHXA 1NLQA 2CDPA 1IGOA 3AXEA 4TZDA 4GB32 1C8M3 4BU2A 5C5UA 2QQJA 2EIGA 1PVXA 3T0BA 3KV6A 2OX0A 2EIEA 4RHV3 2XONA 4AQSA 4BPZA 3OYWA 3O1OA 5KXEA 2J1VA 5FZMA 1WZXA 2W68A 3BTZA 3B02A 4AQ6A 4Y22B 4MUVA 4NROA 2Y6JA 1H0BA 1B35A 4HN0A 3PMSA 4BZ4A 4IEVA 1YFUA 1WCKA 3OF1A 4KI5M 5A7VA 1G86A 3HBKA 1IOAA 4M3CE 4XMIA 2O1QA 3POEA 2XDVA 1EPZA 2R0FA 3PJYA 4PDWC 1D2SA 1Q3EA 2BGCA 3MHZA 3S0MA 4OUMA 4GQ7A 2ORZA 1OQDA 2WT1A 1W9WA 1BMV2 5B6TA 3AJYA 2VBBA 1POV1 4OHZA 4BQYA 1HRI2 3OEBA 2DF7A 2KD7A 1DQ4A 2JKXA 2O14A 2NYYA 1DQ6A 4YPJA 3OOXA 5GZGA 5FZLA 3RZLA 4DXSA 3J8F2 3JCIA 2VUDA 2BQPA 2HBUA 1UW8A 3HN3A 4QAWA 3AKPA 4ZU4A 1C8M2 5LRRA 5KXDA 2WZR1 2J1UA 2OPWA 4Z2WA 2BBAA 5CG9A 2PHRA 3OTFA 4Y3OA 2E51A 5FZCA 1AJOA 1VRBA 1IKPA 3JZVA 4XEZA 1CJPA 3VZKA 2XLFA 1DBNA 5FY4A 1BHGA 3QC2A 2QQUA 4QX2A 3JB4C 1QQP3 4QD2A 4Q0UA 5BNNC 4OI1A 1NA1B 4M00A 5JWPA 3VSFA 2XGXA 4CDWB 4PJYA 4LUMA 5T5LA 3FLPA 1VJ2A 4LBMA 2FDIA 2RS31 3Q8BA 5L73A 4DRRA 4QQ2A 4Y1ZA 2HLEA 4FPGA 4LMFA 3CQOA 1SLBA 5I91A 3V65A 3C7EA 2VECA 3WNLA 3UKNA 4YARA 1R091 2GH2A 1KD7A 3FLRA 4QHZA 4CPBA 4XAAA 2VPVA 4N43B 5CAZA 1LOAA 4HFSA 1QGLA 4JV4A 4HKWA 4AF9A 1SBFA 1PNGA 4XF9A 5FREA 2J1RA 3PTRB 2H0VA 4XFHA 4LLFA 2X5IC 4Q4Y3 1RINA 3O1TA 4YM0A 4B3NA 1Y9GA 1ZX5A 3EXUA 3IKWA 4FOWA 1OH3A 3S6PA 1A8MA 1F15A 2A71A 5CFDC 1UO9A 4JRAA 5H9SA 1BK0A 4LHSA 4KBBA 3USUB 5C3QA 2FCUA 3ZYPA 1QQP2 2X53S 2X5IA 4UYBA 3NNFA 1QH6A 1IKQA 4LIUA 4Y1VA 1HIXA 4NHYA 2ZHMA 1GZWA 2I07B 3WF2A 1LOFC 3ZFFB 3F2ZA 1U5YA 3HQUA 4Q4W1 1FOD3 1UD1A 1QJX3 3AKQA 1ASJ1 5HV0A 1W6PB 2ZHNA 1QJU3 1XBFA 1WUVA 2PELA 5LA9A 2PQQA 3HD8B 3UESA 3H42B 2C9AA 2WN3A 2QZ3A 3JD71 3OB8A 1DQ0A 1UMHA 2CV6A 2P4EA 2VOWA 5GLTA 5AC93 3IT8A 1AR93 3ZOIA 5F3CA 1C5IA 2VQAA 4TWTA 2YG0A 1ZRFA 1AYN1 2I2SA 1YO8A 3VDCA 1HRV1 3T08A 2RDRA 3N7MA 5G05L 5C4WB 1JS9A 3OGRA 5JZGB 4ONUA 3ZFEB 2GZWA 4O9EA 3WF4A 3ZXGA 4AHWA 2CSGA 2DWRA 1LGBA 3ACHA 2WQ4A 3RSJA 2DCTA 4CDQB 1WW4A 4NIIA 1N3QA 1AR82 2W08A 4QDSA 5A7WB 2WABA 3WSOA 3AP9A 4Q4Y2 1OH4A 1W8ZA 2UWAA 4CDUB 3K4DA 3GCWA 2VTXJ 4WM8A 2UURA 4LE4A 2YHJA 4QWNA 3RVHA 3CJIA 4YG0A 1QH7A 1QJY2 3IIIA 3BPSA 5FWJA 2ENRA 4NVPA 1JH5A 3MI8A 1QJEA 1MVEA 1ND3A 1UNBA 2WNVB 3ZSEA 4QXKA 4JKMA 3OM5A 5JR2A 1JN2P 3VKMA 3PDQA 1QEXA 1U5IA 4KCAA 4FO9A 5A1AA 3A4UA 4MV2A 2XOMA 4LA3A 4LO5B 2JDZA 5JPNB 1FOD2 1F4HA 1QJX2 1ZBE3 2WNUC 1JUHA 1QKQA 3LQCA 1CONA 2HWB1 1QJU2 3UKVA 3PNAA 3WATA 5E1RA 3ZSMA 4L92A 3O12A 5AC92 5FZDA 4QKNA 2WA3A 3H8RA 5FXVA 1AR92 1QXRA 2DCZA 4K8FA 2RDQA 1SCSA 4LA2A 3LPFA 2XJPA 1RUD1 2JDNA 4MH0E 3H7JA 3CL1A 4CEWB 1AR63 4S2FA 1PVC3 3RWNA 1HX6A 2WINB 3OGSA 1EUUA 4YVWB 1FV2A 1STMA 1GV9A 3AVSA 3RZKA 1SMVA 5A80A 4KMQA 4UW5A 2CWMA 2D3RA 2QQPA 4QQLA 3TB0A 2F17A 4GMP1 2CDOA 3PVBB 4PLMA 3VB9A 2XLGA 2RR13 1L7LA 2ZX1A 5JIAA 4NIAA 5DAPA 4BHPA 4WV8A 1YUDA 1K3IA 3ZN4A 4Z07A 2VCMA 4A6OA 4DY5A 1JOBA 3VV1A 1RJ8A 1V70A 1W99A 2DUPA 5D8AB 4KCBA 4XBNA 1L7QA 4QHOA 1W0PA 2W87A 4BQ3A 1OPMA 4ARXA 4W6XA 5FZFA 2BJSA 3KZ4C 4TXWA 1Q8QA 3U4SA 3ZXFA 3HNMA 4NO4A 4EQVA 5FXZA 5CA6A 4ONZA 1LHOA 1NE4A 1ZBE2 3H3LA 2JG8B 1X8MA 1UYXA 1GYKA 2ZGPA 1ND2B 1HB1A 1HN0A 1O3QA 1FPN2 3G6JB 3ITQA 5ANQA 3H8UA 3CZUA 5FY9A 1WA6X 4R4ZA 1A6CA 4QGLA 3VBRA 1ZZCA 1OHFA 3P2NA 1V00A 2BVVA 4JX0A 1PK6B 3B69A 1H8TA 4R9CA 5E6HA 2A7AA 4FXGB 4LULA 4GWIA 3LSDA 1AR62 1PVC2 3VHNA 1S0CA 1ENSA 1EY2A 2BU9A 3NNJA 4MGYE 1OLMA 3OG2A 4RGAA 3VZNA 3R4YA 5BNOC 3WPZA 1P8JA 1GKBA 3K3OA 2EICA 3MYXA 2XH6A 2QBXA 3IZOA 3NWKA 3VSRA 3MW3A 2WT2A 4BQ1A 1VMHA 5FMCA 2RR12 1QWRA 2BP6A 1R64A 2XUMA 1FNZA 4AEMA 1R081 4ZY9A 1UOJA 3H3UA 1O4TA 1DGWX 5EJ1B 3WT3A 3ALQA 1A34A 4BB3A 2KA3A 2XJUA 1POV3 2L9LA 4FPLA 1BBT2 1NA1C 2E9QA 2YU1A 4HVOA 4P5HA 2Q8OA 2VXRA 4MGIE 1W9YA 5IVBA 2NZ9A 2Y6GA 3RI9A 4OI0A 4KWLA 3K1UA 2XBO2 3HR9A 5JXJA 2WZR3 4CCJA 4LKEA 3I2DA 3I59B 3AZYA 4KGGA 1U5ZA 2CL2A 3O14A 5IVYA 1MEC1 2WFF3 4J25A 4CDWA 2ARCA 1UIKA 1LAJA 4XTMA 1VAVA 2UYBA 2RV9A 4AFBA 1LOCA 4LBNA 3PUQA 4IEPA 4AI1A 2EA7A 3HBZA 1AYM3 2QQOA 3J26N 3C2UA 4N43C 4ZS3A 2PMWB 1NLRA 2AC1A 5DAQA 3ZYRA 2VZUA 3L9JT 2RS33 4CTEA 5A3UA 2R7EB 5ANNA 3MUZ1 1PZ9A 1H1AA 2VL4A 5JSRA 2YGMA 1G9CA 1JI6A 4SBVA 4YW7A 4B4QA 4AYUA 4C1WA 1R093 2Q0AA 1W8NA 1PGL1 3WW3A 5DG2A 1QNWA 1H30A 1UMIA 1U5XA 1W6QB 2RDSA 4GKXA 2HEVF 1GP4A 1DG6A 4NAOA 4X6QB 2P34A 4XIOA 1X50A 1CPMA 2VW2A 2ZPXA 1CAXB 2RJLA 1UY4A 3B9IA 5GLLA 1WBLA 5JXIA 2QFEA 3U78A 5K0UA 3DUIA 4Q4V3 4LBLA 3J7MA 3M4FA 5FY8A 2V4AA 2YFZA 1QY4A 4Y20A 5LK7B 2IXJA 3HQXA 2Y6LA 3VDDB 2BWAA 3DL3A 5C3PA 1JYTA 3WMYA 2RG4A 1W6MA 3ZFFC 4HVQA 1Z0HA 4BE3A 3SH3A 2P3IA 5FPBA 3USUA 3AYAA 4H7MA 3POGA 4LITA 3TNQA 1UPIA 1YC61 5JMOA 3LCPA 2VZRA 4XZUG 4JTOA 5EJ3A 1KDMA 3LA7A 2WFF2 5L9VA 4AEJA 4URAA 5E16A 2D44A 2ILMA 5DAVA 3TWIA 5BUVA 4WVZA 3P3NA 4AFAA 1ULFA 4BQXA 4BQ4A 2ZACA 4FQ4A 4X8PA 3NV3A 1RUNA 1AYM2 3ZFFA 3LE0A 5JOWA 1UMZA 3IB3A 4MXWB 3ORJA 5C4WC 1LESA 2R041 3LPGA 4GMP0 5JZGC 2ZMLA 3ZFEC 3NW4A 4CP0A 4CU6A 1H8VA 3DF0A 4XQDA 4ASLA 2K0GA 5IW0A 5A3LA 4Q4W3 5A70A 1ASJ3 2IZWA 2XB6C 4FAHA 2OW4A 2Y60A 2IFWA 4F3JA 1H2LA 2Q1MA 3NKTA 4KWUA 2VC9A 1SFNA 3JD73 4XDOA 5DPNA 2GN3A 4ES9A 5BXXA 2FDJA 1LNSA 2WO7A 4CDUC 2ZGMA 1YRZA 4YGBA 5D2AA 1EP0A 3WG4A 5FLWA 4Z92B 5JZGA 4FFGA 1HRV3 2WS92 2NP0A 2GP3A 2QQLA 4L11A 3CJXA 4QPWA 5F5AA 3ZXJA 4CDQA 1WLTA 3VBHB 1FNYA 2J1AA 5A7WA 3PLQA 3ZN5A 2WNVC 1Y9QA 4MGQA 2XWBB 1N1SA 4Q4V2 4N2RA 1W8HA 2E53A 1CAWA 1RB8G 1FV3A 2VH9A 3ILRA 1GOFA 4Q27A 4P5YA 4XABA 4O8OA 3QCWA 4M3CA 1W18A 3ZMNA 3POSA 1RUJ1 5L7OB 2BUKA 4P9XA 3M70A 1UF2C 5FZIA 5LA2A 5LATA 1AL23 3VD9A 2TEPA 3W58A 4EN8B 4AI8A 4K40A 4C8DA 3POYA 3VBUB 2WR9A 4JHZA 3TBDA 2VZSA 4N90A 4XCBA 1VMFA 3POIA 3WNKA 4W6WA 4AI2A 5GLOA 3OSDA 1R1A1 3I2FA 4PHZA 1W2TA 4YVWC 2PAEA 3ZX7A 1I5PA 4FPYA 1ASJ2 2ZX2A 2HWB3 3ZXEA 2VG9A 1J1LA 1WMFA 3WPYA 1MZ6A 2FMDA 3GHMA 4L9BA 5DUUA 4D3WA 2YC2A 5LY2A 1OKQA 1GR3A 1GZTA 1XE0A 2RS12 5GLZA 4D8MA 3RNSA 2VXJA 4CEWA 3C8XA 1HRV2 3VBSB 1YLLA 4GH4B 2XKPA 1VBB1 2G4IA 1RMU1 3WOGA 2DUOA 5D8AC 5HCBA 2E7AA 3WUCA 1VBE1 1DLLA 1VAMA 4P08A 4RQPA 3WW4A 1S2EA 5CIRA 3K4AA 1PM7A 1W05A 2D6LX 1NCQA 1W8UA 3CMGA 4O65A 3THPA 4E4DX 5JAXA 2PLV3 1UCXA 3QLQA 4GMP3 2JDPA 1RXGA 4H3WA 4D47A 3CU9A 1VPHA 1FXZA 5SV5A 4YNIA 1G9BA 1KRIA 4IE5A 1JZ5A 2JG8C 2Y64A 1Q8SA 2VMEA 1OUXA 2ZGTA 1AL22 4FT8A 1ND2C 3LEKA 1Z78A 4FI9A 5B2GB 3BTXA 3THTA 3M1HA 4NPLA 1OBNA 5ERLA 1PO23 2JWPA 4K7JA 4I30A 3RYKA 2A73B 1PK6C 3A22A 3W5NA 2XLAA 3ECQA 2XJTA 3RI8A 4NRQA 3WDTA 2Z79A 1CN1A 1GQHA 3URFA 4CA9A 2N7GA 2BV4A 2B7YA 1YJKA 1YCIA 3E6BA 4ORFA 2BBVA 3OGJA 2QKDA 3MPBA 4RYDA 3KSTA 1LHNA 3LEMA 3WPUA 1UPSA 2ET1A 3I4IA 1YEWA 3APBA 3LZZA 1Y3TA 5EZWA 5FOJB 5FP7A 4DPNA 3MIBA 1RHI2 2DBIA 3BPZA 4LE3A 2YV8A 4FFHA 1LU1A 3WG1A 3AL6A 4LKFA 2PHWA 3OBAA 5FLHA 1RUC1 3O7OA 4JKLA 4K8RB 3V56A 1HN1A 4AWDA 2ZABA 3VLBB 1ZVFA 2W9XA 5FPZA 4A2UA 3SEEA 4PQQA 1RTVA 3SC7X 3VKLA 3IMMA 5M0TA 4XYXA 2PLV2 5GZCA 2YB7A 5JI7A 2WSUA 4DOUA 2RM21 3ENRA 2AUYA 3MPPG 3NQHA 2XQRA 5EP9A 4IV1B 4KGQA 1H1IA 4CDXB 4HOOA 4IL7A 2D97A 5HPOA 1AUYA 1F2NA 2VQUA 1R083 3R05A 2BW8A 2JE8A 1UU4A 1MQTA 5EXOA 3I2GA 4AHZA 1MZ5A 3H1YA 5F37A 1JYIA 4CUCA 1PO22 4UDIA 2HWD2 4QKBA 3WLUA 4XTPA 4A4AA 2ET7A 4LQRA 4AL9A 3Q8CA 3RS6A 5C33A 2IXCA 4K1ZA 3VUOA 2QQMA 4GA9A 1OVPA 4BK5A 1W3VA 1Y9MA 3OD0A 3AK0A 4JC1A 4N53A 2GALA 5I8YA 2VDTA 1KEXA 4CCOA 1UY0A 1MEC3 2XJRA 4MGSA 4DB5A 1POQA 1ZRRA 2IWGB 4YLZA 1CQ9A 2F4LA 4LTAA 4WVVA 5GM0A 4QMAA 4YW1A 2PAKA 2E7TA 4Y1UA 3SKVA 3VD7A 4AEDA 5A3PA 1D4VB 5FDBA 1RUOA 1GYDB 2JD4A 4WBBA 2WNEA 1DGRA 5HXMA 1DYKA 2CGPA 1DZRA 2EAAA 2FZ1A 1C28A 5CNAA 5C8CB 4F83A 3NV1A 1UX7A 5C2MA 1BJQA 2JKBA 2DVGA 3M3CA 5FKBA 5FKCA 1OSGA 2WWSA 3VDDC 2ETEA 4N7IA 5EJZB 1UU6A 4E4ZA 2XJQA 1UYPA 3DYPA 3KCYA 5DQ0A 2ZA9A 4GULA 1BEV1 4XBLA 2BGPA 1GNYA 4O8PA 1Q43A 1E5IA 2J22A 4Y1XA 3V0BA 1R082 3ZN6B 5A3OA 3DYOA 1ZA7A 3W9AA 2C26A 3A0NA 3ZSKA 4F7ZA 3VDDA 2D3PA 1PGW1 3LGRA 5ABJB 4L0PA 1IQAA 4ET7A 5C8WA 3DV8A 5JIUA 3M3QA 1KS4A 3HT2A 1TME1 1VBD1
chains in the Genus database with same CATH topology
4B1MA 4N1IA 3WN0A 5GLLA 3WN1A 4UFMA 4QHZA 5JOXA 3D61A 3QZ4A 4QQSA 4U6DA 3KF3A 2YFSA 1VKDA 5C0PA 3KF5A 3VT0A 3WMYA 1GYEB 3QEFA 4PVIA 3VSSA 2X8SA 3U14A 2AEYA 4PVAA 1GYHA 2EXKA 5A8CA 3QEDA 3BYNA 3OM7A 1Y7BA 3C7OA 4CCCA 4COTA 1UV4A 4KCBA 3ZXLA 1OYGA 3LIHA 4MLGA 4AK7A 2QQWA 4HXCA 1Y9GA 4KMIA 3BYJA 3KSTA 4U6BA 4UFIA 4EQVA 3LEMA 3LV4A 4ONZA 3WPUA 5JOWA 3H3LA 3D5YA 5GLQA 5JOZA 4B1LA 4AK5A 4FFHA 3OM4A 5AYCA 5B6SA 4AZZA 3ZR5A 3C7GA 4AK6A 3OM6A 2B4WA 3P2NA 5A7VB 3VT2A 3UGFA 1YRZA 5FLWA 1ST8A 3SC7X 5FIXA 4O8NA 3IMMA 3QEEA 4FFGA 5AYEA 3U1XA 3D5ZA 3ZXJA 4UFKA 2XQRA 3NQHA 3R4YA 1WL7A 3R67A 3WPZA 3BYLA 3WMZA 3AKFA 5FK7A 5FK8A 3AKGA 4N2RA 3VSRA 3LIGA 3WPVA 3UGGA 5FMCA 5A7VA 2EXHA 3UGHA 3PIJA 4O8OA 4CCDA 4UDGA 5GLMA 3HBKA 5GLRA 3WASA 2X8FA 1W18A 2EXIA 4UDIA 3WAUA 4UFHA 4FFFA 4UDKA 4UDKE 2AEZA 1Y9MA 4N2ZA 5B6TA 3LF7A 3U75A 3PIGA 2VDTA 4KC8A 1YI7A 2YFRA 3K1UA 3LFIA 5GLOA 3OSDA 5JOYA 1GYDB 1W2TA 3ZR6A 3WN2A 4N4BA 3OM5A 4KCAA 4NOVA 2YFTA 5AYDA 3WPYA 4CCEA 3BYKA 3RWKX 3S5QA 4JQTA 3C2UA 3OM2A 3QC2A 2ADDA 5FKBA 2QQUA 2OXBA 2AC1A 5FKCA 1Y4WA 2QQVA 5FMBA 3AKHA 3D60A 3TAWA 3VSFA 3WATA 5ANNA 3AKIA 2X8TA 1UYPA 4FFIA 3VT1A 5A8DA 3ZXKA 3NMBA 3C7HA 1PT2A 5FMDA 3R4ZA 4O8PA 4UDJA 3C7FA 3LDRA 5GLPA 5GLKA 3LDKA 4UFLA 4UFJA 3VSZA 2EXJA 3C7EA 4D47A 1YIFA 2ADEA 3CU9A 5GLNA 4KC7A 5AY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B1M A;  4N1I A;  3WN0 A;  5GLL A;  3WN1 A;  4UFM A;  4QHZ A;  5JOX A;  3D61 A;  3QZ4 A;  4QQS A;  4U6D A;  3KF3 A;  2YFS A;  1VKD A;  5C0P A;  3KF5 A;  3VT0 A;  3WMY A;  1GYE B;  3QEF A;  4PVI A;  3VSS A;  2X8S A;  3U14 A;  2AEY A;  4PVA A;  1GYH A;  2EXK A;  5A8C A;  3QED A;  3BYN A;  3OM7 A;  1Y7B A;  3C7O A;  4CCC A;  4COT A;  1UV4 A;  4KCB A;  3ZXL A;  1OYG A;  3LIH A;  4MLG A;  4AK7 A;  2QQW A;  4HXC A;  1Y9G A;  4KMI A;  3BYJ A;  3KST A;  4U6B A;  4UFI A;  4EQV A;  3LEM A;  3LV4 A;  4ONZ A;  3WPU A;  5JOW A;  3H3L A;  3D5Y A;  5GLQ A;  5JOZ A;  4B1L A;  4AK5 A;  4FFH A;  3OM4 A;  5AYC A;  5B6S A;  4AZZ A;  3ZR5 A;  3C7G A;  4AK6 A;  3OM6 A;  2B4W A;  3P2N A;  5A7V B;  3VT2 A;  3UGF A;  1YRZ A;  5FLW A;  1ST8 A;  3SC7 X;  5FIX A;  4O8N A;  3IMM A;  3QEE A;  4FFG A;  5AYE A;  3U1X A;  3D5Z A;  3ZXJ A;  4UFK A;  2XQR A;  3NQH A;  3R4Y A;  1WL7 A;  3R67 A;  3WPZ A;  3BYL A;  3WMZ A;  3AKF A;  5FK7 A;  5FK8 A;  3AKG A;  4N2R A;  3VSR A;  3LIG A;  3WPV A;  3UGG A;  5FMC A;  5A7V A;  2EXH A;  3UGH A;  3PIJ A;  4O8O A;  4CCD A;  4UDG A;  5GLM A;  3HBK A;  5GLR A;  3WAS A;  2X8F A;  1W18 A;  2EXI A;  4UDI A;  3WAU A;  4UFH A;  4FFF A;  4UDK A;  4UDK E;  2AEZ A;  1Y9M A;  4N2Z A;  5B6T A;  3LF7 A;  3U75 A;  3PIG A;  2VDT A;  4KC8 A;  1YI7 A;  2YFR A;  3K1U A;  3LFI A;  5GLO A;  3OSD A;  5JOY A;  1GYD B;  1W2T A;  3ZR6 A;  3WN2 A;  4N4B A;  3OM5 A;  4KCA A;  4NOV A;  2YFT A;  5AYD A;  3WPY A;  4CCE A;  3BYK A;  3RWK X;  3S5Q A;  4JQT A;  3C2U A;  3OM2 A;  3QC2 A;  2ADD A;  5FKB A;  2QQU A;  2OXB A;  2AC1 A;  5FKC A;  1Y4W A;  2QQV A;  5FMB A;  3AKH A;  3D60 A;  3TAW A;  3VSF A;  3WAT A;  5ANN A;  3AKI A;  2X8T A;  1UYP A;  4FFI A;  3VT1 A;  5A8D A;  3ZXK A;  3NMB A;  3C7H A;  1PT2 A;  5FMD A;  3R4Z A;  4O8P A;  4UDJ A;  3C7F A;  3LDR A;  5GLP A;  5GLK A;  3LDK A;  4UFL A;  4UFJ A;  3VSZ A;  2EXJ A;  3C7E A;  4D47 A;  1YIF A;  2ADE A;  3CU9 A;  5GLN A;  4KC7 A;  5AY9 A; 
#chains in the Genus database with same CATH topology
 4Z1V A;  1QU0 A;  3VHO A;  4YFW A;  4D7Y A;  4GWN A;  1LR5 A;  2PHU A;  1MS9 A;  1RUH 1;  2IXH A;  3D61 A;  1T2X A;  4HK9 A;  3ZKU A;  2JEC A;  3H3Z A;  4ZU5 A;  1S0B A;  4OVE A;  1W2A X;  5CFC B;  3O1S A;  3QEF A;  3S30 A;  4BXF A;  1MEC 2;  2JXA A;  3RJR A;  2QQK A;  3GZA A;  4QB2 A;  3MFC A;  2WWU A;  3ST7 A;  1SPP A;  1RUE 2;  3I2I A;  5C70 A;  1UY2 A;  2HKX A;  2XVG A;  3ZXL A;  2EF6 A;  3K4Z A;  1L3J A;  1LRH A;  2BOI A;  1NXM A;  3WZ1 A;  2R04 3;  2CU5 A;  2VUC A;  1REF A;  2X8K A;  2AYH A;  3CKH A;  4QU1 A;  4YVS A;  5DUX A;  3VBH C;  4EN7 B;  3GAL A;  4YW3 A;  1GMM A;  1RVF 1;  4AVS A;  1VBC 1;  5IFP A;  2A6Z A;  4KL1 A;  3ZYJ B;  3BYW A;  4EWD A;  3FFQ A;  2GMP A;  4CRQ A;  4QX7 A;  5GLQ A;  1UZV A;  2CYF A;  2VZ1 A;  2ZZJ A;  5L7O C;  1VR3 A;  3DYM A;  4LHN A;  1SBE A;  3AMN A;  3I2J A;  5F1R A;  3AKR A;  3GHN A;  4XXP A;  3MO4 A;  4BXS V;  5DZG A;  1AX0 A;  3O0V A;  3B01 A;  5FJH A;  3ZFG B;  2D3S A;  3VBU C;  3WXP A;  3BOW A;  2P3K A;  4SLI A;  3I54 A;  4AVC A;  1C4R A;  2D43 A;  3BIW E;  2CGO A;  2CHH A;  2YRO A;  3AP4 A;  3U1X A;  3KHB A;  2UY9 A;  1YJL A;  1YI9 A;  4OZO A;  1NQJ A;  4ASK A;  3PUS A;  3ILN A;  5FZE A;  3DEM A;  3AKF A;  2VVE A;  5CKN A;  5KHI A;  1W6N B;  3A7Q A;  3RYP A;  1RUJ 3;  5LBB A;  2Y6F A;  3IMN A;  1GFF 2;  2A6X A;  5FYI A;  2QJV A;  4QDQ A;  3B00 A;  3I2H A;  1KGY A;  3ROU A;  3TN9 3;  2HWE 1;  5GAL A;  5CKQ A;  3PJQ A;  1PX3 A;  1TMF 3;  2ORX A;  2OT7 A;  3AMM A;  3VD4 A;  1K42 A;  3OEA A;  3VBS C;  4BLI A;  2YFU A;  5FZA A;  4GH4 C;  4UW6 A;  1R1A 3;  1TEI A;  2PFW A;  4PT6 A;  1UKG A;  5I0U A;  1RUG 1;  4CCN A;  4R4X A;  5FY0 A;  2FZ2 A;  2QQN A;  2QTW B;  5EFU A;  4XJA A;  3VL9 A;  4C1X A;  4HKO A;  1Z7S 2;  3VDA A;  1LEC A;  5HCH A;  1V6I A;  4XW3 A;  2VNO A;  4NWV A;  4CEY B;  2YMZ A;  1YQC A;  1NOV A;  4GAL A;  2OKX A;  5FO9 B;  2V09 A;  2R06 2;  4Q0S A;  1ZRC A;  3EB7 A;  1QXJ A;  1XNC A;  4IDZ A;  5KBF A;  1JU4 A;  4X6R B;  4FTS A;  5LZ6 A;  3AZZ A;  3IPV B;  2G19 A;  2PQS A;  3FWE A;  4NJ4 A;  1I5Z A;  1VBB 3;  3U0Z A;  1UXX X;  5EV7 A;  5FMO L;  2C5D A;  1LB2 A;  4K3U A;  2VZO A;  2WN2 A;  1VBE 3;  3ZIW A;  4FPJ A;  2YPJ A;  3T1L A;  4C91 A;  5A6Y A;  1VAK A;  2XQX A;  5IK4 A;  4CXX A;  4O9G A;  1ZZ9 A;  3N7K A;  4BA6 A;  4KG0 A;  1KIT A;  4OUS A;  4QM9 A;  1N1T A;  2AH2 A;  1IHM A;  1TNF A;  3NAP B;  3QD6 A;  4FPO B;  4JDO A;  4OCT A;  2G9F A;  1A8D A;  5BNO B;  3K46 A;  3TN9 2;  4ZZ5 A;  1DLC A;  4PDW A;  4UW4 A;  4QX1 A;  2R0H A;  1FYU A;  2ZHL A;  3BU7 A;  1TMF 2;  3OY8 B;  3BTY A;  3WN0 A;  4UFM A;  4R9B A;  1WKY A;  1EPW A;  3PVO A;  4RHV 2;  3CBN A;  3SEP A;  1G9D A;  4Q0V A;  1IQD C;  1VB2 A;  2W1W A;  3HIF A;  1F4A A;  1NCR B;  4EWA A;  4W4Z A;  4HSJ A;  2YPD A;  3MUY 1;  1Y7B A;  1QOS A;  1SBD A;  1XND A;  4E27 A;  3RDI A;  1W9F A;  4FPF A;  3WX5 A;  2FHR A;  1E5R A;  4IV1 C;  5BPX A;  4CDX C;  3BYJ A;  4EZH A;  4IGQ A;  2WA4 A;  3ACG A;  1NXD 1;  2VUJ A;  1AJK A;  4Q4X 1;  2KXL A;  1WME A;  4YYO A;  4AVB A;  5BNN A;  1JZ2 A;  3UJQ A;  2VOT A;  3ZO0 B;  1RUC 3;  3D5Y A;  2ZGU A;  3IM0 A;  5HI0 A;  1JW6 A;  1NZI A;  1OFN A;  2A3Y A;  1NLS A;  3AP5 A;  5A3W A;  5J3U A;  1WBF A;  3N7J A;  5FV3 A;  2B4W A;  4QXH A;  3KLS A;  5CYY A;  2RM2 3;  3ELN A;  1OF4 A;  3DKQ A;  1CAV A;  3ACL A;  4LLO A;  1DYP A;  4O8N A;  2GC3 A;  1CIY A;  3WEZ A;  4XJ9 A;  1F31 A;  4UFK A;  2BWC A;  3KQ4 B;  4L8Q A;  1LTE A;  1T6G C;  3VBO B;  2W92 A;  1B09 A;  3I3M A;  1DF0 A;  2FD8 A;  1W04 A;  1YYN A;  4XJW A;  5LBC A;  3WW1 A;  5J1X A;  2Y34 A;  2GC1 A;  2E32 A;  2D6O X;  4C0H A;  3I3B A;  4GZ9 A;  2GMM A;  3UGG A;  3AKT A;  1ULG A;  3J9S A;  5FYS A;  3RPQ A;  2RHP A;  4ARY A;  4EZ4 A;  3CLP A;  3R0R A;  3VZL A;  5GLM A;  5C8C C;  1GQG A;  5EHD A;  2WAO A;  3IDC B;  3FC0 A;  1CPN A;  2GP5 A;  5FYV A;  2WO1 A;  1J1T A;  3EJK A;  4UDK E;  4NE9 A;  4KH9 A;  3ACI A;  4Z82 A;  1K5J A;  1NY7 2;  4AFC A;  4CYD A;  5CFD A;  1G8W A;  4OLL A;  1CVN A;  1HJG A;  4QM8 A;  3LOB A;  1SG3 A;  4UWD A;  3CO2 A;  4AGV A;  2OUJ A;  4J1X A;  4YW5 A;  2ZCW A;  3GF6 A;  4AEK A;  5F9T A;  4IE0 A;  4IV3 B;  2VZV A;  5CEH A;  5L9B A;  5FQ0 B;  2JEN A;  2VQ0 A;  5ABJ C;  4TN7 A;  5AFE A;  1H2K A;  5CB7 A;  4V1P A;  3GNE A;  3FLT A;  3FBM A;  1K45 A;  3H7Y A;  1LOF A;  2TUN A;  3CZJ A;  3SIT A;  3PU3 A;  4CCE A;  2VD7 A;  1F5F A;  4JQT A;  1BEV 3;  2RM2 2;  3ZN6 A;  3UNP A;  1RUI 1;  5FZO A;  1OLQ A;  5CFC C;  1S2K A;  2ZHK A;  2ZX3 A;  2BYV E;  3DPR C;  3NMB A;  1GZC A;  1RJ7 A;  5FMD A;  1M06 G;  4A42 A;  2RE9 A;  4N7U A;  3I8T A;  1ONA A;  4IEZ A;  4DXT A;  1L7R A;  2XHK A;  1V6K A;  1DQ2 A;  3T2Q A;  5A1F A;  1TME 3;  1VBD 3;  2WC2 A;  3VSZ A;  1V6L A;  2JJ6 A;  1W2U A;  5KHJ A;  2YBK A;  3CF6 E;  5IJR A;  4BDV B;  1PX4 A;  3T1M A;  4WVM B;  4C90 A;  1S0J A;  1COV 1;  3BB6 A;  3MV0 1;  4BIF A;  4XMA A;  1OUS A;  2XKO A;  4UW3 A;  1US3 A;  5LBE A;  2Q8D A;  4FTB A;  4U6D A;  1OLR A;  4OUL A;  2JG9 B;  4N8M A;  2LUW A;  4Q8K A;  4XHB A;  4BQ2 A;  1YNA A;  3FBY A;  4CP1 A;  3ZFG C;  1HXS 1;  2ARE A;  1O3R A;  4PVA A;  1YHF A;  3SLI A;  2WSV A;  1C57 A;  3OM7 A;  4A3Z A;  1MS5 A;  3C7O A;  3U11 A;  4LO6 B;  1OQ1 A;  1RVF 3;  5FJK A;  1DYO A;  1VBC 3;  3VGI A;  4AHY A;  4MLG A;  1ENX A;  1H4G A;  2GH8 A;  3OPW A;  4Z2A A;  2GNB A;  3KV4 A;  1VRH 1;  3FE5 A;  3MEP A;  2JIJ A;  1X82 A;  1Y43 B;  2A3W A;  2WNU A;  2VMH A;  1PIV 1;  1G9F A;  2R07 3;  3DKW A;  4HON A;  2DVD A;  4UT5 A;  3HEI A;  2IUW A;  1BYH A;  3LB9 A;  4JHT A;  1IS5 A;  2PHF A;  3BCW A;  3WQ1 A;  2YBS A;  1XNT A;  5I0T A;  1DU3 D;  4TLG A;  3FHI B;  4YGE A;  3V0A B;  2R6Q A;  2VGD A;  1AF9 A;  1KXG A;  2VAU A;  3JUU A;  4FPK A;  4YGD A;  3X29 B;  4AZZ A;  5L19 A;  4JGY C;  5CG8 A;  5AYC A;  1ACC A;  1PGW 2;  4E9K A;  4QKD A;  1HB2 A;  1C1L A;  1W28 A;  3UGF A;  1TME 2;  2YC4 A;  1VMJ A;  4P9I A;  3S57 A;  1LOB A;  4NIG A;  2G9G A;  1LEN A;  1WCS A;  2H0B A;  2PTM A;  2RMU 1;  4WM7 B;  3W59 A;  3R67 A;  1I9R A;  3MV1 1;  4QX8 A;  4YM2 A;  5FZG A;  5FY7 A;  4UAP A;  2HWE 3;  5KXC A;  2DU1 A;  2B45 X;  4CEY C;  5FK8 A;  4GWM A;  4DEQ A;  5J37 A;  1OUR A;  2ES3 A;  4NHK A;  5KXB A;  4LPL A;  3O1M A;  3ZYI B;  3WAS A;  4NMI A;  1HDK A;  2C9K A;  1MAC A;  3OBR A;  4IEW A;  5BNP B;  5K4L A;  5T5P A;  2QUO A;  1NKG A;  2GND A;  4Y22 A;  1RUG 3;  1JU3 A;  4KBZ A;  5FFO C;  5FP9 A;  4XUT A;  1V0A A;  1VBC 2;  4PIZ A;  5DG1 A;  1WMX A;  3N35 A;  2VZP A;  1WD4 A;  4UBH A;  2R16 A;  3BOP A;  3BTA A;  4BH9 A;  3I3E A;  2ZJC A;  1SZB A;  2OZJ A;  1YI7 A;  3NAP C;  4OMC A;  4RR3 B;  2MEV 1;  4OHY A;  2R07 2;  3LFI A;  1W06 A;  2DVF A;  2XHN A;  4GD4 A;  1O4Z A;  1DQ1 A;  4HBN A;  3MLJ A;  4ES8 A;  3H50 A;  2FDG A;  1XXN A;  4ZON A;  3RG0 A;  2C1F A;  5EQU A;  4CP9 B;  4E2Q A;  3GGL A;  3MF6 A;  2BNO A;  3OGG A;  3I49 A;  3SKJ E;  2IVI B;  2XUE A;  3FZ3 A;  4CE8 A;  3OM2 A;  5TSW A;  4UF0 B;  1QDO A;  4HLT A;  3AYD A;  1VE0 A;  5FMB A;  2X05 A;  1W3X A;  5C6C A;  1NCR C;  1IPJ A;  3VBF B;  3ILF A;  5A3N A;  5BNO A;  4DUW A;  3IIA A;  2KM2 A;  2YBP A;  5DZF A;  3SQO A;  5HV4 A;  4A7Y A;  5F3E A;  3AMQ A;  1JZ6 A;  3R4Z A;  3C7F A;  2X09 A;  3OY8 A;  5GLK A;  2HWE 2;  1AVB A;  3MBW A;  3N3H A;  4CZS A;  1YXW A;  4FOQ A;  2YY1 A;  3GBF A;  5T55 A;  2BFU S;  2EXJ A;  4XIK A;  3SXW A;  5J09 A;  1AHS A;  3H8O A;  4HET A;  1OXC A;  2HWC 1;  2X29 A;  2R32 A;  2F6B A;  2ZGN A;  1NA1 A;  2XL7 A;  1HLC A;  3T09 A;  4AGR A;  4IEO A;  5F6K A;  5FBZ A;  5JXH A;  4N1I A;  3Q8A A;  3WD5 A;  4Y24 A;  5FYM A;  1TVG A;  1RUG 2;  2LW8 A;  2OZ6 A;  2DYC A;  4Y26 A;  2LRP A;  3HPN A;  3KV9 A;  3TEY A;  4NPM A;  4YW2 A;  5LWB A;  2CAV A;  1GNH A;  3HT1 A;  4Y33 A;  3CEW A;  1APN A;  3PTY A;  2RVA A;  3G7D A;  4B29 A;  1H1M A;  4HAN A;  1S0I A;  1GYH A;  2EXK A;  1ZZ6 A;  3ABZ A;  4AGG A;  1GP5 A;  1H6X A;  4XFG A;  4E8C A;  5LEJ A;  3WP3 A;  1OYG A;  4Q4X 3;  5A7N A;  1IS4 A;  5C9A B;  2R30 A;  3OPZ A;  3IN9 A;  4N43 A;  3VBO C;  2E26 A;  4RFT 0;  2SBA A;  1MS4 A;  4QPI B;  4PLN A;  2W46 A;  4YG3 A;  1NQD A;  1CAU B;  4XC9 A;  2NMO A;  3HNY M;  2BDR A;  1HB4 A;  4LXL A;  4AFM A;  5L9R A;  2VUA A;  1W03 A;  5I93 A;  3O1R A;  2JE9 A;  3OUJ A;  1HV0 A;  2Q5T A;  1SLI A;  3PVE A;  2ZAH A;  4A6S A;  5KHH A;  4GXL A;  2WZR 2;  1EAH 1;  4MSV A;  1IS3 A;  4DXZ A;  3OUI A;  1JZ4 A;  1RC6 A;  3AFK A;  5C7G A;  4JGZ B;  5AYE A;  5T50 A;  5E8A A;  4H2A A;  1D7P M;  4Q2F A;  1EUT A;  4IV3 C;  2JDK A;  4FXK B;  3AZW A;  2EIB A;  4MET A;  2WZ8 A;  4GWJ A;  4KNC A;  3WV6 A;  5CVR A;  3E6C C;  4R8H A;  2JB4 A;  4CUB A;  5FP3 A;  1ODN A;  4AW7 A;  4QX0 A;  5C3R A;  4D69 A;  1DDL A;  2Y33 A;  2BOJ A;  1T6B X;  3UGH A;  4A45 A;  4B4R A;  2K46 A;  3MZH A;  1W6P A;  4LBJ A;  1URX A;  2RS3 2;  4XCA A;  4NRP A;  3CIH A;  1W6O B;  1O4Y A;  2ZGO A;  2Y38 A;  4M0H A;  4M0N A;  3WNX A;  4KWK A;  3FX3 A;  1S1A A;  3AZX A;  1K5M C;  1R09 2;  4Q4X 2;  4W8J A;  3K75 B;  4AAX A;  2YC0 A;  4DUX A;  3LF7 A;  2VBD A;  5I8S A;  2Y26 A;  3E97 A;  5K7P A;  3S5A A;  1C5H A;  1J58 A;  4GB3 1;  2DUQ A;  1AYN 3;  2UWC A;  2W95 A;  5C4W A;  4QX5 A;  4YZ5 A;  2R1D A;  3AZV A;  3ZFE A;  3GZU C;  1IPS A;  2HBT A;  4LO8 A;  4IUG A;  2GC0 A;  2I45 A;  3WR0 A;  3RZZ A;  4URT A;  1DZT A;  3EYP A;  3O1V A;  1GP6 A;  4Q8L A;  2Z4F A;  3QBQ A;  1RUI 3;  4U2A A;  3USS A;  3WNN A;  2AAC A;  2E6V A;  3DCQ A;  3R4D B;  3VDB A;  4FPC A;  2GSY A;  4I0B A;  5FZK A;  5A7Q A;  4CDU A;  3BKZ A;  1G7Y A;  2QDN A;  3D0S A;  4R9A A;  4AVT A;  1SDW A;  1W90 A;  4CUA A;  2W2I A;  2W91 A;  1HJF A;  2JG9 C;  2Q8E A;  3V64 A;  4BMB A;  4YSF A;  3D60 A;  2VR4 A;  3M3I A;  2UU8 A;  1BK1 A;  1HB3 A;  1UIJ A;  1W0N A;  5I8T A;  1PZ7 A;  5JVV A;  1OVS A;  3ZXK A;  1JZ8 A;  1GQP A;  2WNV A;  2ARB A;  5GLP A;  4NPR A;  5T5J A;  1PMJ X;  1UOF A;  2JEM A;  4BWO A;  4XFF A;  3I2K A;  5J7M A;  3RGB A;  3T2P A;  5DUV A;  2VBP A;  4FP3 A;  3CNA A;  4UFL A;  5E89 A;  1F9K A;  2WQ8 A;  1MZF A;  3LEI A;  2JG9 A;  3MID A;  3ZYF A;  1OT5 A;  3U37 A;  1XE8 A;  1YIF A;  1OOP C;  4QPG B;  1EV1 1;  4UBG A;  2Y0I A;  1O3S A;  4Q4W 2;  4WZC A;  4EN9 B;  1GLH A;  1HRI 1;  5D1I A;  3WN1 A;  3VKF C;  5LB6 A;  1TE1 B;  4XPV A;  1HXS 3;  1ZRD A;  1C3H A;  1OC1 A;  3JD7 2;  1V9U 1;  4JDN A;  3AMP A;  5LA1 A;  4R9D A;  4LOT A;  1C8M 1;  1AYN 2;  5FXX A;  2X8S A;  1CIW A;  4P02 B;  4XFB A;  4RS5 B;  4P9J A;  3QED A;  4YVW A;  1VRH 3;  1RUD 3;  1MVQ A;  2J42 A;  3ZPY A;  1SFP A;  3CU7 A;  3ON7 A;  3UK9 A;  2QQW A;  4KMI A;  4WM7 C;  5A1L A;  3E5Q A;  3V0A A;  5FPV A;  2AZ5 A;  5F5Q A;  1LKN A;  3CHX A;  2GU9 A;  3ZXA C;  4HVR A;  1QIQ A;  3OYW B;  1XB9 A;  4XDQ A;  4E4H A;  2FQP A;  2NPI A;  2ZS6 B;  3THD A;  5BV6 A;  3ES1 A;  4A7K A;  2ZMN A;  3P6B A;  3I97 A;  1GZ9 A;  3BI3 A;  4PBP A;  4YG6 A;  2GDF A;  1UX6 A;  3FMG A;  1N47 A;  4Z8B A;  2YU2 A;  5BNP C;  1B35 B;  5D8A A;  1SQ4 A;  5GLU A;  2ZEZ A;  1OKO A;  5F6L B;  4YGC A;  2W1S A;  3WUD A;  4EJR A;  5F5C A;  3WY6 A;  2RMU 3;  4YM3 A;  2HWF 1;  2ZMK A;  5A7V B;  5FBJ A;  4UXA A;  5FIX A;  1F35 A;  5FUP A;  2VM9 A;  4ASM B;  4U36 A;  2JG8 A;  4RR3 C;  3KVA A;  1O91 A;  2VMD A;  3O0W A;  3POB A;  4UI9 L;  5DUW A;  1ND2 A;  5BNP A;  3U07 A;  3RRD A;  4IEY A;  3R6S A;  3WMZ A;  2HWB 2;  4MX3 A;  2WNO A;  5CKM A;  2SLI A;  3ZDS A;  3WPV A;  1XE7 A;  2D98 A;  3PU8 A;  4ZZ8 A;  2DCK A;  4YWA A;  1W8O A;  2OUH A;  1CZT A;  1PK6 A;  3DN7 A;  5FYY A;  5GLR A;  1CD3 G;  2V72 A;  3KGL A;  2Z2S B;  4RR3 A;  1DHK B;  1ULO A;  1WA4 A;  4NRM A;  3VHR A;  5AFB A;  4FFF A;  1RUD 2;  5LAS A;  3VBF C;  4Q1R A;  4OQ9 A;  4UDK A;  2BPA 2;  2W47 A;  1NG0 A;  3PUR A;  2MEV 3;  5IWF A;  4CP9 A;  5CAD A;  4DIN B;  2XVL A;  1JYW A;  3U75 A;  1XYO A;  3PIG A;  1QQP 1;  3ASI A;  1YQ5 A;  3KV5 A;  5ISL A;  4FP2 A;  1S55 A;  3UET A;  4D6Q A;  5FPU A;  5EWS A;  5I0S A;  4Y5Z 0;  4D0Q A;  5ACA 1;  1XQN A;  2RJK A;  4XUO A;  1G6N A;  3SH5 A;  3I3D A;  3D82 A;  4OZX A;  3K3N A;  2YFT A;  2G1M A;  3F95 A;  4E2G A;  3BYK A;  1CX4 A;  3T3Y A;  2EAL A;  2C0Z A;  3M2M A;  3NO8 A;  3H1W A;  2QQV A;  5A33 B;  1SLC A;  3NV4 A;  3TAW A;  3I59 A;  4XAC A;  1QJF A;  2WJS A;  1JXN A;  1Q8P A;  2VE1 A;  3TOJ A;  2WLQ A;  3N9O A;  4AR2 A;  5L36 A;  1DGL A;  1PT2 A;  3LKJ A;  3ZYB A;  4COU A;  2WQZ C;  1H9W A;  1V6J A;  3LDR A;  2VTX A;  2CWS A;  5C9A C;  5KC6 A;  3T30 A;  1AR8 1;  2PHD A;  3OJB A;  4BQ5 A;  5FRA A;  1QMJ A;  4HG6 B;  4QPI C;  1KFX L;  3GCX A;  2WUH A;  4KC7 A;  3Q8E A;  3N36 A;  1QJY 1;  1ZA4 A;  3W5M A;  3QZ4 A;  3NJZ A;  1DIW A;  2MEV 2;  2D5H A;  5B4X A;  1D4M 1;  1KJR A;  1YQ2 A;  4CCK A;  5JPM B;  4PLO A;  1ALY A;  1YWK A;  4OHX A;  1ODM A;  5LEK A;  1CZV A;  3U14 A;  1W6Q A;  4I2O A;  1ENR A;  5F39 A;  2PA7 A;  3GBW A;  2VZT A;  4ZXE A;  4ZPI A;  4XDP A;  1JUI A;  1CAX A;  4CU8 A;  1UV4 A;  4JGZ C;  2ID4 A;  5FO8 B;  5BYN A;  1QJX 1;  1D0H A;  1GZW B;  1ZM1 A;  4ATE A;  3TEZ A;  2VW0 A;  2W39 A;  3SCH A;  4IW3 A;  1D0G A;  3EBR A;  4YZ2 A;  1AX2 A;  1DCS A;  5AC9 1;  1REE A;  4MAD A;  1AR9 1;  3ZKY A;  5C5T A;  1PNF A;  2HEW F;  2WYS A;  3H8X A;  4HK8 A;  2XML A;  5J36 A;  2WFP A;  2YDE A;  3BVC A;  4A44 A;  4DEV A;  1NX9 A;  4GAZ A;  1S0G A;  4DMI A;  5EPA A;  5CIS A;  3BU0 A;  4AK5 A;  2DCY A;  3KHC A;  1EAH 3;  3OM4 A;  3KMH A;  3TNP B;  4XQ4 A;  1BLZ A;  1N3O A;  4IET A;  1JMU B;  1OI6 A;  4XXA A;  1VBA 1;  3FUO A;  3DPR B;  2UWB A;  4MXW A;  4FCA A;  4MZU A;  2VNV A;  3UYJ A;  1HW5 A;  5H9R A;  3RMY A;  2ZZQ A;  3CDZ B;  1HQW A;  1MS3 A;  3NJY A;  5FWE A;  4B4P A;  1X36 A;  1FAY A;  2HEY F;  3SCG A;  4QX3 A;  1SLT A;  2Q8C A;  4IEU A;  5A32 B;  5CBL A;  4WM8 B;  1H4H A;  4CXW A;  2B5H A;  4UDG A;  2PXJ A;  3FHA A;  2DU0 A;  3D5O A;  4NID A;  1CJD A;  2WDB A;  4IE6 A;  2YGL A;  1OA2 A;  2ZGR A;  2AGS A;  3WIN E;  3D8C A;  4YFZ A;  1PGL 2;  4FVV A;  4JDM A;  1ND3 B;  1QJZ A;  2VOV A;  4PBO A;  4GB3 3;  2JDU A;  1S2B A;  1N3P A;  3THC A;  3VBH A;  3A21 A;  4NAM A;  4QU2 A;  2GNM A;  1ZBE 1;  4BIO A;  1PM4 A;  3Q9O A;  2FCV A;  4AG4 A;  4KC8 A;  3PUI A;  4AE2 A;  3NL1 A;  4Y5T A;  4MLO A;  1FPN 1;  4G9S B;  2FCT A;  5L7O A;  4M01 A;  1CZS A;  2VTF A;  3BAL A;  2IC1 A;  4QPG C;  4Q1P A;  3ZR6 A;  1LJ7 A;  3Q8F A;  3QOP A;  4MHR A;  3AYC A;  1WW6 A;  2ZGL A;  5F2S A;  1AR6 1;  1QF3 A;  5IVF A;  4DZG A;  3VBU A;  3MGU A;  3E5X A;  5F32 A;  1MPX A;  1U0A A;  2EAK A;  2OQ6 A;  3B93 A;  3GJB A;  4DNY A;  5IYY A;  3WW2 A;  4MGZ E;  4K1Y A;  3AKI A;  2YUE A;  3PUH A;  4JGY B;  4Q0Q A;  1JYX A;  2PYT A;  4RS5 C;  5GKA C;  1RIT A;  1BKZ A;  5T54 A;  1DZQ A;  2R04 2;  4MGT A;  2VNG A;  2W94 A;  3A23 A;  1EV1 3;  4FPE A;  1A3K A;  4QDR A;  2ZEX A;  1UXZ A;  2DVA A;  3NNL A;  1HRI 3;  5LY1 A;  1BBT 1;  1JTZ X;  3H9A A;  3VZJ A;  3ES4 A;  2ADE A;  2D93 A;  3WDW A;  1E5H A;  1FAT A;  1V9U 3;  3E1F 1;  3WNO A;  2P17 A;  3VBS A;  1ENQ A;  1S0D A;  1CES A;  3LOI A;  4GH4 A;  5FZ0 A;  1CGP A;  3WDU A;  1UKR A;  1UZW A;  2XBO 1;  3HMY A;  3NNM A;  1Q5O A;  5T52 A;  1B35 C;  1W39 A;  3EMR A;  2BRT A;  2J7M A;  1IZ3 A;  4DS0 A;  4O61 A;  1V6O A;  1RMU 3;  2ZX0 A;  2XWJ B;  2IFR A;  3GZT B;  2ZAA A;  2DV9 A;  4LT5 A;  3WNP A;  4KQ7 A;  2LRO A;  2Y0O A;  4CUG A;  3BN6 A;  2VMI A;  2VU9 A;  3KWV A;  1PGS A;  1ZRI A;  4P9W A;  3JU9 A;  3WG3 A;  5IVE A;  1OPO A;  4PI0 A;  3WQB A;  1RUJ 2;  4RGK A;  4MOA A;  3VBR B;  5IFT A;  1ULD A;  1O7F A;  2P5B A;  5FZB A;  1NAE A;  4PQ9 A;  2AEN A;  2F4P A;  1H8T B;  1GOH A;  2MHF A;  3KCX A;  3RQ0 A;  3N7L A;  5LK5 A;  1U12 A;  1GIC A;  1QOT A;  2WZP P;  1VP6 A;  3WCS A;  1O8P A;  1G9A A;  3L2Y A;  4FQZ A;  3ZMO A;  2HWF 3;  4LBQ D;  3MDP A;  5FCC A;  1MR5 A;  5JLV A;  3H0O A;  3ZXD A;  3FHQ A;  5FY5 A;  2E7Q A;  4H7L A;  1R1A 2;  4IXL A;  1EV1 2;  1W0O A;  3MIF A;  1WW7 A;  3N9P A;  2ZBJ A;  1ST8 A;  1MZE A;  1GNZ A;  1E5S A;  1AXZ A;  1AL0 G;  1OQE A;  1DQ5 A;  5FXW A;  1H6Y A;  4JTN A;  3TEX A;  2P3J A;  1BCX A;  4RA0 A;  4MO3 M;  1V9U 2;  3KM5 A;  2D7F A;  1UWW A;  2A70 A;  4COV A;  5F5I A;  2FDK A;  5FR3 A;  4IQP A;  1SLA A;  4TSV A;  3MF9 A;  4QQP A;  3LEG A;  1ZZ7 A;  5FZ1 A;  1YQ6 A;  2DCJ A;  1VBB 2;  5C71 A;  1RMU 2;  4BK4 A;  3SHR A;  2X8F A;  2WFF 1;  2PN5 A;  1WD3 A;  1VBE 2;  4FSJ A;  3J7L A;  5KHG A;  1ULP A;  3NJV A;  4XFC A;  2A6V A;  4BOW A;  4IV1 A;  4CDX A;  1AYM 1;  1LU2 A;  2AEZ A;  1AZD A;  1BVP 1;  3KVB A;  2I74 A;  3MW4 A;  4AAP A;  4AK3 A;  5ACA 3;  3WF0 A;  2Q1Z B;  2NQY A;  2TBV A;  2OS2 A;  3N9L A;  4XFA A;  4ISR A;  5IAT A;  1GWK A;  1LEM A;  3R4U A;  5DZE A;  1UYY A;  2Q4S A;  5D21 A;  5APA A;  2QNK A;  4AI0 A;  5A33 A;  1IG3 A;  1KQR A;  2VCC A;  4NIH A;  2IXK A;  2HWF 2;  4FOV A;  2BVB A;  4NOV A;  3HAG A;  4P00 B;  2TNF A;  5AYD A;  1KS5 A;  1PHM A;  2HJI A;  2WS9 1;  5FYZ A;  3RWK X;  1OA3 A;  2A6W A;  3D6E A;  3QH6 A;  4P14 A;  4EE2 A;  1XU2 A;  2WO3 A;  4TYS A;  1F8V A;  4FTE A;  4MVT A;  4Q4V 1;  2UY8 A;  1W8F A;  3K2O A;  4YW4 A;  2P1B A;  2VVF A;  4XHX A;  1AR8 3;  4A41 A;  1UOG A;  1XC6 A;  5K0U B;  1WGP A;  3ACF A;  3ZLI A;  5KWR A;  3MW2 A;  4AVV A;  4Y20 B;  4W6Y A;  3IAP A;  2ZXQ A;  3AP6 A;  5FPX A;  2C6S A;  2VOK A;  4A3X A;  2NM1 A;  3WCR A;  5C8C A;  1W6M B;  1S4C A;  4L99 A;  4QPY A;  5I0D A;  1W9S A;  4EWE A;  4AHX A;  2KR2 A;  1QJY 3;  3HOB A;  2WII B;  4GJZ A;  3LAG A;  1X9T A;  1RUC 2;  5GLN A;  1D4M 3;  1IPK A;  3MIG A;  1UY3 A;  5JDB A;  3AC0 A;  4YRD A;  5A7O A;  1OFS A;  3OPT A;  1VLN A;  4CCM A;  3IBM A;  3S7E A;  4AQ2 A;  4QQS A;  2VO5 A;  3VZM A;  1OF3 A;  2A6Y A;  2QCS B;  5ACA 2;  2O0O A;  3BUC A;  5T3N A;  3U10 A;  1VIW B;  3KQR A;  4YW6 A;  4PVI A;  2WKK A;  1K12 A;  4C0B A;  1BQP A;  4E8D A;  1GWM A;  4OQ8 A;  2GME A;  2VQT A;  2DBN A;  1RUF 1;  2VMC A;  5ABJ A;  4OFG A;  1K5M B;  1DGW A;  4CSW A;  1TL2 A;  4J6G A;  2BFU L;  4LBQ B;  5A32 A;  2YYO A;  4MYE A;  3O0X A;  3LIH A;  4AFD A;  5IVV A;  4KG8 A;  4AK7 A;  3NV2 A;  4DXR A;  5KR7 A;  1SAC A;  3AYE A;  2RS1 1;  2WLP A;  4B8E A;  1GWL A;  1WCQ A;  2XJV A;  2VZ3 A;  3K48 A;  2OYZ A;  1WCD J;  3LV4 A;  1RUH 3;  5CFC A;  1I1E A;  4OHW A;  4LO7 A;  4WM8 C;  1JZ7 A;  3DPR A;  4AI3 A;  3CJI C;  3NNG A;  2BTV C;  5JOZ A;  4B1L A;  2B9V A;  1VBA 3;  4G3Y C;  4LOS A;  3UKT A;  1ND3 C;  2ARA A;  5AVA A;  1GBG A;  4I09 A;  4AK6 A;  2AR6 A;  4LKS A;  3OM6 A;  5F8P A;  1CAW B;  5FMO S;  5FZH A;  2XPJ A;  1TZO A;  4XJU A;  2LS6 A;  1TNR A;  2VMG A;  2ZGK A;  1FMD 1;  3D4K A;  3HN1 A;  4LJH A;  1AL2 1;  4M3C B;  3I7D A;  4XF0 A;  3T0A A;  4HL0 A;  3QEE A;  4MHU A;  4D6R A;  4XUQ A;  3D5Z A;  3P3P A;  3AB0 A;  1D4M 2;  3MIC A;  2JIC A;  3O1U A;  3KGZ A;  1YFW A;  4OMD A;  4NR1 A;  1XRU A;  4ATF A;  1LHV A;  1EYB A;  1OOP B;  2OQ7 A;  4NHL A;  1BEV 2;  1M4W A;  5F3G A;  3W21 A;  2EXH A;  1YFY A;  1J3Q A;  3PIJ A;  3ZFG A;  4CCD A;  5GLV A;  4E2S A;  4QKF A;  1H9P A;  3D3A A;  3GM8 A;  1S0E A;  2QVS B;  4XQW A;  2NMN A;  2D6M A;  2X10 A;  2ZKN A;  1W2O A;  3GJA A;  2B4K A;  3A0K A;  4FOY A;  1NYW A;  2VY0 A;  2ZTN A;  3HNB M;  1OA4 A;  3ZDV A;  1FPN 3;  1POV 0;  1ZBA 1;  2OII A;  3DGT A;  4E4S A;  1W6N A;  3K77 A;  5JCT A;  2HH9 A;  1QHD A;  1VBD 2;  4COY A;  2A5Z A;  1Q56 A;  4QHB A;  4XE9 A;  2CAU A;  1OMI A;  1RHI 1;  5FZ7 A;  1LED A;  1RUH 2;  5C3O A;  3GDB A;  4D94 A;  1JYN A;  3JQW A;  5JOY A;  5IK8 A;  3WP4 A;  1N1Y A;  1UL9 A;  3J4U H;  2R49 A;  3E6D A;  3QH7 A;  4ZKT B;  3WN2 A;  4JGY A;  5FYT A;  4HPK B;  1VBA 2;  2B39 A;  1D2Q A;  3RYR A;  3TAY A;  1CX1 A;  1J3P A;  2PLV 1;  4RQP B;  5JI9 A;  1F5J A;  5A6X A;  2ZEY A;  1NCQ B;  1ULE A;  3OGV A;  4RD7 A;  4B7E A;  3UL2 A;  2Q30 A;  4OUE A;  4XET A;  5IVJ A;  2J1S A;  3M3E A;  5CU1 A;  2WL1 A;  4UOJ A;  3VN4 A;  4S2H A;  2X8T A;  1FI2 A;  1RVF 2;  5FAX A;  3JBG 1;  1CWP A;  3J7H A;  2XG3 A;  4LNV A;  5GZE A;  1BBT 3;  4CEY A;  1J59 A;  2C24 A;  4I3G A;  3ETP A;  1PO2 1;  3FN9 A;  3S7I A;  3GBG A;  2C4X A;  1TG7 A;  2B8M A;  2HWD 1;  3BIE A;  4MXV A;  4OHV A;  4YZ3 A;  3VBR C;  3WF3 A;  4IEQ A;  4UFJ A;  4DRV A;  2ZOE B;  3IPV A;  1H2N A;  1AR7 1;  4LHL A;  2XBO 3;  1DGR N;  2QDR A;  1DFQ A;  3LFM A;  1H8T C;  5EYY A;  3AFG A;  2HYX A;  2WRA A;  3POJ A;  3UJO A;  1MS0 A;  5FO7 B;  3WF1 A;  1A78 A;  1C8N A;  4KWJ A;  4DFS A;  5AY9 A;  4K6B A;  2D5F A;  1LOE A;  2LAL A;  3FUQ A;  3KF3 A;  3WVJ A;  2VCA A;  3KF5 A;  3NAP A;  4XBQ A;  3JXS A;  1GAN A;  1W9T A;  2JE7 A;  4LIV A;  4AOC A;  4FAG A;  2VMF A;  4XUP A;  1WCU A;  2BGO A;  4BIS A;  3TEW A;  2EVX A;  2Z42 A;  4QT6 A;  3WP6 A;  5A6Z A;  5DDJ 1;  2VNR A;  2O8O A;  4Q5O A;  3B94 A;  4JRL A;  3IDB B;  5IVC A;  2P37 A;  3WP5 A;  3TYJ A;  1NCR A;  3JB8 A;  2RDN A;  3BGA A;  1XOY A;  4N9I A;  3WG2 A;  3KS7 A;  1LGN A;  3OBT A;  2W1U A;  3VZO A;  2GAU A;  2P6H A;  2Z69 A;  2CY6 A;  2JX9 A;  3POW A;  1FX5 A;  1XNA A;  2RS5 1;  3LDB A;  2DDU A;  3C7G A;  5JXG A;  1IS6 A;  3WDY A;  4CDW C;  1X7N A;  1XJA A;  1MQT B;  5GJ6 A;  5A7S A;  4K9S A;  3FFZ A;  3UV9 A;  4MG2 A;  4QQO A;  1JOJ A;  5HBA A;  1FT9 A;  3INA A;  3WQ0 A;  2V5D A;  5DMY A;  2E31 A;  3ZSJ A;  2J1E A;  1ZZB A;  5KHK A;  1PO1 1;  1UU5 A;  1RGS A;  1WL7 A;  3ETQ A;  4PF5 A;  2RJ2 A;  3AJZ A;  3DXT A;  4O7X A;  4IEX A;  5FZ8 A;  1GUI A;  4N53 B;  4AXO A;  2JD9 A;  4DQA A;  5FK7 A;  5B4N A;  4Y5S A;  2R1B A;  3NST A;  4DY3 A;  4RGG A;  2P3Y A;  1MS8 A;  1RUE 1;  4QXB A;  1PMH X;  2LM3 A;  5FYH A;  3M3O A;  1XYP A;  4HSL A;  4I02 A;  4QGM A;  4DIQ A;  4AED B;  4F8A A;  4RFR B;  4UFH A;  1N1V A;  5KC5 A;  2A75 A;  1R1Z A;  1HV1 A;  1J83 A;  3VBO A;  1TQ5 A;  4N2Z A;  1SFY A;  3KT4 A;  1KDK A;  3QAC A;  5JSO A;  5K0U C;  3J7N A;  4S2G A;  1WWY A;  4GKY A;  2PAM A;  5HXV A;  4X8N A;  4XF4 A;  5IAV A;  1SLL A;  5FPA A;  5EYX A;  5FOB B;  2WS9 3;  3MFA A;  2VUL A;  4N4B A;  3RZJ A;  3LA2 A;  1O6U A;  3WDX A;  1C1F A;  1HKD A;  2D40 A;  3ZPO A;  1XU1 A;  3V0B B;  3PL0 A;  2MNG A;  4H14 A;  4XF3 A;  3LA3 A;  5DAB A;  2VOX A;  2DFC A;  2D6K A;  4D7T A;  5EIY B;  4FPH A;  1US2 A;  1JOP A;  2ADD A;  1XSR A;  3HVD A;  3KB5 A;  1X8E A;  3HQR A;  3AKH A;  1AXY A;  4IV3 A;  4KU8 A;  5FQ0 A;  1XSQ A;  5FYC A;  3O5S A;  3P5B A;  3VD5 A;  5C3S A;  1O3T A;  5A6Q A;  5JUV A;  3GXU A;  2QQI A;  2JDH A;  3SMH A;  3LDK A;  4WVW A;  1MS1 A;  4XJZ A;  4ERO A;  3JQX A;  4LKD A;  1O5U A;  5F7U A;  5H9P A;  2YZ4 A;  4M3C F;  4RL7 A;  4EN6 B;  1SPP B;  4EV0 A;  1O8S A;  1NUK A;  4QXC A;  1J3R A;  3T2O A;  4B1M A;  5IHR A;  1K5M A;  2ZGQ A;  5FZ9 A;  4BQW A;  4CDQ C;  4LBQ A;  4NHM A;  1RUF 3;  3PHM A;  4YVS B;  2YFS A;  1Z7S 1;  2K9Z A;  1VKD A;  5C0P A;  1YQ8 A;  2D6P A;  1ZRE A;  1W8W A;  4N9H A;  1GYE B;  5GZF A;  1DP0 A;  1GSL A;  1XPW A;  4V2V A;  5HCF A;  3VSS A;  1S0F A;  2AEY A;  2R06 1;  3ZYH A;  2EID A;  2RS1 3;  3N9N A;  3ZSL A;  3IDA A;  1VB4 A;  4WVM A;  2CGN A;  4Q0P A;  4AVA A;  3OD4 A;  2WYF A;  4HXC A;  1UZY A;  4XF1 A;  2V4V A;  5LW9 A;  5DN2 A;  4I0W B;  1COV 3;  4U6B A;  3MLK A;  4UFI A;  2V73 A;  2B46 X;  2W3J A;  3KT7 A;  3RZG A;  1QXP A;  4HT1 T;  1WW5 A;  1BMV 1;  4G4F A;  4LHK A;  4LK7 A;  4IE4 A;  3MLL A;  4PIX A;  4BJ0 A;  2GNT A;  4CPB D;  1V6N A;  1FMD 3;  1XYN A;  4LBO A;  3J8F 1;  5IK7 A;  2MPF A;  1QDC A;  4ZXK A;  3VHP A;  3TN9 1;  2IVJ A;  1Q8V A;  3PME A;  3N9Q A;  4MGK E;  4BME A;  4LOR A;  4QB1 A;  3C3V A;  4A7Z A;  1TMF 1;  1OOP A;  5BNQ A;  3TRS B;  2DTY A;  3ZYG A;  2O8Q A;  4PF1 A;  1AXK A;  5A7P A;  4J1W A;  3IDE A;  4IND A;  3IAQ A;  1PIV 3;  4RHV 1;  5LRS A;  1W8T A;  1JYV A;  4CEW C;  4D6S A;  1RUI 2;  5K9Y A;  2PHL A;  1UOB A;  3BYL A;  2WO2 A;  4I0A A;  3OCP A;  3AL5 A;  5A3T A;  4DO0 A;  3AKG A;  1RUF 2;  3OUH A;  2BEO A;  4OYU A;  3LIG A;  2V5Y A;  2VVD A;  5E88 A;  1O5L A;  3W20 A;  3RZM A;  3KD4 A;  1UY1 A;  4RQP C;  1HQN A;  4RSU A;  1NCQ C;  1ZBA 3;  4P9G A;  3AXD A;  4LEJ A;  3MIE A;  2VCB A;  3WAU A;  5FYB A;  2CNA A;  2GN7 A;  4WM7 A;  4XUN A;  4XAE A;  1RHI 3;  4AQT A;  1ZZ8 A;  1BXH A;  3T0D A;  1SCR A;  4HPK A;  4ZU7 A;  4KU7 A;  1COV 2;  5FUN A;  2YFR A;  5J48 A;  4NWW A;  5FZ6 A;  1LGC A;  2BNN A;  2XL9 A;  1SHW B;  3ATG A;  3KCC A;  3NVC A;  3AP7 A;  3RZH A;  3SH4 A;  3VL8 A;  2JDY A;  5K8S A;  2XR4 A;  1HXS 2;  5FZ4 A;  4IES A;  1FMD 2;  3OBZ A;  3T4V A;  4Q29 A;  1NE6 A;  1RXF A;  2Y6K A;  5IK5 A;  3S5Q A;  4COW A;  3JBG 3;  1SEF A;  4LO4 B;  4BM8 A;  5I0R A;  2OXB A;  5DXD A;  1Y4W A;  1H2M A;  2BNM A;  1RL3 A;  1VRH 2;  2HWD 3;  3N9M A;  4FFI A;  4LUK A;  4PDW B;  3VT1 A;  2XVK A;  5A8D A;  5FZ3 A;  1PIV 2;  2VZQ A;  2BER A;  1PMI A;  4HMZ A;  4W50 A;  4UDJ A;  1AR7 3;  2J1T A;  4LR4 A;  2Q1F A;  1GU3 A;  1PZ8 A;  3BOD A;  3E5U A;  4BYY A;  1GOG A;  1RED A;  2OVU A;  1UZZ A;  2GC2 A;  2QZ2 A;  2WZE A;  3B3Q E;  1UYZ A;  4GJY A;  1LHU A;  1NY7 1;  4IER A;  4UF0 A;  4XOG A;  5JSP A;  1JBC A;  1ZBA 2;  3VBF A;  3U4X A;  3AKS A;  5FUI A;  1LCL A;  3WHU A;  4CXY A;  3ZM8 A;  3KT1 A;  2IXI A;  4LK6 A;  2WAA A;  2HYK A;  2A1X A;  5LCW L;  1YFX A;  2XJS A;  3ME2 A;  4GIQ A;  2RMU 2;  4JCK A;  3VT0 A;  3UT0 A;  1MQT C;  1UN1 A;  4IGO A;  5BNN B;  2WBK A;  2E33 A;  5DDJ 3;  1QNY A;  4XVH A;  5G04 L;  2W1Q A;  3DEC A;  3H1M A;  2H6B A;  3WQ7 A;  1ZNP A;  4ISQ A;  4CCC A;  1X9P A;  2HWC 3;  4K20 A;  4ZS2 A;  2B42 B;  1W2N A;  4H55 A;  4AI9 A;  4COZ A;  2NN8 A;  4XUR A;  2LTN A;  4N53 C;  1E57 A;  4HN1 A;  4Q4Y 1;  4CU7 A;  2FDH A;  2Z5W A;  3JBG 2;  1CAV B;  4XIL A;  4NOT A;  1XNB A;  2RS5 3;  5DAX A;  4AED C;  4JVA A;  5GLW A;  2VW1 A;  1LHW A;  2ZEW A;  4EN0 A;  1SDD B;  2K2S A;  5C9A A;  5B6S A;  3T2T A;  3ZR5 A;  1AR7 2;  5F3I A;  4I3P A;  4XJ8 A;  1KJL A;  5JR7 B;  3B9C A;  3GZE A;  4TTG A;  4YZ1 A;  1PO1 3;  3RJ2 X;  4XZP A;  3VT2 A;  4QPI A;  1I6X A;  1LOG A;  1CAU A;  2P6C A;  4I01 A;  3VKN A;  2X5I B;  4QB6 A;  3B7M A;  1RYY A;  5F2W A;  2A3X A;  4NUB A;  5J98 B;  3I2O A;  3IWZ A;  1RUE 3;  1FOD 1;  1OLM E;  4IE7 A;  4JAA A;  5SV8 A;  1QJU 1;  4EYU A;  4PI2 A;  5CFD B;  2DVB A;  4ZHN A;  2JDA A;  3KSC A;  1NZC A;  5FP4 A;  2D6N A;  3R4S A;  3FJS A;  1JHN A;  1WMD A;  1JYC A;  2JB8 A;  4Q26 A;  4V2W A;  1X33 A;  5HCA A;  3O1P A;  1ULC A;  2EXI A;  5DDJ 2;  3VKO A;  4PCR A;  1JZ3 A;  4JGZ A;  3LSE A;  3PUA A;  3B5L B;  1VAL A;  1Q8O A;  3T4H B;  2PHT A;  4NN0 A;  2H6C A;  3POF A;  2HWC 2;  4L97 A;  4OI2 A;  4YM1 A;  1KFU L;  2ZGS A;  5CZK A;  4Y1Y A;  5FLI A;  3SCF A;  4D7S A;  1XNK A;  5FY1 A;  1AX1 A;  2ZX4 A;  1UAI A;  1UQX A;  4XFI A;  5FZO B;  1HQL A;  3N4M A;  3LWC A;  2G9Z A;  4CCL A;  4QQH A;  2ARX A;  5AVP A;  4CU9 A;  2RS5 2;  3RMX A;  3WHT A;  2DFB A;  3M7A A;  3NJX A;  4B7K A;  1W6O A;  5IT6 A;  5IAX A;  2W5F A;  3D0J A;  3RFR A;  3ZVX A;  5LBF A;  1LOD A;  1YIP A;  5T5O A;  4LBK A;  4R52 A;  4IGP A;  4ITC A;  3CJI B;  3MIH A;  4NHX A;  4W65 A;  1NT0 A;  4QGN A;  3I3Q A;  4YVS C;  2DUR A;  2Y6H A;  1PO1 2;  1QOO A;  5A3M A;  2FDF A;  2W52 A;  3AX4 A;  4YZ4 A;  1IG0 A;  1ZYB A;  2ERF A;  2WT0 A;  3L2H A;  1WLC A;  2JIG A;  2QE3 A;  2WWJ A;  5FP8 A;  1J84 A;  3NRU A;  4K21 A;  4M4R A;  3C7H A;  5DAW A;  3ZIX A;  5J96 B;  5JMC A;  5FPL A;  1BZW A;  2ZKL A;  3AVR A;  2UYA A;  2VJX A;  3VD3 A;  2IXL A;  1WLD A;  4M4P A;  2OPK A;  3K51 A;  3P1I A;  1OD5 A;  2YXS A;  3PVN A;  4HZF A;  4P9L A;  1V6M A;  5GZD A;  3HJR A;  3WDV A;  3AMH A;  1JOD A;  4CVU A;  1Z7S 3;  4OI4 A;  4BLJ A;  4PIY A;  5LA0 A;  3SNM A;  2B9U A;  3SIS A;  1EAH 2;  3EO6 A;  5JOX A;  2XXZ A;  4FBF A;  1PVC 1;  2R07 1;  2ATF A;  2E63 A;  1JHJ A;  2R06 3;  4TLF A;  5H9Q A;  2W0X A;  4DUV A;  2WNU B;  3LD8 A;  5IUQ A;  4JQR A;  2FBE A;  3DXU A;  4RN5 A;  1UZ0 A;  1O59 A;  2NLR A;  3M8L A;  4WZF A;  4JZR A;  4QPG A;  3WNM A;  5A8C A;  3BYN A;  5FLJ A;  4CP2 A;  2RR1 1;  4Y4Y A;  4BCU A;  2Y8K A;  5BY5 A;  2CTV A;  4JKK A;  5FYU A;  4COT A;  2BZD A;  2JDM A;  4Y4R A;  1I3H A;  1RIR A;  4S2D A;  2P2K A;  3EHK A;  2OA2 A;  5FTT C;  3EQE A;  3AM2 A;  4HKL A;  3FL7 A;  1OD3 A;  3HWJ A;  4L2N A;  3GYD A;  1CR7 A;  1LUL A;  1WLW A;  3J8F 3;  3NKG A;  2FMY A;  2DTW A;  4P9Y A;  1BVV A;  4RS5 A;  2PHX A;  1NLQ A;  2CDP A;  1IGO A;  3AXE A;  4TZD A;  4GB3 2;  1C8M 3;  4BU2 A;  5C5U A;  2QQJ A;  2EIG A;  1PVX A;  3T0B A;  3KV6 A;  2OX0 A;  2EIE A;  4RHV 3;  2XON A;  4AQS A;  4BPZ A;  3OYW A;  3O1O A;  5KXE A;  2J1V A;  5FZM A;  1WZX A;  2W68 A;  3BTZ A;  3B02 A;  4AQ6 A;  4Y22 B;  4MUV A;  4NRO A;  2Y6J A;  1H0B A;  1B35 A;  4HN0 A;  3PMS A;  4BZ4 A;  4IEV A;  1YFU A;  1WCK A;  3OF1 A;  4KI5 M;  5A7V A;  1G86 A;  3HBK A;  1IOA A;  4M3C E;  4XMI A;  2O1Q A;  3POE A;  2XDV A;  1EPZ A;  2R0F A;  3PJY A;  4PDW C;  1D2S A;  1Q3E A;  2BGC A;  3MHZ A;  3S0M A;  4OUM A;  4GQ7 A;  2ORZ A;  1OQD A;  2WT1 A;  1W9W A;  1BMV 2;  5B6T A;  3AJY A;  2VBB A;  1POV 1;  4OHZ A;  4BQY A;  1HRI 2;  3OEB A;  2DF7 A;  2KD7 A;  1DQ4 A;  2JKX A;  2O14 A;  2NYY A;  1DQ6 A;  4YPJ A;  3OOX A;  5GZG A;  5FZL A;  3RZL A;  4DXS A;  3J8F 2;  3JCI A;  2VUD A;  2BQP A;  2HBU A;  1UW8 A;  3HN3 A;  4QAW A;  3AKP A;  4ZU4 A;  1C8M 2;  5LRR A;  5KXD A;  2WZR 1;  2J1U A;  2OPW A;  4Z2W A;  2BBA A;  5CG9 A;  2PHR A;  3OTF A;  4Y3O A;  2E51 A;  5FZC A;  1AJO A;  1VRB A;  1IKP A;  3JZV A;  4XEZ A;  1CJP A;  3VZK A;  2XLF A;  1DBN A;  5FY4 A;  1BHG A;  3QC2 A;  2QQU A;  4QX2 A;  3JB4 C;  1QQP 3;  4QD2 A;  4Q0U A;  5BNN C;  4OI1 A;  1NA1 B;  4M00 A;  5JWP A;  3VSF A;  2XGX A;  4CDW B;  4PJY A;  4LUM A;  5T5L A;  3FLP A;  1VJ2 A;  4LBM A;  2FDI A;  2RS3 1;  3Q8B A;  5L73 A;  4DRR A;  4QQ2 A;  4Y1Z A;  2HLE A;  4FPG A;  4LMF A;  3CQO A;  1SLB A;  5I91 A;  3V65 A;  3C7E A;  2VEC A;  3WNL A;  3UKN A;  4YAR A;  1R09 1;  2GH2 A;  1KD7 A;  3FLR A;  4QHZ A;  4CPB A;  4XAA A;  2VPV A;  4N43 B;  5CAZ A;  1LOA A;  4HFS A;  1QGL A;  4JV4 A;  4HKW A;  4AF9 A;  1SBF A;  1PNG A;  4XF9 A;  5FRE A;  2J1R A;  3PTR B;  2H0V A;  4XFH A;  4LLF A;  2X5I C;  4Q4Y 3;  1RIN A;  3O1T A;  4YM0 A;  4B3N A;  1Y9G A;  1ZX5 A;  3EXU A;  3IKW A;  4FOW A;  1OH3 A;  3S6P A;  1A8M A;  1F15 A;  2A71 A;  5CFD C;  1UO9 A;  4JRA A;  5H9S A;  1BK0 A;  4LHS A;  4KBB A;  3USU B;  5C3Q A;  2FCU A;  3ZYP A;  1QQP 2;  2X53 S;  2X5I A;  4UYB A;  3NNF A;  1QH6 A;  1IKQ A;  4LIU A;  4Y1V A;  1HIX A;  4NHY A;  2ZHM A;  1GZW A;  2I07 B;  3WF2 A;  1LOF C;  3ZFF B;  3F2Z A;  1U5Y A;  3HQU A;  4Q4W 1;  1FOD 3;  1UD1 A;  1QJX 3;  3AKQ A;  1ASJ 1;  5HV0 A;  1W6P B;  2ZHN A;  1QJU 3;  1XBF A;  1WUV A;  2PEL A;  5LA9 A;  2PQQ A;  3HD8 B;  3UES A;  3H42 B;  2C9A A;  2WN3 A;  2QZ3 A;  3JD7 1;  3OB8 A;  1DQ0 A;  1UMH A;  2CV6 A;  2P4E A;  2VOW A;  5GLT A;  5AC9 3;  3IT8 A;  1AR9 3;  3ZOI A;  5F3C A;  1C5I A;  2VQA A;  4TWT A;  2YG0 A;  1ZRF A;  1AYN 1;  2I2S A;  1YO8 A;  3VDC A;  1HRV 1;  3T08 A;  2RDR A;  3N7M A;  5G05 L;  5C4W B;  1JS9 A;  3OGR A;  5JZG B;  4ONU A;  3ZFE B;  2GZW A;  4O9E A;  3WF4 A;  3ZXG A;  4AHW A;  2CSG A;  2DWR A;  1LGB A;  3ACH A;  2WQ4 A;  3RSJ A;  2DCT A;  4CDQ B;  1WW4 A;  4NII A;  1N3Q A;  1AR8 2;  2W08 A;  4QDS A;  5A7W B;  2WAB A;  3WSO A;  3AP9 A;  4Q4Y 2;  1OH4 A;  1W8Z A;  2UWA A;  4CDU B;  3K4D A;  3GCW A;  2VTX J;  4WM8 A;  2UUR A;  4LE4 A;  2YHJ A;  4QWN A;  3RVH A;  3CJI A;  4YG0 A;  1QH7 A;  1QJY 2;  3III A;  3BPS A;  5FWJ A;  2ENR A;  4NVP A;  1JH5 A;  3MI8 A;  1QJE A;  1MVE A;  1ND3 A;  1UNB A;  2WNV B;  3ZSE A;  4QXK A;  4JKM A;  3OM5 A;  5JR2 A;  1JN2 P;  3VKM A;  3PDQ A;  1QEX A;  1U5I A;  4KCA A;  4FO9 A;  5A1A A;  3A4U A;  4MV2 A;  2XOM A;  4LA3 A;  4LO5 B;  2JDZ A;  5JPN B;  1FOD 2;  1F4H A;  1QJX 2;  1ZBE 3;  2WNU C;  1JUH A;  1QKQ A;  3LQC A;  1CON A;  2HWB 1;  1QJU 2;  3UKV A;  3PNA A;  3WAT A;  5E1R A;  3ZSM A;  4L92 A;  3O12 A;  5AC9 2;  5FZD A;  4QKN A;  2WA3 A;  3H8R A;  5FXV A;  1AR9 2;  1QXR A;  2DCZ A;  4K8F A;  2RDQ A;  1SCS A;  4LA2 A;  3LPF A;  2XJP A;  1RUD 1;  2JDN A;  4MH0 E;  3H7J A;  3CL1 A;  4CEW B;  1AR6 3;  4S2F A;  1PVC 3;  3RWN A;  1HX6 A;  2WIN B;  3OGS A;  1EUU A;  4YVW B;  1FV2 A;  1STM A;  1GV9 A;  3AVS A;  3RZK A;  1SMV A;  5A80 A;  4KMQ A;  4UW5 A;  2CWM A;  2D3R A;  2QQP A;  4QQL A;  3TB0 A;  2F17 A;  4GMP 1;  2CDO A;  3PVB B;  4PLM A;  3VB9 A;  2XLG A;  2RR1 3;  1L7L A;  2ZX1 A;  5JIA A;  4NIA A;  5DAP A;  4BHP A;  4WV8 A;  1YUD A;  1K3I A;  3ZN4 A;  4Z07 A;  2VCM A;  4A6O A;  4DY5 A;  1JOB A;  3VV1 A;  1RJ8 A;  1V70 A;  1W99 A;  2DUP A;  5D8A B;  4KCB A;  4XBN A;  1L7Q A;  4QHO A;  1W0P A;  2W87 A;  4BQ3 A;  1OPM A;  4ARX A;  4W6X A;  5FZF A;  2BJS A;  3KZ4 C;  4TXW A;  1Q8Q A;  3U4S A;  3ZXF A;  3HNM A;  4NO4 A;  4EQV A;  5FXZ A;  5CA6 A;  4ONZ A;  1LHO A;  1NE4 A;  1ZBE 2;  3H3L A;  2JG8 B;  1X8M A;  1UYX A;  1GYK A;  2ZGP A;  1ND2 B;  1HB1 A;  1HN0 A;  1O3Q A;  1FPN 2;  3G6J B;  3ITQ A;  5ANQ A;  3H8U A;  3CZU A;  5FY9 A;  1WA6 X;  4R4Z A;  1A6C A;  4QGL A;  3VBR A;  1ZZC A;  1OHF A;  3P2N A;  1V00 A;  2BVV A;  4JX0 A;  1PK6 B;  3B69 A;  1H8T A;  4R9C A;  5E6H A;  2A7A A;  4FXG B;  4LUL A;  4GWI A;  3LSD A;  1AR6 2;  1PVC 2;  3VHN A;  1S0C A;  1ENS A;  1EY2 A;  2BU9 A;  3NNJ A;  4MGY E;  1OLM A;  3OG2 A;  4RGA A;  3VZN A;  3R4Y A;  5BNO C;  3WPZ A;  1P8J A;  1GKB A;  3K3O A;  2EIC A;  3MYX A;  2XH6 A;  2QBX A;  3IZO A;  3NWK A;  3VSR A;  3MW3 A;  2WT2 A;  4BQ1 A;  1VMH A;  5FMC A;  2RR1 2;  1QWR A;  2BP6 A;  1R64 A;  2XUM A;  1FNZ A;  4AEM A;  1R08 1;  4ZY9 A;  1UOJ A;  3H3U A;  1O4T A;  1DGW X;  5EJ1 B;  3WT3 A;  3ALQ A;  1A34 A;  4BB3 A;  2KA3 A;  2XJU A;  1POV 3;  2L9L A;  4FPL A;  1BBT 2;  1NA1 C;  2E9Q A;  2YU1 A;  4HVO A;  4P5H A;  2Q8O A;  2VXR A;  4MGI E;  1W9Y A;  5IVB A;  2NZ9 A;  2Y6G A;  3RI9 A;  4OI0 A;  4KWL A;  3K1U A;  2XBO 2;  3HR9 A;  5JXJ A;  2WZR 3;  4CCJ A;  4LKE A;  3I2D A;  3I59 B;  3AZY A;  4KGG A;  1U5Z A;  2CL2 A;  3O14 A;  5IVY A;  1MEC 1;  2WFF 3;  4J25 A;  4CDW A;  2ARC A;  1UIK A;  1LAJ A;  4XTM A;  1VAV A;  2UYB A;  2RV9 A;  4AFB A;  1LOC A;  4LBN A;  3PUQ A;  4IEP A;  4AI1 A;  2EA7 A;  3HBZ A;  1AYM 3;  2QQO A;  3J26 N;  3C2U A;  4N43 C;  4ZS3 A;  2PMW B;  1NLR A;  2AC1 A;  5DAQ A;  3ZYR A;  2VZU A;  3L9J T;  2RS3 3;  4CTE A;  5A3U A;  2R7E B;  5ANN A;  3MUZ 1;  1PZ9 A;  1H1A A;  2VL4 A;  5JSR A;  2YGM A;  1G9C A;  1JI6 A;  4SBV A;  4YW7 A;  4B4Q A;  4AYU A;  4C1W A;  1R09 3;  2Q0A A;  1W8N A;  1PGL 1;  3WW3 A;  5DG2 A;  1QNW A;  1H30 A;  1UMI A;  1U5X A;  1W6Q B;  2RDS A;  4GKX A;  2HEV F;  1GP4 A;  1DG6 A;  4NAO A;  4X6Q B;  2P34 A;  4XIO A;  1X50 A;  1CPM A;  2VW2 A;  2ZPX A;  1CAX B;  2RJL A;  1UY4 A;  3B9I A;  5GLL A;  1WBL A;  5JXI A;  2QFE A;  3U78 A;  5K0U A;  3DUI A;  4Q4V 3;  4LBL A;  3J7M A;  3M4F A;  5FY8 A;  2V4A A;  2YFZ A;  1QY4 A;  4Y20 A;  5LK7 B;  2IXJ A;  3HQX A;  2Y6L A;  3VDD B;  2BWA A;  3DL3 A;  5C3P A;  1JYT A;  3WMY A;  2RG4 A;  1W6M A;  3ZFF C;  4HVQ A;  1Z0H A;  4BE3 A;  3SH3 A;  2P3I A;  5FPB A;  3USU A;  3AYA A;  4H7M A;  3POG A;  4LIT A;  3TNQ A;  1UPI A;  1YC6 1;  5JMO A;  3LCP A;  2VZR A;  4XZU G;  4JTO A;  5EJ3 A;  1KDM A;  3LA7 A;  2WFF 2;  5L9V A;  4AEJ A;  4URA A;  5E16 A;  2D44 A;  2ILM A;  5DAV A;  3TWI A;  5BUV A;  4WVZ A;  3P3N A;  4AFA A;  1ULF A;  4BQX A;  4BQ4 A;  2ZAC A;  4FQ4 A;  4X8P A;  3NV3 A;  1RUN A;  1AYM 2;  3ZFF A;  3LE0 A;  5JOW A;  1UMZ A;  3IB3 A;  4MXW B;  3ORJ A;  5C4W C;  1LES A;  2R04 1;  3LPG A;  4GMP 0;  5JZG C;  2ZML A;  3ZFE C;  3NW4 A;  4CP0 A;  4CU6 A;  1H8V A;  3DF0 A;  4XQD A;  4ASL A;  2K0G A;  5IW0 A;  5A3L A;  4Q4W 3;  5A70 A;  1ASJ 3;  2IZW A;  2XB6 C;  4FAH A;  2OW4 A;  2Y60 A;  2IFW A;  4F3J A;  1H2L A;  2Q1M A;  3NKT A;  4KWU A;  2VC9 A;  1SFN A;  3JD7 3;  4XDO A;  5DPN A;  2GN3 A;  4ES9 A;  5BXX A;  2FDJ A;  1LNS A;  2WO7 A;  4CDU C;  2ZGM A;  1YRZ A;  4YGB A;  5D2A A;  1EP0 A;  3WG4 A;  5FLW A;  4Z92 B;  5JZG A;  4FFG A;  1HRV 3;  2WS9 2;  2NP0 A;  2GP3 A;  2QQL A;  4L11 A;  3CJX A;  4QPW A;  5F5A A;  3ZXJ A;  4CDQ A;  1WLT A;  3VBH B;  1FNY A;  2J1A A;  5A7W A;  3PLQ A;  3ZN5 A;  2WNV C;  1Y9Q A;  4MGQ A;  2XWB B;  1N1S A;  4Q4V 2;  4N2R A;  1W8H A;  2E53 A;  1CAW A;  1RB8 G;  1FV3 A;  2VH9 A;  3ILR A;  1GOF A;  4Q27 A;  4P5Y A;  4XAB A;  4O8O A;  3QCW A;  4M3C A;  1W18 A;  3ZMN A;  3POS A;  1RUJ 1;  5L7O B;  2BUK A;  4P9X A;  3M70 A;  1UF2 C;  5FZI A;  5LA2 A;  5LAT A;  1AL2 3;  3VD9 A;  2TEP A;  3W58 A;  4EN8 B;  4AI8 A;  4K40 A;  4C8D A;  3POY A;  3VBU B;  2WR9 A;  4JHZ A;  3TBD A;  2VZS A;  4N90 A;  4XCB A;  1VMF A;  3POI A;  3WNK A;  4W6W A;  4AI2 A;  5GLO A;  3OSD A;  1R1A 1;  3I2F A;  4PHZ A;  1W2T A;  4YVW C;  2PAE A;  3ZX7 A;  1I5P A;  4FPY A;  1ASJ 2;  2ZX2 A;  2HWB 3;  3ZXE A;  2VG9 A;  1J1L A;  1WMF A;  3WPY A;  1MZ6 A;  2FMD A;  3GHM A;  4L9B A;  5DUU A;  4D3W A;  2YC2 A;  5LY2 A;  1OKQ A;  1GR3 A;  1GZT A;  1XE0 A;  2RS1 2;  5GLZ A;  4D8M A;  3RNS A;  2VXJ A;  4CEW A;  3C8X A;  1HRV 2;  3VBS B;  1YLL A;  4GH4 B;  2XKP A;  1VBB 1;  2G4I A;  1RMU 1;  3WOG A;  2DUO A;  5D8A C;  5HCB A;  2E7A A;  3WUC A;  1VBE 1;  1DLL A;  1VAM A;  4P08 A;  4RQP A;  3WW4 A;  1S2E A;  5CIR A;  3K4A A;  1PM7 A;  1W05 A;  2D6L X;  1NCQ A;  1W8U A;  3CMG A;  4O65 A;  3THP A;  4E4D X;  5JAX A;  2PLV 3;  1UCX A;  3QLQ A;  4GMP 3;  2JDP A;  1RXG A;  4H3W A;  4D47 A;  3CU9 A;  1VPH A;  1FXZ A;  5SV5 A;  4YNI A;  1G9B A;  1KRI A;  4IE5 A;  1JZ5 A;  2JG8 C;  2Y64 A;  1Q8S A;  2VME A;  1OUX A;  2ZGT A;  1AL2 2;  4FT8 A;  1ND2 C;  3LEK A;  1Z78 A;  4FI9 A;  5B2G B;  3BTX A;  3THT A;  3M1H A;  4NPL A;  1OBN A;  5ERL A;  1PO2 3;  2JWP A;  4K7J A;  4I30 A;  3RYK A;  2A73 B;  1PK6 C;  3A22 A;  3W5N A;  2XLA A;  3ECQ A;  2XJT A;  3RI8 A;  4NRQ A;  3WDT A;  2Z79 A;  1CN1 A;  1GQH A;  3URF A;  4CA9 A;  2N7G A;  2BV4 A;  2B7Y A;  1YJK A;  1YCI A;  3E6B A;  4ORF A;  2BBV A;  3OGJ A;  2QKD A;  3MPB A;  4RYD A;  3KST A;  1LHN A;  3LEM A;  3WPU A;  1UPS A;  2ET1 A;  3I4I A;  1YEW A;  3APB A;  3LZZ A;  1Y3T A;  5EZW A;  5FOJ B;  5FP7 A;  4DPN A;  3MIB A;  1RHI 2;  2DBI A;  3BPZ A;  4LE3 A;  2YV8 A;  4FFH A;  1LU1 A;  3WG1 A;  3AL6 A;  4LKF A;  2PHW A;  3OBA A;  5FLH A;  1RUC 1;  3O7O A;  4JKL A;  4K8R B;  3V56 A;  1HN1 A;  4AWD A;  2ZAB A;  3VLB B;  1ZVF A;  2W9X A;  5FPZ A;  4A2U A;  3SEE A;  4PQQ A;  1RTV A;  3SC7 X;  3VKL A;  3IMM A;  5M0T A;  4XYX A;  2PLV 2;  5GZC A;  2YB7 A;  5JI7 A;  2WSU A;  4DOU A;  2RM2 1;  3ENR A;  2AUY A;  3MPP G;  3NQH A;  2XQR A;  5EP9 A;  4IV1 B;  4KGQ A;  1H1I A;  4CDX B;  4HOO A;  4IL7 A;  2D97 A;  5HPO A;  1AUY A;  1F2N A;  2VQU A;  1R08 3;  3R05 A;  2BW8 A;  2JE8 A;  1UU4 A;  1MQT A;  5EXO A;  3I2G A;  4AHZ A;  1MZ5 A;  3H1Y A;  5F37 A;  1JYI A;  4CUC A;  1PO2 2;  4UDI A;  2HWD 2;  4QKB A;  3WLU A;  4XTP A;  4A4A A;  2ET7 A;  4LQR A;  4AL9 A;  3Q8C A;  3RS6 A;  5C33 A;  2IXC A;  4K1Z A;  3VUO A;  2QQM A;  4GA9 A;  1OVP A;  4BK5 A;  1W3V A;  1Y9M A;  3OD0 A;  3AK0 A;  4JC1 A;  4N53 A;  2GAL A;  5I8Y A;  2VDT A;  1KEX A;  4CCO A;  1UY0 A;  1MEC 3;  2XJR A;  4MGS A;  4DB5 A;  1POQ A;  1ZRR A;  2IWG B;  4YLZ A;  1CQ9 A;  2F4L A;  4LTA A;  4WVV A;  5GM0 A;  4QMA A;  4YW1 A;  2PAK A;  2E7T A;  4Y1U A;  3SKV A;  3VD7 A;  4AED A;  5A3P A;  1D4V B;  5FDB A;  1RUO A;  1GYD B;  2JD4 A;  4WBB A;  2WNE A;  1DGR A;  5HXM A;  1DYK A;  2CGP A;  1DZR A;  2EAA A;  2FZ1 A;  1C28 A;  5CNA A;  5C8C B;  4F83 A;  3NV1 A;  1UX7 A;  5C2M A;  1BJQ A;  2JKB A;  2DVG A;  3M3C A;  5FKB A;  5FKC A;  1OSG A;  2WWS A;  3VDD C;  2ETE A;  4N7I A;  5EJZ B;  1UU6 A;  4E4Z A;  2XJQ A;  1UYP A;  3DYP A;  3KCY A;  5DQ0 A;  2ZA9 A;  4GUL A;  1BEV 1;  4XBL A;  2BGP A;  1GNY A;  4O8P A;  1Q43 A;  1E5I A;  2J22 A;  4Y1X A;  3V0B A;  1R08 2;  3ZN6 B;  5A3O A;  3DYO A;  1ZA7 A;  3W9A A;  2C26 A;  3A0N A;  3ZSK A;  4F7Z A;  3VDD A;  2D3P A;  1PGW 1;  3LGR A;  5ABJ B;  4L0P A;  1IQA A;  4ET7 A;  5C8W A;  3DV8 A;  5JIU A;  3M3Q A;  1KS4 A;  3HT2 A;  1TME 1;  1VBD 1; 
#chains in the Genus database with same CATH homology
 4B1M A;  4N1I A;  3WN0 A;  5GLL A;  3WN1 A;  4UFM A;  4QHZ A;  5JOX A;  3D61 A;  3QZ4 A;  4QQS A;  4U6D A;  3KF3 A;  2YFS A;  1VKD A;  5C0P A;  3KF5 A;  3VT0 A;  3WMY A;  1GYE B;  3QEF A;  4PVI A;  3VSS A;  2X8S A;  3U14 A;  2AEY A;  4PVA A;  1GYH A;  2EXK A;  5A8C A;  3QED A;  3BYN A;  3OM7 A;  1Y7B A;  3C7O A;  4CCC A;  4COT A;  1UV4 A;  4KCB A;  3ZXL A;  1OYG A;  3LIH A;  4MLG A;  4AK7 A;  2QQW A;  4HXC A;  1Y9G A;  4KMI A;  3BYJ A;  3KST A;  4U6B A;  4UFI A;  4EQV A;  3LEM A;  3LV4 A;  4ONZ A;  3WPU A;  5JOW A;  3H3L A;  3D5Y A;  5GLQ A;  5JOZ A;  4B1L A;  4AK5 A;  4FFH A;  3OM4 A;  5AYC A;  5B6S A;  4AZZ A;  3ZR5 A;  3C7G A;  4AK6 A;  3OM6 A;  2B4W A;  3P2N A;  5A7V B;  3VT2 A;  3UGF A;  1YRZ A;  5FLW A;  1ST8 A;  3SC7 X;  5FIX A;  4O8N A;  3IMM A;  3QEE A;  4FFG A;  5AYE A;  3U1X A;  3D5Z A;  3ZXJ A;  4UFK A;  2XQR A;  3NQH A;  3R4Y A;  1WL7 A;  3R67 A;  3WPZ A;  3BYL A;  3WMZ A;  3AKF A;  5FK7 A;  5FK8 A;  3AKG A;  4N2R A;  3VSR A;  3LIG A;  3WPV A;  3UGG A;  5FMC A;  5A7V A;  2EXH A;  3UGH A;  3PIJ A;  4O8O A;  4CCD A;  4UDG A;  5GLM A;  3HBK A;  5GLR A;  3WAS A;  2X8F A;  1W18 A;  2EXI A;  4UDI A;  3WAU A;  4UFH A;  4FFF A;  4UDK A;  4UDK E;  2AEZ A;  1Y9M A;  4N2Z A;  5B6T A;  3LF7 A;  3U75 A;  3PIG A;  2VDT A;  4KC8 A;  1YI7 A;  2YFR A;  3K1U A;  3LFI A;  5GLO A;  3OSD A;  5JOY A;  1GYD B;  1W2T A;  3ZR6 A;  3WN2 A;  4N4B A;  3OM5 A;  4KCA A;  4NOV A;  2YFT A;  5AYD A;  3WPY A;  4CCE A;  3BYK A;  3RWK X;  3S5Q A;  4JQT A;  3C2U A;  3OM2 A;  3QC2 A;  2ADD A;  5FKB A;  2QQU A;  2OXB A;  2AC1 A;  5FKC A;  1Y4W A;  2QQV A;  5FMB A;  3AKH A;  3D60 A;  3TAW A;  3VSF A;  3WAT A;  5ANN A;  3AKI A;  2X8T A;  1UYP A;  4FFI A;  3VT1 A;  5A8D A;  3ZXK A;  3NMB A;  3C7H A;  1PT2 A;  5FMD A;  3R4Z A;  4O8P A;  4UDJ A;  3C7F A;  3LDR A;  5GLP A;  5GLK A;  3LDK A;  4UFL A;  4UFJ A;  3VSZ A;  2EXJ A;  3C7E A;  4D47 A;  1YIF A;  2ADE A;  3CU9 A;  5GLN A;  4KC7 A;  5AY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...