3R4YA

Crystal structure of alpha-neoagarobiose hydrolase (alpha-nabh) from saccharophagus degradans 2-40
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
362
structure length
360
Chain Sequence
KLSKASLRAIERGYDEKGPEWLFEFDITPLKGDLAYEEGVIRRDPSAVLKVDDEYHVWYTKGEGETVGFGSDNPEDKVFPWDKTEVWHATSKDKITWKEIGPAIQRGAAGAYDDRAVFTPEVLRHNGTYYLVYQTVKAPYLNRSLEHIAIAYSDSPFGPWTKSDAPILSPENDGVWDTDEDNRFLVKEKGSFDSHKVHDPCLMFFNNRFYLYYKGETMGESMNMGGREIKHGVAIADSPLGPYTKSEYNPITNSGHEVAVWPYKGGMATMLTTDGPEKNTCQWAEDGINFDIMSHIKGAPEAVGFFRPDSDDPISGIEWGLSHKYDASWNWNYLCFFKTRRQVLDAGSYQQTGDSGAVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 32, N terminal
publication title Crystal structure of a key enzyme in the agarolytic pathway, alpha-neoagarobiose hydrolase from Saccharophagus degradans 2-40
pubmed doi rcsb
source organism Saccharophagus degradans
total genus 85
structure length 360
sequence length 362
chains with identical sequence B
ec nomenclature ec 3.2.1.-:
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.640 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3r4yA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3r4yA02
4FFGA 3C2UA 3QZ4A 2YFTA 4ONZA 3WATA 1W2TA 3C7OA 3WN1A 2EXJA 5FIXA 2AEZA 2B4WA 1UYPA 2X8FA 4UDIA 3NQHA 5A8DA 3WPZA 3WPYA 3R67A 3LIGA 4KMIA 2QQUA 3AKFA 2OXBA 3VT1A 2QQWA 1UV4A 5A8CA 5FK8A 4PVIA 5FK7A 3P2NA 3D61A 3WMZA 3WPUA 3QC2A 4O8OA 5ANNA 3OM5A 3WMYA 3PIGA 3U14A 1ST8A 4EQVA 4FFFA 3BYKA 2YFRA 3LEMA 2EXIA 4O8PA 1YRZA 5FKCA 3LIHA 5B6SA 3LDKA 4N1IA 3UGFA 5JOWA 4D47A 4QQSA 4AK6A 3D60A 4O8NA 4COTA 4UDKE 4AK5A 3R4ZA 1YIFA 1WL7A 3LV4A 2QQVA 4U6DA 2EXKA 2AC1A 4FFHA 5FMDA 3WPVA 3D5ZA 3QEEA 1VKDA 3LFIA 5GLMA 2X8SA 5AYEA 3VSFA 3KF3A 5GLNA 3C7HA 1MKMA 1W18A 1Y7BA 5GLOA 3BYJA 3UGHA 1Y4WA 5GLRA 3WN0A 4AK7A 3AKIA 3QEDA 5JOZA 4PVAA 3WASA 5FLWA 3VT2A 3K1UA 3LF7A 1OYGA 1GYDB 3OM7A 4KC7A 4MLGA 5FMCA 5GLQA 3ZXJA 4KCBA 5B6TA 3VSRA 4N2RA 3VSSA 2EXHA 4UDKA 5AYCA 3BYNA 3D5YA 5C0PA 4KCAA 2XQRA 1Y9GA 3LDRA 3KF5A 5AY9A 3VT0A 5A7VA 5JOXA 4KC8A 5A7VB 3WAUA 5AYDA 4FFIA 3VSZA 5GLLA 1GYHA 1PT2A 3BYLA 3OM4A 3PIJA 1GYEB 2AEYA 3OM2A 5JOYA 3KSTA 3R4YA 5FMBA 3OM6A 1Y9MA 3C7EA 3UGGA 3WN2A 1YI7A 2VDTA 4NOVA 4U6BA 4N4BA 3RWKX 3CU9A 3C7FA 3SC7X 2YFSA 5GLPA 2X8TA 3AKGA 5FKBA 2ADDA 5GLKA 3C7GA 3U75A 3QEFA 3AKHA 4N2ZA 3TAWA 3ZXKA 3ZXLA 2ADEA 4UDJA 4UDGA
chains in the Genus database with same CATH superfamily
1FOSF 4JBZA 1A02F 2KLUA 2A45H 1SQPK 5CMZA 3CCJP 1HGVA 2E74B 3WPYA 1KORA 1PP9E 2QJPB 1NTMD 2AEFA 3RL0C 4NPDA 1W5CE 5FK7A 3BCCG 2ZVNB 1E5WA 1ZR2A 2OYHB 3CPWO 1M56D 4JYCA 1IFJA 4WWIA 3PTZA 4EQVA 3LIHA 4LLHA 5AVYB 1SQQJ 3TDKA 3TNUB 3R4ZA 1M90Q 4PJ0H 3RBZA 1SP4A 4EOTA 1FZCC 3L75G 3M0DC 1NWQA 1W18A 2I1JA 2N1TD 2V7QJ 2WT7B 4H0LD 3AE3C 2D2CB 3FX0A 3HD7A 4KCBA 3H1KG 2IBZG 2QJKB 5BU8B 1JCCA 1NJIQ 1L0NJ 3HE4A 4AQRD 4I7ZB 3G71P 1NTMJ 1EZVI 5AW7B 1YHQP 1FZAA 5KLVD 1L0LE 2QJPC 3OM4A 1FZBA 3OM2A 5TJHA 2QSIA 2W8ZA 1KQFB 2E5YA 3Q5RA 2ZJSE 4OGQD 5B5EH 3L70E 2ZVOB 4TT3H 2OYHC 2VDTA 1OWAA 2HFED 3RWKX 1KYOI 1SQBD 4OWFA 3CU9A 2FXMA 5GLPA 1N7LA 2ZXXA 3L71D 3ABVC 3GLMA 1NKZB 1J2JB 2A06E 4GDOA 3A2AA 3RK2B 2EXJA 5H2FE 4I6MC 4DT0A 1EXIA 1RH5B 2JP3A 1Z56A 2IFNA 2WQYC 3D6ZA 1N7SC 2ZT9B 3VN0A 2IZ0A 5KAIH 2QJKC 1H8AA 1LP1A 1SQVK 3CX5H 5KLVJ 5CCGC 1SLQA 2EXIA 4D47A 4HB1A 3M06A 2Q3EA 1EDLA 1KTMA 4JF7A 4OVNF 1SQBJ 1PIXA 3L72G 1IK7A 2KB7P 2JWAA 3LFIA 1K8AQ 1GU4A 1NTKD 1PPJE 5KJ7D 3RGUA 2OYOA 3TSIA 4ZNCA 4D6TE 5L8RJ 1IO4A 1K73Q 3RK2C 1LTJB 3G6EP 3BYNA 1S4XA 5AYCA 3V4WA 4KCAA 2BCCJ 3A5TA 1OFCX 2UWJE 5AW9B 4KC8A 1JY3P 1GL2A 3CCMP 3USSA 3WMM0 1JCDA 1U57A 3RK3E 4GIFA 1Q2NA 2E75B 1JTHA 3WU2H 1NO4A 4H44C 1GTWA 4KJMA 1JM0A 3P7KA 3VMXA 3FXEA 2IDBA 2YFSA 1FC2C 3H1HD 1LJ2A 2LXCB 2IFMA 2KP8A 5GLKA 3C7GA 1KQGB 3ZXLA 3R2PA 1T3UA 1VQMP 1NTKJ 3RBXA 3I55P 3L36A 3KDPB 3T97B 3UIAA 1EXJA 3L71G 1NU1E 5AVZB 4C46A 1EZVE 1SQXK 3MGNA 4GT1A 3D61A 1LTJC 2K1AA 1P84E 1ST8A 2YFRA 1ZP0C 4MN4C 4IFMA 3E7KA 4DJGA 4WY4B 2GA1A 3TGUD 1KYOE 3IN6A 3LV4A 4N3YB 2GUSA 3O6QB 1VQ8P 3H1HJ 4BRYA 1VKDA 1VPCA 3KZIH 1FE6A 3H1LD 1QL1A 3AKIA 3M0AA 5AW5B 2QM7A 1Q90D 3PLNA 2QIWA 3Q2YA 2RKLA 4N6JA 1N86A 1YI2P 3AE7C 2O01J 1NTZD 1M1JB 4AYCA 1HTLC 5CJ4A 1RE4A 5AVQB 1KILB 1YQ3C 4RESB 5GTHE 4IFFA 3H1IJ 3M0DA 3TGUJ 1LT9C 2K9YA 3AKGA 4WY4C 1ZR4A 2H8PD 4UDGA 5BU5A 3LIDA 1W2TA 3C7OA 3S4RA 3H1LJ 2NPSD 2H88C 1YIJP 3VT1A 1NVOA 1L4AB 2BASA 1S2EA 3Q5PA 2YMYA 1CI6A 3GF7A 3W67A 1KB9I 1WRGA 1NTZJ 1JB0J 1IK9A 1PL5A 1JY3N 1M1JC 3UGFA 1JOCA 4QQSA 3TNUA 5AVVB 1HVVA 1RE3A 3AE8C 1KILC 1SQPE 3HUSC 5CJ0A 3D5ZA 1PP9D 2L91A 1R8EA 1W2EA 1N7SA 5AVRB 3TGUG 3QEDA 2WSEH 3TYYA 2FFDB 2FYUE 3ITKA 2DW3A 1NAYA 3F89A 5TISH 4O9BA 1OW6A 2LKMA 5CCGA 1EDJA 2XQRA 5E79E 1PGJA 2ITAA 5APUA 3PJSK 3BYLA 1L4AC 5JOYA 3E1IA 2G3AA 4Y99B 1BDDA 1SFCD 5AW6B 4GKGA 1IFDA 1NTZG 3QEFA 1H89A 2WZ7A 2ADEA 2E43A 1PP9J 5CHXA 2N1TB 3QZ4A 3AE2C 2M5AA 4GOFA 2B89A 1L0LD 1NU1K 5APQA 1JY2O 3VOPA 3H1JE 3I56P 2OQQA 1DX7A 2FFDC 2V7QH 1UV4A 3P2NA 2YO3A 2WMMA 2FYNC 4K35A 2FY8A 4OGQB 3FWNA 1YRZA 2A06D 1FJPA 4O8NA 4HH2A 4AK5A 4RKUJ 5DJUB 3AEFC 1NKNA 3AECC 3KXDA 1G1JA 4Y99C 3WUUA 2Y9YA 3U1CA 1YJWP 5BVZA 2J58A 4IL6E 1KYOH 4LGDE 3OM7A 1L0LJ 1SQVE 2N1TC 2R44A 2ZYDA 2C9NY 4WB4A 3Q1MA 3LDRA 3L70J 1RF1A 3U59A 3H32B 1J1EB 2KZIA 2SPZA 2W6AA 1DEBA 1RF0C 4PV1B 5FMBA 2IX7C 3SWYA 5B66E 4D6TD 3HD7D 4OGQC 2YIUB 2ADDA 3HTKA 1OXZA 5AVSB 3L73G 1YITP 3WN1A 1PGQA 3H25A 3AEBC 3RK3D 3JC22 3T97A 1ZW0A 2QQWA 4W7ZA 1NHLA 2CK3H 5FK8A 2E5TA 2WVRA 3M9HA 4U7JA 1LT9A 1GMJA 4O8PA 1KZUB 1J1EC 4WY4A 4UDKE 2OTJP 3AEGC 1L0ND 4XE5B 4PV1C 3I5CA 4D6TJ 1JUNA 1UIXA 1H0TA 4PD4E 1EZVD 3KF3A 5CBNA 2CPBA 1Y7BA 2A06G 2FYUK 1SQXE 2YIUC 1Y4WA 2WPVB 1JEKA 2C0XA 3VT2A 3CC7P 2YNYA 2OARA 3VSRA 1VF5D 3FWLA 2WPQA 2H43A 1KYOD 3B5NA 2FKWB 5AW0B 2RMZA 1VQPP 1NYHA 4UB8H 4IL6X 3AE4C 1EDIA 5GLLA 1GYHA 4UB6E 3EWKA 5KAFE 1URQC 1BCCG 3HUSA 3B4SA 1N73B 2P7JA 4N78E 2FXOA 3V5BA 1BGYG 3CCEP 3U75A 2E74C 3ZXKA 1NU1J 3KPEA 2NZ2A 1GL2D 3P8CE 3V2RA 2KNCA 1P84I 1Q7YQ 2B4WA 1NGMB 1AJYA 3WPZA 4BXLA 3QH9A 1XTGB 4KMIA 3HE5B 1L4AA 1K04A 2QG4A 4H13D 4K3AA 3G4SP 2R3CA 3CCSP 5EFWB 4O8OA 1SQQG 2K9JB 3OM5A 3CWBD 4FFFA 3BVHA 1RQVA 2O01H 3PH0A 3OJAB 1GW4A 2BCCD 2KIKA 3D71A 1QL2A 2HYNA 2Q9IA 2D2CC 1N73C 2WSFH 3BCCE 1HGZA 2Y0EA 1BSHA 3VSFA 5GLNA 2JJLA 3VP9A 4I7ZC 2FFDA 2XDJA 1GW3A 3CXHE 1OYGA 1L0NG 2Q5UA 1NTMG 2OGUA 1WT6A 1LT1A 4W7YA 5AY9A 1Y9GA 3AE5C 1RHZB 2AXTH 1LTIC 3G3ZA 1SQPD 3L75E 1OZHA 2B87B 3OAKA 1LWUB 1KILE 2WSSH 3CLQA 1UIIA 1IFNA 1YYCA 3C7EA 3CWBJ 1KV4A 2XU6A 4N4BA 1TU3F 3JCUH 2O01N 5CCHC 4L74A 3LW5J 2PP6A 1KB9H 3TF5A 5KTBA 4C7NB 3TAWA 2N1TA 3CCUP 3V2QA 3VMAA 1DD3A 1ZLLA 2QVAA 2ZT9C 1ZOYC 1RQUA 2AXCA 3S9OA 2A45I 5GTIH 2KI7B 1U7JA 1QVFO 2V4HA 5KLVG 1VQKP 1ZRTD 1VDFA 3D6YA 1SQPJ 1S5LE 2HR3A 3CMEP 1SFCB 1SQBG 1LWUC 3GG2A 1OVVA 1QGKB 2EXKA 1Q82Q 1K05A 1QLED 2KS1B 3CWBG 1BDCA 3V4QA 3NFQA 3A0BE 1RY3A 1T6AA 4EDFA 4ZKPA 3U1AA 3H1ID 2FYZA 3K1UA 3BRTB 1HH0A 2BCCG 2Z5HA 5K5GB 3VSSA 1S3JA 3C8VA 1VQ9P 1KC8Q 2E75C 3P8MC 3L72E 3L35A 2HODB 3WAUA 1VQLP 3PP5A 3A0HE 2ZYGA 1N7SD 1KD1Q 4NPEA 1JMMA 3L74E 3CC4P 2KZJA 3A3YB 3JSVC 1M57D 2IYPA 1SQVD 2LR2A 5CCGD 1SFCC 1NTKG 1EDKA 4N2ZA 3C2UA 1KB9D 3V2PA 5FIXA 2OYIB 5APSA 4RJTA 1BE3D 4UDIA 2WSFJ 1FZCA 2MKVA 2Y9ZA 4JQ0D 2XNXA 1T2KD 1DEEG 1URQA 1OVUA 2KK7A 3CL3D 3QC2A 2KXPB 3SWKA 2XZRA 1EQ7A 1FDOA 2KLVA 2O1KA 3CX5I 1Y47A 3MUDC 1LTTC 3M9BA 2J5UA 3HD7B 3L71E 4LC1A 1YIFA 3H1HG 3S1KA 1SQVJ 1JY2P 2Q6QA 2OYHA 1ZV8A 4H44D 1FOSE 5H2FH 3RK3B 5GLRA 2JWDA 3LF7A 1VQ5P 2QJYB 1W2BO 5FMCA 1BE3J 4N2RA 1OX3A 2OYIC 2E76D 2XNDH 3NMDA 3CC2P 1HJ0A 1KQLA 3H1IG 3PIJA 1KFNA 3KSTA 3IAOA 4Z1MH 2WT7A 1SQXD 3UGGA 1FZEA 4WBAA 1VQNP 3FGAD 2W6BA 4PJ0E 1N2DC 1YQ4C 3EFFK 2LXBA 1GK6A 3FXDA 2K3RA 3H1LG 1LP1B 2JR8A 1SQVG 1AV1A 3IR9A 2OXBA 4N78D 1SQQK 2J59M 2QJYC 4R4LA 3ZDMA 3BASA 2IYOA 3AEDC 4L75A 4PD4I 1BE3G 1L2PA 4EYYQ 5CCHA 3BYKA 1OW7A 3RL0g 4H0LB 3P8CD 3MHVA 3VMZA 2WITA 3B71A 1J1DB 1EC5A 3SWFA 3D60A 2QM8A 5B5EE 1SQXJ 2N9BA 5KKZB 1GZLA 1HWTC 3L70D 3B8EB 3WPVA 3QEEA 3VYIA 5AYEA 1GL2B 1L0NK 3HRNA 1NTMK 1JTHB 4PVAA 3WASA 1FDIA 2WSCJ 4XA4A 3AEAC 1GD2E 4H13B 4UDKA 2POHA 5KLIB 1KN7A 3D70A 3VT0A 1S9KE 2E42A 3PHLA 1P84H 4KHXA 5KAIE 2JKVA 2AEYA 1IFIA 3TGUE 3R4YA 3CX5E 1Q81Q 2R32A 1JMBA 3V6IA 1JNMA 1LTJA 1PP9G 2X8TA 4H0LC 4I1LA 3B5ND 5KKZC 4XFJA 2IPPA 2GM4A 4OH8B 3NTNA 2KOGA 3WATA 1SQXG 3L75D 1R5SA 2ZYAA 1PPJD 1GL2C 3SFEC 1JY2N 5KLVK 3R67A 4DOJA 2Z4EA 4EIJA 3MTUE 1NTZE 2GUVA 1U7MA 5A8CA 3AE6C 1PZQA 2R5BA 3K5BA 3KYQA 1AA0A 4H13C 1SQBK 5ANNA 5APTA 3BCCJ 5GTHH 1ZXGA 3LDKA 3CXHI 4CPGA 1ZN5A 4TLFA 1YJ9P 2QE7H 3MP7B 1NH4A 1USDA 5CBOA 1NAFA 3C7HA 4U3FE 1L0LG 3UGHA 1X0TA 3WN0A 2NRGA 1USEA 3LW5H 3L75J 5FLWA 2YXRB 4BWNA 5GLQA 3L70G 3KQGA 1CSBA 3CCRP 2IBZI 2W6JH 3KF5A 2HODA 1NU1D 1AFOA 3O6QA 5AYDA 3BRVB 4FFIA 1JO5A 2K37A 3OM6A 1Y9MA 5AVWB 1R5LA 1P84D 5KJ7C 1NTKK 1BSNA 2P58A 1HBWA 5APVA 1M1JA 2IZ1A 1QX8A 3L72D 1CI6B 3KZIE 2OYIA 1G2CB 1PGPA 1KILA 2M3BA 3QWOC 3M91A 2WPSA 3L74D 1RE4C 1LTBC 2Z5IA 1LGHB 5E79H 4PVIA 3WMZA 1DIPA 1FZFA 3L73E 1QVGO 1MV8A 1IFPA 1N7SB 1PPJG 2B9BA 3LEMA 5FKCA 4D6TG 3N7NA 4COTA 3VTPC 2MJZA 2RN0A 1YTZT 4HKZH 2AC1A 2QA4P 2HG5D 5AVXB 4NPFX 5C2MA 1YTZI 1AVYA 4Y28J 1D7MA 3L72J 2G8YA 3TK1A 1CW5A 1FJKA 3ZXJA 2EXHA 2N9YB 3O8ZA 4JYBA 3L74J 5M1BA 2YKQA 2P67A 4DZOA 2M8RA 1RE3C 2KUBA 1KFMA 2M5AB 2FXPA 3SFDC 2NPSB 3IFMA 1YI7A 1FDMA 1GU5A 1NU1G 1AQ5A 1WMKA 1EZVG 3AKHA 3NXSA 4H44B 4R4MA 1VQ6P 2HLOA 4ONZA 4IL6H 2Q1KA 1BCCE 4PV1D 5AW2B 1Y8AA 1NTZK 2X8FA 1IFMA 3RL0D 1BGYE 2E76B 3H1KE 3LIEA 3LIGA 2IBZE 2HPCB 1M1KQ 1Q86Q 1DD4A 2FYUD 5TISE 3CMAP 3L37A 3L71J 1T2KC 3A7OA 3OA7A 4GODA 3KHUA 5B66H 3L74G 3C1LA 5B6SA 2Q3IA 1MFZA 1IZNB 1CZQA 1A02J 1HJBA 2QQVA 4U6DA 1RF0A 2WWWA 2NPSC 1RF1B 5DJTB 2R5DA 1SVFA 1URQD 1E79H 1YJNP 5GLMA 2X8SA 1X79B 3GW6A 5AVTB 1FZGA 1SQQE 1GK4A 2L5GB 4MLGA 1GYDB 2E74D 3H1JD 3C9IA 3HTKB 3V2NA 2FYUJ 2P10A 5A7VB 2QRXA 2E76C 2PFXA 1PT2A 1QEXA 2YKOA 3GHGB 1L0NE 2W83C 4NOVA 1FBMA 1NTME 3F5HA 1TL2A 3SC7X 4M3LA 1S1CX 1K9MQ 2I1KA 4PD4H 3H32A 2QEXP 4UDJA 4FFGA 1OVRA 2OTKE 1LT9B 1S9KD 1RF1C 2O3JA 1PV3A 2AEZA 4L73A 1LNQA 2A45G 3CX5D 4C7RA 2WTYA 2I8DA 4JPZB 2D2CD 3AKFA 3WUTA 1LTAC 4AUWA 1SQPG 1HUCA 4L76A 1H0TB 3H1JJ 4UB6H 1PGOA 2KYVA 5KJ7A 5KAFH 2WSCH 4RO0A 3PIGA 1VQ7P 4GOEA 1JY3O 4ASWA 2FYUG 2H89C 3GHGC 1L0LK 2VRSA 3B5NB 3CCVP 5FMDA 1X22A 5KLVE 2B88A 2YMKA 1MZ9A 1M7LA 3GMAA 2O1JA 4YTPC 1IC2A 3AE1C 3CI9A 4AK7A 3RK2D 5AVUB 3HUSB 5CCHD 4KC7A 1NOHA 4HYTB 1SQBE 2BEQD 4W80A 2ZFCA 2JDIH 5JOXA 1S5LX 3HE4B 2ZT9D 3CWBE 4HJGH 1IJDB 4ZKUA 1DH3A 2KNCB 4U3FD 1XTCC 2BCCE 2JEEA 2R3SA 3H1JG 3MIWA 3SSUA 2AEJA 3IF4A 2ZXEB 4QMAA 1S72P 2YFTA 3EQ2A 1G2CA 3B5NC 4PD4D 1GDTA 3CXHH 3NQHA 2W90A 5AW1B 1N73A 3MD0A 2Y0DA 1T3JA 2H7HA 4ASVA 1T8ZA 5APYA 1OMIA 3H6PA 2OTLP 1NTKE 2C0WA 3HD7C 5APWA 4ZMDA 4UB8E 2PGDA 5APXA 3WMYA 3U14A 2E75D 2YKPA 5JOWA 4AK6A 2K88A 4U3FJ 1LTSC 1VF5B 1AVOA 1MFTA 3HE5A 3RK3C 2FYNB 4FFHA 3VMYA 3N4XA 2AEMA 1H88A 3G9RA 1X8YA 1FS0E 2K9JA 5GLOA 1YBKA 3BYJA 3CCQP 3L73D 1KQSO 1OIPA 3GF3A 3H1HE 3WUVA 3AE9C 4EI2A 3E1RA 3VP8A 2PAJA 2FBWC 1ZRTE 2WPRA 1VL2A 2XV5A 2YO2A 3M9QA 1S5LH 2CPSA 2NPSA 3WN2A 4YPCA 1FU1A 3OW2O 4WY4D 3C7FA 3W68A 1G1IA 2PRRA 1X9VA 5AW4B 5C39A 1VF5C 3A0BH 2P2UA 2B87A 4U3FG 3H1IE 2M3EA 1LWUA 2P1JA 3BCCD 1VQOP 3P32A 5AW3B 2Q7CA 1UYPA 1LTGC 5A8DA 3L73J 4YXDC 2M0BA 1N8RQ 2HPCA 3CD6P 1VQ4P 2Y0CA 3CXHD 2QQUA 4I2LC 3AEEC 2XKMA 2AXTE 4C7NA 1J1DC 4IOIH 3WPUA 3H1LE 3A0HH 2BEZF 2KSEA 4WVZA 1KILD 4N1IA 1BCCD 1WL7A 1Y9BA 1BGYD 3H1KD 4B86A 3JCUE 2IBZD 3BATA 1SS1A 3EFGA 1OW8A 1M8OB 1KB9E 4BRYB 2JO1A 3Q5SA 1BE3E 4YXWH 1MKMA 5KLIC 1PFIA 5AW8B 5JOZA 3RL0B 1KMIZ 1SFCA 3WU2E 5B6TA 5GTIE 2RH0A 3D5YA 5C0PA 1AQTA 4IFDK 5A7VA 2ZAEB 1L4AD 3Q3DA 1MUUA 3MZWB 2KS1A 3II6A 3L4FA 3VSZA 3GHGA 4A7PA 4DCKA 1GYEB 2W27A 2C9LY 2KSJA 1SQQD 4KT0J 3PRJA 1FZCB 4U6BA 2YXQB 1BCCJ 1ZMEC 1FAVA 2WSEJ 1URQB 5FKBA 3CCLP 1HF9A 1BGYJ 3H1KJ 3MUDA
chains in the Genus database with same CATH topology
4R4MA 3C2UA 3QZ4A 4ONZA 3AE2C 5FIXA 4PV1D 2X8FA 4UDIA 2WSFJ 2E74B 3WPYA 1KORA 2E76B 3LIGA 2MKVA 1DD4A 2OQQA 1UV4A 5FK7A 3P2NA 3QC2A 2FYNC 1FDOA 4EQVA 4OGQB 1YRZA 3LIHA 5B6SA 2J5UA 4O8NA 4AK5A 3R4ZA 1YIFA 4RKUJ 2QQVA 3AEFC 3AECC 4U6DA 5GLMA 2X8SA 4H44D 1W18A 5GLRA 2V7QJ 3LF7A 4MLGA 1GYDB 4H0LD 3OM7A 3AE3C 5FMCA 2D2CB 4KCBA 4N2RA 2E74D 2E76D 3Q1MA 3LDRA 1HJ0A 4I7ZB 2P10A 5A7VB 2E76C 1PT2A 2QJPC 3OM4A 3PIJA 3OM2A 3KSTA 4PV1B 3IAOA 4Z1MH 2QSIA 1KQFB 5FMBA 3Q5RA 4OGQD 3UGGA 4TT3H 2VDTA 4NOVA 3RWKX 3CU9A 3SC7X 4OGQC 3FGAD 5GLPA 1S1CX 1YQ4C 2ADDA 3ABVC 3GLMA 4UDJA 4FFGA 4GDOA 3WN1A 3H25A 2EXJA 1EXIA 3AEBC 1PV3A 2AEZA 2JP3A 2WQYC 3D6ZA 2D2CD 3AKFA 2OXBA 2QQWA 2ZT9B 2QJYC 4R4LA 5FK8A 3AEDC 2QJKC 3PIGA 4U7JA 3BYKA 1OW7A 3RL0g 1GMJA 2EXIA 4O8PA 4H0LB 4D47A 3B71A 3D60A 4UDKE 2H89C 3AEGC 4PV1C 1KTMA 5FMDA 3WPVA 1PIXA 3QEEA 1UIXA 1IK7A 2YMKA 3LFIA 5AYEA 3GMAA 3KF3A 1Y7BA 2YIUC 1Y4WA 4YTPC 3AE1C 2WPVB 4AK7A 4PVAA 3WASA 3VT2A 4KC7A 1FDIA 5L8RJ 2BEQD 3VSRA 2WSCJ 1VF5D 3AEAC 4UDKA 4H13B 3BYNA 5AYCA 4KCAA 3D70A 3VT0A 5JOXA 1S5LX 2ZT9D 4KC8A 1NYHA 4IL6X 3AE4C 5GLLA 1GYHA 1U57A 3RK3E 3EWKA 2AEYA 2E75B 3R4YA 4H44C 2IDBA 2YFSA 2X8TA 4H0LC 5GLKA 3C7GA 3U75A 2E74C 5KKZC 4XFJA 3ZXKA 1KQGB 3ZXLA 2NZ2A 2YFTA 3WATA 2B4WA 3NQHA 3SFEC 1NGMB 1AJYA 3WPZA 3T97B 1EXJA 3R67A 4KMIA 1K04A 4H13D 1OMIA 5A8CA 3AE6C 3D61A 4O8OA 4H13C 5ANNA 3OM5A 3WMYA 3U14A 1ST8A 4FFFA 2YFRA 1ZP0C 2E75D 3LDKA 5JOWA 1RQVA 4AK6A 1VF5B 3IN6A 3LV4A 3D71A 4FFHA 2D2CC 3G9RA 1VKDA 3VSFA 5GLNA 3C7HA 5GLOA 3UGHA 3BYJA 3WN0A 3AKIA 4I7ZC 5FLWA 1OYGA 5GLQA 1Q90D 2QIWA 3GF3A 3Q2YA 3AE9C 5AY9A 1Y9GA 3AE7C 3KF5A 2FBWC 3AE5C 1ZRTE 2O01J 1VL2A 3O6QA 5AYDA 4FFIA 1KILE 3OM6A 1Y9MA 3C7EA 1YQ3C 3WN2A 4N4BA 1TU3F 3C7FA 2K9YA 3LW5J 3AKGA 3TAWA 1VF5C 4UDGA 1W2TA 1DD3A 3C7OA 2ZT9C 1ZOYC 1RQUA 1UYPA 3S9OA 5A8DA 4YXDC 2H88C 2QQUA 3VT1A 3AEEC 4PVIA 3Q5PA 3WMZA 3WPUA 1DIPA 3GF7A 3D6YA 1JB0J 1PL5A 2BEZF 3LEMA 5FKCA 4N1IA 3UGFA 4QQSA 4COTA 1WL7A 1Y9BA 3AE8C 2EXKA 2AC1A 3D5ZA 1K05A 1OW8A 1R8EA 2JO1A 4Y28J 3Q5SA 1MKMA 5KLIC 3QEDA 5JOZA 2G8YA 3K1UA 1KMIZ 3ZXJA 5B6TA 3VSSA 2EXHA 3C8VA 1OW6A 2E75C 3D5YA 5C0PA 2XQRA 5M1BA 5A7VA 3Q3DA 3WAUA 3VSZA 3BYLA 1GYEB 5JOYA 2FXPA 3SFDC 4KT0J 2G3AA 1YI7A 4U6BA 1ZMEC 1WMKA 2WSEJ 5FKBA 1HF9A 3QEFA 3AKHA 4N2ZA 4H44B 2ADEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FFG A;  3C2U A;  3QZ4 A;  2YFT A;  4ONZ A;  3WAT A;  1W2T A;  3C7O A;  3WN1 A;  2EXJ A;  5FIX A;  2AEZ A;  2B4W A;  1UYP A;  2X8F A;  4UDI A;  3NQH A;  5A8D A;  3WPZ A;  3WPY A;  3R67 A;  3LIG A;  4KMI A;  2QQU A;  3AKF A;  2OXB A;  3VT1 A;  2QQW A;  1UV4 A;  5A8C A;  5FK8 A;  4PVI A;  5FK7 A;  3P2N A;  3D61 A;  3WMZ A;  3WPU A;  3QC2 A;  4O8O A;  5ANN A;  3OM5 A;  3WMY A;  3PIG A;  3U14 A;  1ST8 A;  4EQV A;  4FFF A;  3BYK A;  2YFR A;  3LEM A;  2EXI A;  4O8P A;  1YRZ A;  5FKC A;  3LIH A;  5B6S A;  3LDK A;  4N1I A;  3UGF A;  5JOW A;  4D47 A;  4QQS A;  4AK6 A;  3D60 A;  4O8N A;  4COT A;  4UDK E;  4AK5 A;  3R4Z A;  1YIF A;  1WL7 A;  3LV4 A;  2QQV A;  4U6D A;  2EXK A;  2AC1 A;  4FFH A;  5FMD A;  3WPV A;  3D5Z A;  3QEE A;  1VKD A;  3LFI A;  5GLM A;  2X8S A;  5AYE A;  3VSF A;  3KF3 A;  5GLN A;  3C7H A;  1MKM A;  1W18 A;  1Y7B A;  5GLO A;  3BYJ A;  3UGH A;  1Y4W A;  5GLR A;  3WN0 A;  4AK7 A;  3AKI A;  3QED A;  5JOZ A;  4PVA A;  3WAS A;  5FLW A;  3VT2 A;  3K1U A;  3LF7 A;  1OYG A;  1GYD B;  3OM7 A;  4KC7 A;  4MLG A;  5FMC A;  5GLQ A;  3ZXJ A;  4KCB A;  5B6T A;  3VSR A;  4N2R A;  3VSS A;  2EXH A;  4UDK A;  5AYC A;  3BYN A;  3D5Y A;  5C0P A;  4KCA A;  2XQR A;  1Y9G A;  3LDR A;  3KF5 A;  5AY9 A;  3VT0 A;  5A7V A;  5JOX A;  4KC8 A;  5A7V B;  3WAU A;  5AYD A;  4FFI A;  3VSZ A;  5GLL A;  1GYH A;  1PT2 A;  3BYL A;  3OM4 A;  3PIJ A;  1GYE B;  2AEY A;  3OM2 A;  5JOY A;  3KST A;  3R4Y A;  5FMB A;  3OM6 A;  1Y9M A;  3C7E A;  3UGG A;  3WN2 A;  1YI7 A;  2VDT A;  4NOV A;  4U6B A;  4N4B A;  3RWK X;  3CU9 A;  3C7F A;  3SC7 X;  2YFS A;  5GLP A;  2X8T A;  3AKG A;  5FKB A;  2ADD A;  5GLK A;  3C7G A;  3U75 A;  3QEF A;  3AKH A;  4N2Z A;  3TAW A;  3ZXK A;  3ZXL A;  2ADE A;  4UDJ A;  4UDG A; 
#chains in the Genus database with same CATH topology
 1FOS F;  4JBZ A;  1A02 F;  2KLU A;  2A45 H;  1SQP K;  5CMZ A;  3CCJ P;  1HGV A;  2E74 B;  3WPY A;  1KOR A;  1PP9 E;  2QJP B;  1NTM D;  2AEF A;  3RL0 C;  4NPD A;  1W5C E;  5FK7 A;  3BCC G;  2ZVN B;  1E5W A;  1ZR2 A;  2OYH B;  3CPW O;  1M56 D;  4JYC A;  1IFJ A;  4WWI A;  3PTZ A;  4EQV A;  3LIH A;  4LLH A;  5AVY B;  1SQQ J;  3TDK A;  3TNU B;  3R4Z A;  1M90 Q;  4PJ0 H;  3RBZ A;  1SP4 A;  4EOT A;  1FZC C;  3L75 G;  3M0D C;  1NWQ A;  1W18 A;  2I1J A;  2N1T D;  2V7Q J;  2WT7 B;  4H0L D;  3AE3 C;  2D2C B;  3FX0 A;  3HD7 A;  4KCB A;  3H1K G;  2IBZ G;  2QJK B;  5BU8 B;  1JCC A;  1NJI Q;  1L0N J;  3HE4 A;  4AQR D;  4I7Z B;  3G71 P;  1NTM J;  1EZV I;  5AW7 B;  1YHQ P;  1FZA A;  5KLV D;  1L0L E;  2QJP C;  3OM4 A;  1FZB A;  3OM2 A;  5TJH A;  2QSI A;  2W8Z A;  1KQF B;  2E5Y A;  3Q5R A;  2ZJS E;  4OGQ D;  5B5E H;  3L70 E;  2ZVO B;  4TT3 H;  2OYH C;  2VDT A;  1OWA A;  2HFE D;  3RWK X;  1KYO I;  1SQB D;  4OWF A;  3CU9 A;  2FXM A;  5GLP A;  1N7L A;  2ZXX A;  3L71 D;  3ABV C;  3GLM A;  1NKZ B;  1J2J B;  2A06 E;  4GDO A;  3A2A A;  3RK2 B;  2EXJ A;  5H2F E;  4I6M C;  4DT0 A;  1EXI A;  1RH5 B;  2JP3 A;  1Z56 A;  2IFN A;  2WQY C;  3D6Z A;  1N7S C;  2ZT9 B;  3VN0 A;  2IZ0 A;  5KAI H;  2QJK C;  1H8A A;  1LP1 A;  1SQV K;  3CX5 H;  5KLV J;  5CCG C;  1SLQ A;  2EXI A;  4D47 A;  4HB1 A;  3M06 A;  2Q3E A;  1EDL A;  1KTM A;  4JF7 A;  4OVN F;  1SQB J;  1PIX A;  3L72 G;  1IK7 A;  2KB7 P;  2JWA A;  3LFI A;  1K8A Q;  1GU4 A;  1NTK D;  1PPJ E;  5KJ7 D;  3RGU A;  2OYO A;  3TSI A;  4ZNC A;  4D6T E;  5L8R J;  1IO4 A;  1K73 Q;  3RK2 C;  1LTJ B;  3G6E P;  3BYN A;  1S4X A;  5AYC A;  3V4W A;  4KCA A;  2BCC J;  3A5T A;  1OFC X;  2UWJ E;  5AW9 B;  4KC8 A;  1JY3 P;  1GL2 A;  3CCM P;  3USS A;  3WMM 0;  1JCD A;  1U57 A;  3RK3 E;  4GIF A;  1Q2N A;  2E75 B;  1JTH A;  3WU2 H;  1NO4 A;  4H44 C;  1GTW A;  4KJM A;  1JM0 A;  3P7K A;  3VMX A;  3FXE A;  2IDB A;  2YFS A;  1FC2 C;  3H1H D;  1LJ2 A;  2LXC B;  2IFM A;  2KP8 A;  5GLK A;  3C7G A;  1KQG B;  3ZXL A;  3R2P A;  1T3U A;  1VQM P;  1NTK J;  3RBX A;  3I55 P;  3L36 A;  3KDP B;  3T97 B;  3UIA A;  1EXJ A;  3L71 G;  1NU1 E;  5AVZ B;  4C46 A;  1EZV E;  1SQX K;  3MGN A;  4GT1 A;  3D61 A;  1LTJ C;  2K1A A;  1P84 E;  1ST8 A;  2YFR A;  1ZP0 C;  4MN4 C;  4IFM A;  3E7K A;  4DJG A;  4WY4 B;  2GA1 A;  3TGU D;  1KYO E;  3IN6 A;  3LV4 A;  4N3Y B;  2GUS A;  3O6Q B;  1VQ8 P;  3H1H J;  4BRY A;  1VKD A;  1VPC A;  3KZI H;  1FE6 A;  3H1L D;  1QL1 A;  3AKI A;  3M0A A;  5AW5 B;  2QM7 A;  1Q90 D;  3PLN A;  2QIW A;  3Q2Y A;  2RKL A;  4N6J A;  1N86 A;  1YI2 P;  3AE7 C;  2O01 J;  1NTZ D;  1M1J B;  4AYC A;  1HTL C;  5CJ4 A;  1RE4 A;  5AVQ B;  1KIL B;  1YQ3 C;  4RES B;  5GTH E;  4IFF A;  3H1I J;  3M0D A;  3TGU J;  1LT9 C;  2K9Y A;  3AKG A;  4WY4 C;  1ZR4 A;  2H8P D;  4UDG A;  5BU5 A;  3LID A;  1W2T A;  3C7O A;  3S4R A;  3H1L J;  2NPS D;  2H88 C;  1YIJ P;  3VT1 A;  1NVO A;  1L4A B;  2BAS A;  1S2E A;  3Q5P A;  2YMY A;  1CI6 A;  3GF7 A;  3W67 A;  1KB9 I;  1WRG A;  1NTZ J;  1JB0 J;  1IK9 A;  1PL5 A;  1JY3 N;  1M1J C;  3UGF A;  1JOC A;  4QQS A;  3TNU A;  5AVV B;  1HVV A;  1RE3 A;  3AE8 C;  1KIL C;  1SQP E;  3HUS C;  5CJ0 A;  3D5Z A;  1PP9 D;  2L91 A;  1R8E A;  1W2E A;  1N7S A;  5AVR B;  3TGU G;  3QED A;  2WSE H;  3TYY A;  2FFD B;  2FYU E;  3ITK A;  2DW3 A;  1NAY A;  3F89 A;  5TIS H;  4O9B A;  1OW6 A;  2LKM A;  5CCG A;  1EDJ A;  2XQR A;  5E79 E;  1PGJ A;  2ITA A;  5APU A;  3PJS K;  3BYL A;  1L4A C;  5JOY A;  3E1I A;  2G3A A;  4Y99 B;  1BDD A;  1SFC D;  5AW6 B;  4GKG A;  1IFD A;  1NTZ G;  3QEF A;  1H89 A;  2WZ7 A;  2ADE A;  2E43 A;  1PP9 J;  5CHX A;  2N1T B;  3QZ4 A;  3AE2 C;  2M5A A;  4GOF A;  2B89 A;  1L0L D;  1NU1 K;  5APQ A;  1JY2 O;  3VOP A;  3H1J E;  3I56 P;  2OQQ A;  1DX7 A;  2FFD C;  2V7Q H;  1UV4 A;  3P2N A;  2YO3 A;  2WMM A;  2FYN C;  4K35 A;  2FY8 A;  4OGQ B;  3FWN A;  1YRZ A;  2A06 D;  1FJP A;  4O8N A;  4HH2 A;  4AK5 A;  4RKU J;  5DJU B;  3AEF C;  1NKN A;  3AEC C;  3KXD A;  1G1J A;  4Y99 C;  3WUU A;  2Y9Y A;  3U1C A;  1YJW P;  5BVZ A;  2J58 A;  4IL6 E;  1KYO H;  4LGD E;  3OM7 A;  1L0L J;  1SQV E;  2N1T C;  2R44 A;  2ZYD A;  2C9N Y;  4WB4 A;  3Q1M A;  3LDR A;  3L70 J;  1RF1 A;  3U59 A;  3H32 B;  1J1E B;  2KZI A;  2SPZ A;  2W6A A;  1DEB A;  1RF0 C;  4PV1 B;  5FMB A;  2IX7 C;  3SWY A;  5B66 E;  4D6T D;  3HD7 D;  4OGQ C;  2YIU B;  2ADD A;  3HTK A;  1OXZ A;  5AVS B;  3L73 G;  1YIT P;  3WN1 A;  1PGQ A;  3H25 A;  3AEB C;  3RK3 D;  3JC2 2;  3T97 A;  1ZW0 A;  2QQW A;  4W7Z A;  1NHL A;  2CK3 H;  5FK8 A;  2E5T A;  2WVR A;  3M9H A;  4U7J A;  1LT9 A;  1GMJ A;  4O8P A;  1KZU B;  1J1E C;  4WY4 A;  4UDK E;  2OTJ P;  3AEG C;  1L0N D;  4XE5 B;  4PV1 C;  3I5C A;  4D6T J;  1JUN A;  1UIX A;  1H0T A;  4PD4 E;  1EZV D;  3KF3 A;  5CBN A;  2CPB A;  1Y7B A;  2A06 G;  2FYU K;  1SQX E;  2YIU C;  1Y4W A;  2WPV B;  1JEK A;  2C0X A;  3VT2 A;  3CC7 P;  2YNY A;  2OAR A;  3VSR A;  1VF5 D;  3FWL A;  2WPQ A;  2H43 A;  1KYO D;  3B5N A;  2FKW B;  5AW0 B;  2RMZ A;  1VQP P;  1NYH A;  4UB8 H;  4IL6 X;  3AE4 C;  1EDI A;  5GLL A;  1GYH A;  4UB6 E;  3EWK A;  5KAF E;  1URQ C;  1BCC G;  3HUS A;  3B4S A;  1N73 B;  2P7J A;  4N78 E;  2FXO A;  3V5B A;  1BGY G;  3CCE P;  3U75 A;  2E74 C;  3ZXK A;  1NU1 J;  3KPE A;  2NZ2 A;  1GL2 D;  3P8C E;  3V2R A;  2KNC A;  1P84 I;  1Q7Y Q;  2B4W A;  1NGM B;  1AJY A;  3WPZ A;  4BXL A;  3QH9 A;  1XTG B;  4KMI A;  3HE5 B;  1L4A A;  1K04 A;  2QG4 A;  4H13 D;  4K3A A;  3G4S P;  2R3C A;  3CCS P;  5EFW B;  4O8O A;  1SQQ G;  2K9J B;  3OM5 A;  3CWB D;  4FFF A;  3BVH A;  1RQV A;  2O01 H;  3PH0 A;  3OJA B;  1GW4 A;  2BCC D;  2KIK A;  3D71 A;  1QL2 A;  2HYN A;  2Q9I A;  2D2C C;  1N73 C;  2WSF H;  3BCC E;  1HGZ A;  2Y0E A;  1BSH A;  3VSF A;  5GLN A;  2JJL A;  3VP9 A;  4I7Z C;  2FFD A;  2XDJ A;  1GW3 A;  3CXH E;  1OYG A;  1L0N G;  2Q5U A;  1NTM G;  2OGU A;  1WT6 A;  1LT1 A;  4W7Y A;  5AY9 A;  1Y9G A;  3AE5 C;  1RHZ B;  2AXT H;  1LTI C;  3G3Z A;  1SQP D;  3L75 E;  1OZH A;  2B87 B;  3OAK A;  1LWU B;  1KIL E;  2WSS H;  3CLQ A;  1UII A;  1IFN A;  1YYC A;  3C7E A;  3CWB J;  1KV4 A;  2XU6 A;  4N4B A;  1TU3 F;  3JCU H;  2O01 N;  5CCH C;  4L74 A;  3LW5 J;  2PP6 A;  1KB9 H;  3TF5 A;  5KTB A;  4C7N B;  3TAW A;  2N1T A;  3CCU P;  3V2Q A;  3VMA A;  1DD3 A;  1ZLL A;  2QVA A;  2ZT9 C;  1ZOY C;  1RQU A;  2AXC A;  3S9O A;  2A45 I;  5GTI H;  2KI7 B;  1U7J A;  1QVF O;  2V4H A;  5KLV G;  1VQK P;  1ZRT D;  1VDF A;  3D6Y A;  1SQP J;  1S5L E;  2HR3 A;  3CME P;  1SFC B;  1SQB G;  1LWU C;  3GG2 A;  1OVV A;  1QGK B;  2EXK A;  1Q82 Q;  1K05 A;  1QLE D;  2KS1 B;  3CWB G;  1BDC A;  3V4Q A;  3NFQ A;  3A0B E;  1RY3 A;  1T6A A;  4EDF A;  4ZKP A;  3U1A A;  3H1I D;  2FYZ A;  3K1U A;  3BRT B;  1HH0 A;  2BCC G;  2Z5H A;  5K5G B;  3VSS A;  1S3J A;  3C8V A;  1VQ9 P;  1KC8 Q;  2E75 C;  3P8M C;  3L72 E;  3L35 A;  2HOD B;  3WAU A;  1VQL P;  3PP5 A;  3A0H E;  2ZYG A;  1N7S D;  1KD1 Q;  4NPE A;  1JMM A;  3L74 E;  3CC4 P;  2KZJ A;  3A3Y B;  3JSV C;  1M57 D;  2IYP A;  1SQV D;  2LR2 A;  5CCG D;  1SFC C;  1NTK G;  1EDK A;  4N2Z A;  3C2U A;  1KB9 D;  3V2P A;  5FIX A;  2OYI B;  5APS A;  4RJT A;  1BE3 D;  4UDI A;  2WSF J;  1FZC A;  2MKV A;  2Y9Z A;  4JQ0 D;  2XNX A;  1T2K D;  1DEE G;  1URQ A;  1OVU A;  2KK7 A;  3CL3 D;  3QC2 A;  2KXP B;  3SWK A;  2XZR A;  1EQ7 A;  1FDO A;  2KLV A;  2O1K A;  3CX5 I;  1Y47 A;  3MUD C;  1LTT C;  3M9B A;  2J5U A;  3HD7 B;  3L71 E;  4LC1 A;  1YIF A;  3H1H G;  3S1K A;  1SQV J;  1JY2 P;  2Q6Q A;  2OYH A;  1ZV8 A;  4H44 D;  1FOS E;  5H2F H;  3RK3 B;  5GLR A;  2JWD A;  3LF7 A;  1VQ5 P;  2QJY B;  1W2B O;  5FMC A;  1BE3 J;  4N2R A;  1OX3 A;  2OYI C;  2E76 D;  2XND H;  3NMD A;  3CC2 P;  1HJ0 A;  1KQL A;  3H1I G;  3PIJ A;  1KFN A;  3KST A;  3IAO A;  4Z1M H;  2WT7 A;  1SQX D;  3UGG A;  1FZE A;  4WBA A;  1VQN P;  3FGA D;  2W6B A;  4PJ0 E;  1N2D C;  1YQ4 C;  3EFF K;  2LXB A;  1GK6 A;  3FXD A;  2K3R A;  3H1L G;  1LP1 B;  2JR8 A;  1SQV G;  1AV1 A;  3IR9 A;  2OXB A;  4N78 D;  1SQQ K;  2J59 M;  2QJY C;  4R4L A;  3ZDM A;  3BAS A;  2IYO A;  3AED C;  4L75 A;  4PD4 I;  1BE3 G;  1L2P A;  4EYY Q;  5CCH A;  3BYK A;  1OW7 A;  3RL0 g;  4H0L B;  3P8C D;  3MHV A;  3VMZ A;  2WIT A;  3B71 A;  1J1D B;  1EC5 A;  3SWF A;  3D60 A;  2QM8 A;  5B5E E;  1SQX J;  2N9B A;  5KKZ B;  1GZL A;  1HWT C;  3L70 D;  3B8E B;  3WPV A;  3QEE A;  3VYI A;  5AYE A;  1GL2 B;  1L0N K;  3HRN A;  1NTM K;  1JTH B;  4PVA A;  3WAS A;  1FDI A;  2WSC J;  4XA4 A;  3AEA C;  1GD2 E;  4H13 B;  4UDK A;  2POH A;  5KLI B;  1KN7 A;  3D70 A;  3VT0 A;  1S9K E;  2E42 A;  3PHL A;  1P84 H;  4KHX A;  5KAI E;  2JKV A;  2AEY A;  1IFI A;  3TGU E;  3R4Y A;  3CX5 E;  1Q81 Q;  2R32 A;  1JMB A;  3V6I A;  1JNM A;  1LTJ A;  1PP9 G;  2X8T A;  4H0L C;  4I1L A;  3B5N D;  5KKZ C;  4XFJ A;  2IPP A;  2GM4 A;  4OH8 B;  3NTN A;  2KOG A;  3WAT A;  1SQX G;  3L75 D;  1R5S A;  2ZYA A;  1PPJ D;  1GL2 C;  3SFE C;  1JY2 N;  5KLV K;  3R67 A;  4DOJ A;  2Z4E A;  4EIJ A;  3MTU E;  1NTZ E;  2GUV A;  1U7M A;  5A8C A;  3AE6 C;  1PZQ A;  2R5B A;  3K5B A;  3KYQ A;  1AA0 A;  4H13 C;  1SQB K;  5ANN A;  5APT A;  3BCC J;  5GTH H;  1ZXG A;  3LDK A;  3CXH I;  4CPG A;  1ZN5 A;  4TLF A;  1YJ9 P;  2QE7 H;  3MP7 B;  1NH4 A;  1USD A;  5CBO A;  1NAF A;  3C7H A;  4U3F E;  1L0L G;  3UGH A;  1X0T A;  3WN0 A;  2NRG A;  1USE A;  3LW5 H;  3L75 J;  5FLW A;  2YXR B;  4BWN A;  5GLQ A;  3L70 G;  3KQG A;  1CSB A;  3CCR P;  2IBZ I;  2W6J H;  3KF5 A;  2HOD A;  1NU1 D;  1AFO A;  3O6Q A;  5AYD A;  3BRV B;  4FFI A;  1JO5 A;  2K37 A;  3OM6 A;  1Y9M A;  5AVW B;  1R5L A;  1P84 D;  5KJ7 C;  1NTK K;  1BSN A;  2P58 A;  1HBW A;  5APV A;  1M1J A;  2IZ1 A;  1QX8 A;  3L72 D;  1CI6 B;  3KZI E;  2OYI A;  1G2C B;  1PGP A;  1KIL A;  2M3B A;  3QWO C;  3M91 A;  2WPS A;  3L74 D;  1RE4 C;  1LTB C;  2Z5I A;  1LGH B;  5E79 H;  4PVI A;  3WMZ A;  1DIP A;  1FZF A;  3L73 E;  1QVG O;  1MV8 A;  1IFP A;  1N7S B;  1PPJ G;  2B9B A;  3LEM A;  5FKC A;  4D6T G;  3N7N A;  4COT A;  3VTP C;  2MJZ A;  2RN0 A;  1YTZ T;  4HKZ H;  2AC1 A;  2QA4 P;  2HG5 D;  5AVX B;  4NPF X;  5C2M A;  1YTZ I;  1AVY A;  4Y28 J;  1D7M A;  3L72 J;  2G8Y A;  3TK1 A;  1CW5 A;  1FJK A;  3ZXJ A;  2EXH A;  2N9Y B;  3O8Z A;  4JYB A;  3L74 J;  5M1B A;  2YKQ A;  2P67 A;  4DZO A;  2M8R A;  1RE3 C;  2KUB A;  1KFM A;  2M5A B;  2FXP A;  3SFD C;  2NPS B;  3IFM A;  1YI7 A;  1FDM A;  1GU5 A;  1NU1 G;  1AQ5 A;  1WMK A;  1EZV G;  3AKH A;  3NXS A;  4H44 B;  4R4M A;  1VQ6 P;  2HLO A;  4ONZ A;  4IL6 H;  2Q1K A;  1BCC E;  4PV1 D;  5AW2 B;  1Y8A A;  1NTZ K;  2X8F A;  1IFM A;  3RL0 D;  1BGY E;  2E76 B;  3H1K E;  3LIE A;  3LIG A;  2IBZ E;  2HPC B;  1M1K Q;  1Q86 Q;  1DD4 A;  2FYU D;  5TIS E;  3CMA P;  3L37 A;  3L71 J;  1T2K C;  3A7O A;  3OA7 A;  4GOD A;  3KHU A;  5B66 H;  3L74 G;  3C1L A;  5B6S A;  2Q3I A;  1MFZ A;  1IZN B;  1CZQ A;  1A02 J;  1HJB A;  2QQV A;  4U6D A;  1RF0 A;  2WWW A;  2NPS C;  1RF1 B;  5DJT B;  2R5D A;  1SVF A;  1URQ D;  1E79 H;  1YJN P;  5GLM A;  2X8S A;  1X79 B;  3GW6 A;  5AVT B;  1FZG A;  1SQQ E;  1GK4 A;  2L5G B;  4MLG A;  1GYD B;  2E74 D;  3H1J D;  3C9I A;  3HTK B;  3V2N A;  2FYU J;  2P10 A;  5A7V B;  2QRX A;  2E76 C;  2PFX A;  1PT2 A;  1QEX A;  2YKO A;  3GHG B;  1L0N E;  2W83 C;  4NOV A;  1FBM A;  1NTM E;  3F5H A;  1TL2 A;  3SC7 X;  4M3L A;  1S1C X;  1K9M Q;  2I1K A;  4PD4 H;  3H32 A;  2QEX P;  4UDJ A;  4FFG A;  1OVR A;  2OTK E;  1LT9 B;  1S9K D;  1RF1 C;  2O3J A;  1PV3 A;  2AEZ A;  4L73 A;  1LNQ A;  2A45 G;  3CX5 D;  4C7R A;  2WTY A;  2I8D A;  4JPZ B;  2D2C D;  3AKF A;  3WUT A;  1LTA C;  4AUW A;  1SQP G;  1HUC A;  4L76 A;  1H0T B;  3H1J J;  4UB6 H;  1PGO A;  2KYV A;  5KJ7 A;  5KAF H;  2WSC H;  4RO0 A;  3PIG A;  1VQ7 P;  4GOE A;  1JY3 O;  4ASW A;  2FYU G;  2H89 C;  3GHG C;  1L0L K;  2VRS A;  3B5N B;  3CCV P;  5FMD A;  1X22 A;  5KLV E;  2B88 A;  2YMK A;  1MZ9 A;  1M7L A;  3GMA A;  2O1J A;  4YTP C;  1IC2 A;  3AE1 C;  3CI9 A;  4AK7 A;  3RK2 D;  5AVU B;  3HUS B;  5CCH D;  4KC7 A;  1NOH A;  4HYT B;  1SQB E;  2BEQ D;  4W80 A;  2ZFC A;  2JDI H;  5JOX A;  1S5L X;  3HE4 B;  2ZT9 D;  3CWB E;  4HJG H;  1IJD B;  4ZKU A;  1DH3 A;  2KNC B;  4U3F D;  1XTC C;  2BCC E;  2JEE A;  2R3S A;  3H1J G;  3MIW A;  3SSU A;  2AEJ A;  3IF4 A;  2ZXE B;  4QMA A;  1S72 P;  2YFT A;  3EQ2 A;  1G2C A;  3B5N C;  4PD4 D;  1GDT A;  3CXH H;  3NQH A;  2W90 A;  5AW1 B;  1N73 A;  3MD0 A;  2Y0D A;  1T3J A;  2H7H A;  4ASV A;  1T8Z A;  5APY A;  1OMI A;  3H6P A;  2OTL P;  1NTK E;  2C0W A;  3HD7 C;  5APW A;  4ZMD A;  4UB8 E;  2PGD A;  5APX A;  3WMY A;  3U14 A;  2E75 D;  2YKP A;  5JOW A;  4AK6 A;  2K88 A;  4U3F J;  1LTS C;  1VF5 B;  1AVO A;  1MFT A;  3HE5 A;  3RK3 C;  2FYN B;  4FFH A;  3VMY A;  3N4X A;  2AEM A;  1H88 A;  3G9R A;  1X8Y A;  1FS0 E;  2K9J A;  5GLO A;  1YBK A;  3BYJ A;  3CCQ P;  3L73 D;  1KQS O;  1OIP A;  3GF3 A;  3H1H E;  3WUV A;  3AE9 C;  4EI2 A;  3E1R A;  3VP8 A;  2PAJ A;  2FBW C;  1ZRT E;  2WPR A;  1VL2 A;  2XV5 A;  2YO2 A;  3M9Q A;  1S5L H;  2CPS A;  2NPS A;  3WN2 A;  4YPC A;  1FU1 A;  3OW2 O;  4WY4 D;  3C7F A;  3W68 A;  1G1I A;  2PRR A;  1X9V A;  5AW4 B;  5C39 A;  1VF5 C;  3A0B H;  2P2U A;  2B87 A;  4U3F G;  3H1I E;  2M3E A;  1LWU A;  2P1J A;  3BCC D;  1VQO P;  3P32 A;  5AW3 B;  2Q7C A;  1UYP A;  1LTG C;  5A8D A;  3L73 J;  4YXD C;  2M0B A;  1N8R Q;  2HPC A;  3CD6 P;  1VQ4 P;  2Y0C A;  3CXH D;  2QQU A;  4I2L C;  3AEE C;  2XKM A;  2AXT E;  4C7N A;  1J1D C;  4IOI H;  3WPU A;  3H1L E;  3A0H H;  2BEZ F;  2KSE A;  4WVZ A;  1KIL D;  4N1I A;  1BCC D;  1WL7 A;  1Y9B A;  1BGY D;  3H1K D;  4B86 A;  3JCU E;  2IBZ D;  3BAT A;  1SS1 A;  3EFG A;  1OW8 A;  1M8O B;  1KB9 E;  4BRY B;  2JO1 A;  3Q5S A;  1BE3 E;  4YXW H;  1MKM A;  5KLI C;  1PFI A;  5AW8 B;  5JOZ A;  3RL0 B;  1KMI Z;  1SFC A;  3WU2 E;  5B6T A;  5GTI E;  2RH0 A;  3D5Y A;  5C0P A;  1AQT A;  4IFD K;  5A7V A;  2ZAE B;  1L4A D;  3Q3D A;  1MUU A;  3MZW B;  2KS1 A;  3II6 A;  3L4F A;  3VSZ A;  3GHG A;  4A7P A;  4DCK A;  1GYE B;  2W27 A;  2C9L Y;  2KSJ A;  1SQQ D;  4KT0 J;  3PRJ A;  1FZC B;  4U6B A;  2YXQ B;  1BCC J;  1ZME C;  1FAV A;  2WSE J;  1URQ B;  5FKB A;  3CCL P;  1HF9 A;  1BGY J;  3H1K J;  3MUD A; 
#chains in the Genus database with same CATH homology
 4R4M A;  3C2U A;  3QZ4 A;  4ONZ A;  3AE2 C;  5FIX A;  4PV1 D;  2X8F A;  4UDI A;  2WSF J;  2E74 B;  3WPY A;  1KOR A;  2E76 B;  3LIG A;  2MKV A;  1DD4 A;  2OQQ A;  1UV4 A;  5FK7 A;  3P2N A;  3QC2 A;  2FYN C;  1FDO A;  4EQV A;  4OGQ B;  1YRZ A;  3LIH A;  5B6S A;  2J5U A;  4O8N A;  4AK5 A;  3R4Z A;  1YIF A;  4RKU J;  2QQV A;  3AEF C;  3AEC C;  4U6D A;  5GLM A;  2X8S A;  4H44 D;  1W18 A;  5GLR A;  2V7Q J;  3LF7 A;  4MLG A;  1GYD B;  4H0L D;  3OM7 A;  3AE3 C;  5FMC A;  2D2C B;  4KCB A;  4N2R A;  2E74 D;  2E76 D;  3Q1M A;  3LDR A;  1HJ0 A;  4I7Z B;  2P10 A;  5A7V B;  2E76 C;  1PT2 A;  2QJP C;  3OM4 A;  3PIJ A;  3OM2 A;  3KST A;  4PV1 B;  3IAO A;  4Z1M H;  2QSI A;  1KQF B;  5FMB A;  3Q5R A;  4OGQ D;  3UGG A;  4TT3 H;  2VDT A;  4NOV A;  3RWK X;  3CU9 A;  3SC7 X;  4OGQ C;  3FGA D;  5GLP A;  1S1C X;  1YQ4 C;  2ADD A;  3ABV C;  3GLM A;  4UDJ A;  4FFG A;  4GDO A;  3WN1 A;  3H25 A;  2EXJ A;  1EXI A;  3AEB C;  1PV3 A;  2AEZ A;  2JP3 A;  2WQY C;  3D6Z A;  2D2C D;  3AKF A;  2OXB A;  2QQW A;  2ZT9 B;  2QJY C;  4R4L A;  5FK8 A;  3AED C;  2QJK C;  3PIG A;  4U7J A;  3BYK A;  1OW7 A;  3RL0 g;  1GMJ A;  2EXI A;  4O8P A;  4H0L B;  4D47 A;  3B71 A;  3D60 A;  4UDK E;  2H89 C;  3AEG C;  4PV1 C;  1KTM A;  5FMD A;  3WPV A;  1PIX A;  3QEE A;  1UIX A;  1IK7 A;  2YMK A;  3LFI A;  5AYE A;  3GMA A;  3KF3 A;  1Y7B A;  2YIU C;  1Y4W A;  4YTP C;  3AE1 C;  2WPV B;  4AK7 A;  4PVA A;  3WAS A;  3VT2 A;  4KC7 A;  1FDI A;  5L8R J;  2BEQ D;  3VSR A;  2WSC J;  1VF5 D;  3AEA C;  4UDK A;  4H13 B;  3BYN A;  5AYC A;  4KCA A;  3D70 A;  3VT0 A;  5JOX A;  1S5L X;  2ZT9 D;  4KC8 A;  1NYH A;  4IL6 X;  3AE4 C;  5GLL A;  1GYH A;  1U57 A;  3RK3 E;  3EWK A;  2AEY A;  2E75 B;  3R4Y A;  4H44 C;  2IDB A;  2YFS A;  2X8T A;  4H0L C;  5GLK A;  3C7G A;  3U75 A;  2E74 C;  5KKZ C;  4XFJ A;  3ZXK A;  1KQG B;  3ZXL A;  2NZ2 A;  2YFT A;  3WAT A;  2B4W A;  3NQH A;  3SFE C;  1NGM B;  1AJY A;  3WPZ A;  3T97 B;  1EXJ A;  3R67 A;  4KMI A;  1K04 A;  4H13 D;  1OMI A;  5A8C A;  3AE6 C;  3D61 A;  4O8O A;  4H13 C;  5ANN A;  3OM5 A;  3WMY A;  3U14 A;  1ST8 A;  4FFF A;  2YFR A;  1ZP0 C;  2E75 D;  3LDK A;  5JOW A;  1RQV A;  4AK6 A;  1VF5 B;  3IN6 A;  3LV4 A;  3D71 A;  4FFH A;  2D2C C;  3G9R A;  1VKD A;  3VSF A;  5GLN A;  3C7H A;  5GLO A;  3UGH A;  3BYJ A;  3WN0 A;  3AKI A;  4I7Z C;  5FLW A;  1OYG A;  5GLQ A;  1Q90 D;  2QIW A;  3GF3 A;  3Q2Y A;  3AE9 C;  5AY9 A;  1Y9G A;  3AE7 C;  3KF5 A;  2FBW C;  3AE5 C;  1ZRT E;  2O01 J;  1VL2 A;  3O6Q A;  5AYD A;  4FFI A;  1KIL E;  3OM6 A;  1Y9M A;  3C7E A;  1YQ3 C;  3WN2 A;  4N4B A;  1TU3 F;  3C7F A;  2K9Y A;  3LW5 J;  3AKG A;  3TAW A;  1VF5 C;  4UDG A;  1W2T A;  1DD3 A;  3C7O A;  2ZT9 C;  1ZOY C;  1RQU A;  1UYP A;  3S9O A;  5A8D A;  4YXD C;  2H88 C;  2QQU A;  3VT1 A;  3AEE C;  4PVI A;  3Q5P A;  3WMZ A;  3WPU A;  1DIP A;  3GF7 A;  3D6Y A;  1JB0 J;  1PL5 A;  2BEZ F;  3LEM A;  5FKC A;  4N1I A;  3UGF A;  4QQS A;  4COT A;  1WL7 A;  1Y9B A;  3AE8 C;  2EXK A;  2AC1 A;  3D5Z A;  1K05 A;  1OW8 A;  1R8E A;  2JO1 A;  4Y28 J;  3Q5S A;  1MKM A;  5KLI C;  3QED A;  5JOZ A;  2G8Y A;  3K1U A;  1KMI Z;  3ZXJ A;  5B6T A;  3VSS A;  2EXH A;  3C8V A;  1OW6 A;  2E75 C;  3D5Y A;  5C0P A;  2XQR A;  5M1B A;  5A7V A;  3Q3D A;  3WAU A;  3VSZ A;  3BYL A;  1GYE B;  5JOY A;  2FXP A;  3SFD C;  4KT0 J;  2G3A A;  1YI7 A;  4U6B A;  1ZME C;  1WMK A;  2WSE J;  5FKB A;  1HF9 A;  3QEF A;  3AKH A;  4N2Z A;  4H44 B;  2ADE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...