3R4YA

Crystal structure of alpha-neoagarobiose hydrolase (alpha-nabh) from saccharophagus degradans 2-40
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
362
structure length
360
Chain Sequence
KLSKASLRAIERGYDEKGPEWLFEFDITPLKGDLAYEEGVIRRDPSAVLKVDDEYHVWYTKGEGETVGFGSDNPEDKVFPWDKTEVWHATSKDKITWKEIGPAIQRGAAGAYDDRAVFTPEVLRHNGTYYLVYQTVKAPYLNRSLEHIAIAYSDSPFGPWTKSDAPILSPENDGVWDTDEDNRFLVKEKGSFDSHKVHDPCLMFFNNRFYLYYKGETMGESMNMGGREIKHGVAIADSPLGPYTKSEYNPITNSGHEVAVWPYKGGMATMLTTDGPEKNTCQWAEDGINFDIMSHIKGAPEAVGFFRPDSDDPISGIEWGLSHKYDASWNWNYLCFFKTRRQVLDAGSYQQTGDSGAVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a key enzyme in the agarolytic pathway, alpha-neoagarobiose hydrolase from Saccharophagus degradans 2-40
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 32, N terminal
total genus 85
structure length 360
sequence length 362
chains with identical sequence B
ec nomenclature ec 3.2.1.-:
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.640 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3r4yA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3r4yA02
1VKDA 2EXIA 3C7EA 2B4WA 5FKBA 3KSTA 3WMYA 4ONZA 4D47A 5FMBA 1Y7BA 3WN2A 3UGHA 2QQWA 5GLRA 3OM2A 4N4BA 5GLKA 3AKIA 3C7GA 4AK7A 2YFRA 4UDGA 4N2ZA 3ZXLA 3QEFA 5ANNA 2EXHA 3QC2A 5A7VB 4PVAA 3WPVA 4MLGA 3VSSA 3WPZA 3TAWA 4AK5A 3WATA 1ST8A 5A8DA 5GLNA 1OYGA 2QQVA 5A8CA 3VSFA 3SC7X 3D5ZA 2YFSA 4UDJA 3C7OA 5GLLA 1YRZA 3PIJA 5JOYA 4KC8A 3LEMA 2X8SA 4UDKA 3LV4A 3ZXJA 3BYKA 3VT1A 2ADDA 3ZXKA 3WN0A 3R4ZA 1W18A 3LIGA 5GLMA 2AEZA 4EQVA 5C0PA 3VT2A 3WMZA 5GLOA 3AKFA 4PVIA 5AY9A 5AYCA 3U75A 2ADEA 3LDKA 4COTA 4KMIA 3KF5A 3R4YA 3LIHA 3AKHA 4O8PA 5FMDA 3D61A 3LFIA 3C7FA 5B6SA 1YI7A 3C2UA 5AYEA 1Y9GA 3R67A 1WL7A 2AC1A 4KC7A 2OXBA 2QQUA 4QQSA 3C7HA 3D5YA 1Y9MA 4N1IA 4NOVA 5GLQA 3OM5A 3CU9A 2YFTA 3QEEA 3UGGA 3RWKX 1YIFA 1UYPA 4N2RA 3AKGA 3OM6A 5FIXA 5FK7A 5FK8A 4FFIA 3OM4A 4KCAA 5FKCA 1W2TA 3LF7A 4U6DA 3WPUA 5B6TA 3PIGA 4O8NA 3P2NA 5JOZA 3WAUA 3VSZA 5FLWA 4UDKE 3LDRA 5JOWA 3VSRA 3BYNA 3K1UA 4O8OA 3UGFA 1MKMA 5A7VA 1GYEB 3D60A 3WASA 3QEDA 1PT2A 3BYJA 4UDIA 3WN1A 1Y4WA 4KCBA 5GLPA 3OM7A 5FMCA 1GYDB 5JOXA 4U6BA 4FFFA 2EXKA 2VDTA 2AEYA 4FFHA 3BYLA 3NQHA 2X8FA 1GYHA 2EXJA 4FFGA 3U14A 2XQRA 3QZ4A 5AYDA 4AK6A 1UV4A 2X8TA 3KF3A 3VT0A 3WPYA
chains in the Genus database with same CATH superfamily
1NTMJ 2XZRA 1S5LH 1LWUB 1SQPK 1GL2D 2QQWA 2WPQA 2Q1KA 3ITKA 4K35A 3PTZA 3BVHA 5KLVK 3NMDA 3L75J 3PHLA 2Z4EA 3D5ZA 3KXDA 4UDJA 1YRZA 2N1TD 3V4QA 2R3CA 1N7SA 3L73G 4Z1MH 4HH2A 1L0LK 2IDBA 2V7QJ 3AKFA 3M0AA 5KJ7D 1KB9I 4UB8H 3AE8C 2LXCB 4KMIA 4LLHA 3TGUG 3CCSP 2QM7A 3LFIA 4C46A 3SWFA 2AXCA 3HD7C 3BASA 1RF1B 2QQUA 2Q3IA 5FIXA 3E7KA 3OAKA 4JPZB 2C0WA 2Y9YA 1SP4A 1CI6A 5B5EE 1N86A 1GYDB 2EXKA 1BE3E 4N3YB 3BYLA 3M0DC 1VQ5P 5AW0B 1QLED 4DZOA 4A7PA 1JUNA 3H1HG 5C2MA 5GLRA 4N4BA 3H1HE 3AEEC 5B5EH 3M91A 4U3FG 4AK7A 2B89A 3M9QA 2PP6A 1JY2P 1ZR2A 1SQVJ 1R8EA 4Y99B 2ZFCA 3PLNA 4I7ZB 3H32A 4ZMDA 4GT1A 4BRYA 4KC8A 1JMMA 2E76B 3LV4A 1H8AA 4HJGH 5C0PA 3KZIH 1JCCA 1SFCA 3KYQA 3D6YA 3HE5B 3V2PA 1S1CX 3Q5PA 3U75A 3FWLA 3LDKA 3L74G 1L2PA 4L75A 3L72J 5CCGC 1AQ5A 4PV1C 1NTKD 1ZLLA 5B6SA 1ZR4A 1HGZA 1FJKA 4I2LC 2YMKA 2YFTA 3VMZA 2P7JA 2Z5IA 1Y8AA 3WUVA 2D2CD 1KILB 5FKCA 4O8NA 4PV1D 1J1DC 1SQXK 5JOWA 1AFOA 1J2JB 1VQ4P 3R2PA 4O8OA 3JCUE 3D60A 3IAOA 3M9HA 1Y4WA 3T97B 4JF7A 1BGYE 2IFMA 1QGKB 5CCGA 4I6MC 1QVGO 3AE6C 5TJHA 1MV8A 2YXQB 2KIKA 3TK1A 3PRJA 5KJ7A 2XQRA 4R4MA 3FWNA 1DEBA 3WPYA 1YBKA 1PP9E 3MIWA 1AJYA 3BRVB 1EZVI 2NPSB 4QMAA 2GM4A 5ANNA 3AEAC 3RK3E 3QC2A 3H1LD 4H44C 2YKQA 1S9KE 3TNUA 3H6PA 2K1AA 3C7OA 4W7ZA 1JEKA 3VP9A 3KZIE 2ZT9B 1OVRA 2E75B 2XU6A 3RGUA 1NGMB 1VQ9P 2KP8A 3LW5H 2A06G 2AXTH 2R5DA 5GLOA 5CCHA 3H1KJ 4H13D 3TF5A 3R4YA 5BU8B 3GG2A 2WPSA 3R67A 3CLQA 3MP7B 4D6TG 2OXBA 1AQTA 2YKPA 2PFXA 1IFMA 1EZVG 1H0TA 3CCQP 3AKGA 3OM6A 1EZVE 5FK8A 3AECC 3V2NA 3BCCE 1VQ7P 1FZEA 4H13B 2W90A 1OX3A 1LT9B 3WN1A 3HTKA 2OGUA 2E42A 1GL2B 3RL0B 4YPCA 4OGQD 1VQKP 3JSVC 3V2RA 3B5NB 3G3ZA 1YQ3C 5CHXA 3RBZA 3TGUE 2ZVOB 1SQVD 4Y28J 2B4WA 3KSTA 1SQPJ 4D47A 2KB7P 1RE3C 1JY2O 2WT7B 1KB9E 1BGYG 1L0LG 1DX7A 1ZXGA 3M9BA 1ST8A 2BEQD 2YFSA 2OYHA 1S9KD 1QVFO 1NHLA 1QL1A 3FXDA 4JBZA 3PJSK 3RK2C 1NTKJ 1NTMD 2HLOA 5KLVG 3OJAB 1PPJE 2C9LY 3OW2O 1PPJG 3CX5H 1DEEG 3B5NA 2HPCB 2QSIA 1PGJA 2M0BA 3GHGB 1KMIZ 1FJPA 1ZRTE 3USSA 1RQVA 2B87B 2ZVNB 1NWQA 1KFMA 1W2BO 1GK6A 1EDIA 3BCCD 2HYNA 1EXJA 3D71A 2LXBA 1KTMA 1HH0A 2K9JB 5CJ0A 1PGQA 3UIAA 4DCKA 1EQ7A 3C8VA 5AYDA 1UV4A 1KN7A 1OIPA 2X8TA 2FYZA 1KV4A 1E5WA 1LTIC 1HGVA 3AE1C 1GMJA 1IFNA 1N73B 5APYA 3F5HA 1SQQG 1ZN5A 2QJYB 3CWBG 3L70D 2OYIB 1NAFA 4KHXA 1CSBA 1KZUB 1U7JA 2E5TA 1M8OB 3TNUB 5AW6B 4D6TE 3U1AA 3OA7A 2VRSA 1KQGB 1QEXA 4UDKA 2B9BA 2W83C 1NU1G 5DJTB 1P84H 2KS1B 3L73E 3GF3A 2WPRA 2IZ1A 3Q2YA 1IFPA 4GOEA 4AUWA 1FAVA 4O8PA 3AEBC 2Y0DA 4KT0J 1NTMG 2AEJA 1IFDA 1WL7A 1IFIA 3SWYA 2KYVA 4QQSA 4NOVA 4XFJA 1S2EA 3RWKX 1IK9A 1K04A 3AE3C 2WTYA 2R44A 1K05A 2AEFA 1N7SC 5TISE 3WAUA 2QM8A 1LJ2A 1SQPD 1OW7A 3RK2D 3ABVC 2RN0A 4UB8E 1URQD 1R5LA 1JY3O 2QE7H 3S1KA 3MUDC 3H1ID 2QJKC 1LT9C 2KOGA 1URQA 3LIEA 5CCHC 1L0NK 2D2CC 2GA1A 1GU5A 2G8YA 4L74A 3TGUJ 2MKVA 1SFCB 5FKBA 2FKWB 2A06D 1EXIA 2Q9IA 2WMMA 1URQB 3RL0g 1K8AQ 3H32B 3L70E 5AVZB 1FC2C 1PP9J 4D6TD 2X8SA 2LR2A 2FBWC 2FY8A 3R4ZA 4EQVA 2MJZA 2HFED 2W6JH 1IZNB 5B66E 2WSFJ 2IYOA 3FX0A 3II6A 3CCJP 3BCCJ 1YI2P 1OWAA 1T2KC 1A02F 4IFFA 1EDLA 3VMYA 1G1JA 3H1HJ 2FYUE 3LIDA 3WU2E 2YIUC 1CI6B 4GKGA 1BE3G 1X79B 1XTCC 4U3FJ 3GHGC 1M90Q 1Q7YQ 3AE4C 1SQVG 3GW6A 1ZMEC 1M1JC 2KS1A 1DIPA 3P32A 3H1KD 3F89A 1MKMA 1LTJB 4JQ0D 2Q3EA 1SQPE 5L8RJ 1JCDA 3JC22 2ZYAA 1NTZG 4XE5B 2OYIA 1LNQA 4TT3H 4EIJA 1N73A 3H1IJ 2CPSA 4UB6E 1GTWA 5CJ4A 3L4FA 1LTTC 2A06E 5AW2B 1LWUC 3H1JG 1Q86Q 3WUTA 2ZXXA 3HD7D 2K9JA 3CX5E 1NKNA 4R4LA 3L71E 3C9IA 4JYBA 5H2FH 5AVRB 2A45H 3A2AA 5AVQB 2WPVB 4WBAA 4JYCA 3VT1A 3H1LJ 1JNMA 2B87A 1KFNA 2KXPB 4HKZH 2XNXA 4YTPC 3M0DA 4DT0A 1N7LA 4PD4E 2OTKE 3GHGA 1RE4C 1BGYD 3D61A 1RY3A 2P1JA 2WSSH 2HPCA 1HWTC 1YJNP 4KC7A 5KAFH 1HBWA 5GTIE 3C7HA 3D5YA 3OM5A 3QEEA 4M3LA 1RF1C 5KLIB 1T3JA 3CC2P 2W6BA 1L0NG 3CC7P 1L0NE 1BCCJ 2P67A 5FLWA 1PGOA 3BYNA 1FZGA 2QJYC 3L70J 1FOSE 1SQXG 1ZP0C 4UDIA 3S9OA 1IJDB 2Y9ZA 1R5SA 3W67A 3CCMP 3RK3D 2YKOA 1YYCA 2WT7A 1WRGA 1DH3A 2E76C 1UIIA 2EXIA 1FBMA 2QVAA 1KYOH 3C1LA 1GD2E 3D6ZA 2Q6QA 2IYPA 1NTKK 2OARA 1OW6A 5A7VB 3HUSB 3TAWA 4AQRD 1QX8A 1YTZI 1SVFA 2QQVA 5KAIH 3A7OA 5JOYA 1K9MQ 1IO4A 4IOIH 3H1HD 1OZHA 2ADDA 3QH9A 1VF5B 3LIGA 4YXDC 3QWOC 3VT2A 3H1IE 1RQUA 1H0TB 5AY9A 3IFMA 3AKHA 4IL6X 1G2CB 4PD4D 2WQYC 3SWKA 2AC1A 4RESB 5AVTB 3SSUA 1L4AC 3BATA 2P2UA 1YJ9P 3L72E 3L75G 1KYOE 2NZ2A 2R32A 1T2KD 4GIFA 1SLQA 2M3EA 3VMAA 2E76D 2UWJE 5A7VA 3JCUH 1VQLP 1ZOYC 1KQFB 4RO0A 3OM7A 1KB9D 3VTPC 2KLVA 1LTBC 4BWNA 2N9YB 1LTGC 4H44D 1SQXD 1BSNA 1UIXA 2QA4P 1XTGB 2ZJSE 3WMYA 1AVYA 4ONZA 1Y7BA 1RH5B 2KUBA 3B5ND 4N2ZA 2FYUD 1KILD 1KORA 2KLUA 4GOFA 4PV1B 3CL3D 3SC7X 4H44B 2P10A 3PIJA 1M56D 1L0LE 1LP1B 1VF5C 4IFDK 3G71P 5H2FE 3H1LE 3NXSA 2ZT9C 3O8ZA 2QIWA 2O01N 3HRNA 4L73A 4DOJA 3L37A 2ADEA 3RBXA 5FMDA 3HTKB 1DD3A 1FOSF 1NO4A 3GF7A 3VMXA 3HE5A 1YTZT 5BVZA 5B6TA 1NTZK 1FDMA 3NFQA 1Z56A 3CX5D 4BRYB 2NPSC 1S5LX 3SFEC 3CXHD 3CCUP 1FZFA 3L73J 1NU1J 5GLPA 5APWA 1EZVD 1LTJC 3TDKA 1PL5A 2N1TA 1ZW0A 3H25A 3M06A 3AE5C 3U14A 1BSHA 3RL0C 2WSFH 2FYNC 2IZ0A 2KZIA 1USEA 3MD0A 1WT6A 5APUA 2LKMA 3P7KA 3CMEP 4NPFX 4C7NB 3I56P 2AXTE 2HODA 2HG5D 2PGDA 3ZXLA 3TGUD 1NU1D 1LTJA 3MUDA 1SQQE 2QEXP 1SQVE 3GLMA 2NPSA 3P8CD 1BCCE 2Y0EA 1SQQK 3LEMA 4EDFA 3VOPA 1S3JA 5KLIC 2JEEA 4TLFA 2BCCG 3AEFC 1W18A 2XNDH 1JY3N 3RK2B 1EDJA 2FYUJ 3E1RA 3FXEA 3KQGA 1M1JB 4COTA 2HR3A 1M1KQ 1FZCC 3G4SP 3MTUE 5AVXB 4H0LD 3CMAP 1HJBA 2IBZG 5CMZA 1KILA 4I1LA 2KI7B 1SQBJ 1VQMP 1SQVK 3EWKA 5CCGD 2E74D 2IBZE 3L71G 2FFDA 5CCHD 5AVUB 1PT2A 1OW8A 5JOXA 2WSCH 2R5BA 4U6BA 1YJWP 2IBZI 4O9BA 2O3JA 2FYNB 4AK6A 4UB6H 1VQ8P 3L74J 3VT0A 5AW1B 2E74B 2P58A 4HYTB 5FMBA 5GTHH 2OTLP 2G3AA 3QEFA 4L76A 1SS1A 1MFZA 3L74D 4PVAA 3WPVA 1X9VA 3O6QA 3EFFK 1W5CE 3HD7B 3I5CA 1PZQA 2FXPA 3L72D 3V5BA 3GMAA 2YMYA 2I1KA 1OXZA 1L4AB 3U1CA 4WY4D 4AYCA 1OMIA 3IF4A 2WSCJ 1DD4A 2FXMA 1NTZJ 2K88A 1IC2A 3H1KE 4DJGA 1BDDA 2M5AA 1S4XA 1G1IA 1SQBE 3NTNA 4EI2A 3KF5A 1VDFA 3VN0A 1SQPG 3L73D 1Y9GA 1GK4A 3V4WA 3Q5SA 3EFGA 1LTSC 1NTZD 1YIFA 3G6EP 1UYPA 3CXHI 3H1JJ 1PV3A 1VQNP 4PJ0H 1GW3A 1BGYJ 3OM4A 3WPUA 2OTJP 1AVOA 3P2NA 2W27A 3EQ2A 1NOHA 3A5TA 2OYHC 3VSRA 1CW5A 1JO5A 1GYEB 2I1JA 3QEDA 1NH4A 1GDTA 3H1LG 5FMCA 3CCVP 1AA0A 1FDIA 3NQHA 5AVYB 3H1KG 3L71D 1RHZB 2NRGA 5EFWB 3H1JD 2E74C 1SQBK 1E79H 2A45I 4WB4A 1Q82Q 1VQPP 3MHVA 2ZXEB 3Q1MA 1P84D 4D6TJ 2RMZA 2J59M 4WWIA 2B88A 4WY4A 3OM2A 5GLKA 2Q7CA 3A0HH 3S4RA 2ZYDA 4H0LC 1KD1Q 4N6JA 1YHQP 4ZNCA 5CBOA 3VSSA 2Y0CA 4LGDE 1JTHB 1OYGA 2XKMA 3WUUA 1H88A 1K73Q 3VSFA 2Q5UA 3CWBD 3L70G 1SQXJ 1TU3F 3ZXJA 1M1JA 1NTKE 2H7HA 4RKUJ 5AW7B 4EYYQ 3A0HE 4PVIA 2IPPA 1M57D 5CBNA 3A0BH 3IR9A 4C7RA 4KJMA 3CX5I 3C2UA 1SQBD 3KHUA 5AYEA 1LGHB 1KQLA 2IFNA 2BCCE 3CWBJ 3TYYA 3CCRP 1J1DB 1FZAA 3Q3DA 1L0LJ 1HUCA 2QJPC 4FFIA 2OYHB 5APSA 4CPGA 2RH0A 1FZCA 3WMM0 3K1UA 1FDOA 3MGNA 3N7NA 2PRRA 5APTA 3B4SA 1GU4A 1KC8Q 2WSEH 4U3FE 4K3AA 1NU1K 5KLVJ 2QG4A 3CD6P 1N7SD 1NKZB 3L75D 1GYHA 4IL6E 1RF0C 3I55P 3H1JE 5AW8B 1FZBA 5BU5A 5E79H 3UGHA 3KDPB 3CXHH 4OVNF 5GTHE 1GL2A 5AW4B 1NYHA 4UDGA 3CPWO 1LT9A 1Q90D 2JJLA 2EXHA 1VQ6P 4MLGA 1Y47A 2KK7A 1D7MA 4AK5A 3HE4B 3O6QB 1Y9BA 3W68A 2N9BA 2YO2A 4WY4C 1HJ0A 5APQA 3V2QA 3TSIA 4BXLA 1IFJA 2IBZD 2KSJA 4EOTA 1LT1A 2WSEJ 5C39A 3ZXKA 1IK7A 3RK3C 1KYOD 2RKLA 1YIJP 2GUVA 3VYIA 4WVZA 3LIHA 1PFIA 2OQQA 1J1EC 3CCLP 2KNCA 1NAYA 1SQQJ 1Y9MA 5GLQA 3AEDC 5GTIH 3B5NC 2W8ZA 4N2RA 2BASA 2FFDB 2CK3H 2K37A 2BCCD 4KCAA 3FGAD 3VSZA 3L74E 1PP9G 1OVUA 3B71A 1Q2NA 1KILE 3P8MC 5AVWB 1N8RQ 1L0ND 1EC5A 4U3FD 2O01H 3MZWB 1S72P 2C0XA 1S5LE 3KF3A 3L72G 3L75E 1KYOI 1VL2A 1U7MA 3AE7C 2O1JA 3U59A 2IX7C 1L4AD 2WZ7A 3L36A 5K5GB 2E75D 3AKIA 3T97A 2ZAEB 1GL2C 1PIXA 1GZLA 5KLVD 1NTME 5M1BA 3WPZA 1Q81Q 1NTZE 1GW4A 1NJIQ 5KAFE 1OVVA 1PPJD 4ASVA 2YNYA 2YXRB 1RF0A 2HODB 4N78E 3RK3B 5KTBA 4XA4A 4C7NA 1X22A 1JB0J 3WMZA 1T8ZA 2BEZF 2JO1A 1VQOP 2O01J 2KSEA 1ZRTD 5AVSB 2OYIC 2L91A 3SFDC 4NPEA 5APVA 2H43A 3H1IG 5AW5B 3C7FA 2N1TB 2JWAA 3AE9C 1TL2A 3WU2H 5AW9B 4U7JA 1P84E 4HB1A 3K5BA 1AV1A 2O1KA 5FK7A 3RL0D 3Q5RA 3PIGA 2QJPB 2Z5HA 1N2DC 2PAJA 3PH0A 3UGFA 1JM0A 2J5UA 3BYJA 1YQ4C 3HE4A 1A02J 1U57A 2BCCJ 1NU1E 3CWBE 4ASWA 3HUSC 1RE4A 2WVRA 1RE3A 1MZ9A 2KZJA 2WWWA 3D70A 2JDIH 2J58A 2FYUG 2X8FA 2JP3A 4W80A 1OFCX 5DJUB 2M3BA 3BCCG 1H89A 2K9YA 1VKDA 4OWFA 3WN2A 2WITA 2I8DA 3N4XA 1BE3J 1P84I 1LP1A 4W7YA 1X0TA 5KKZB 2E5YA 3V6IA 1SQXE 1L0NJ 5KJ7C 2YO3A 2XV5A 1KQSO 3WATA 1SQBG 4H0LB 5GLNA 5A8CA 3CI9A 4IFMA 1JY3P 2DW3A 1HTLC 1CZQA 3L71J 2H8PD 2ZT9D 3CCEP 2A45G 4PD4I 4OGQB 1QL2A 3BYKA 1USDA 3WN0A 1N73C 2ITAA 5GLMA 1RF1A 4N78D 2POHA 1URQC 2GUSA 1YITP 1VF5D 5AYCA 1L0LD 2N1TC 4MN4C 3BRTB 2W6AA 1NTMK 4Y99C 3B8EB 2H89C 1YI7A 2QJKB 1SFCD 4NPDA 1KILC 3CU9A 3UGGA 1N7SB 1HF9A 1JOCA 5TISH 1KB9H 1MFTA 1W2TA 4U6DA 1SFCC 5JOZA 3LDRA 3VP8A 3WASA 2KNCB 2C9NY 4KCBA 2JKVA 1FU1A 3ZDMA 1JTHA 2OYOA 2M8RA 1NTKG 3LW5J 1PGPA 2AEMA 1LWUA 1G2CA 2D2CB 2SPZA 3CC4P 4PJ0E 2EXJA 2CPBA 2L5GB 4WY4B 1JMBA 1VPCA 3CXHE 4GODA 3C7EA 1FE6A 4B86A 1HVVA 5KKZC 2FXOA 3C7GA 1MUUA 2YFRA 1T6AA 2QRXA 4I7ZC 5A8DA 4LC1A 1BCCG 4OGQC 4IL6H 3HUSA 1X8YA 5KAIE 5GLLA 2YIUB 5APXA 4YXWH 1T3UA 1M7LA 2FFDC 2NPSD 1W2EA 1SQQD 2AEZA 1ZV8A 3P8CE 5E79E 1BCCD 2E43A 1PP9D 2ZYGA 1LTAC 5AVVB 1WMKA 3AE2C 4RJTA 3IN6A 4GDOA 1FZCB 2M5AB 1J1EB 2JWDA 4N1IA 1NVOA 2E75C 3PP5A 2XDJA 4H13C 3E1IA 3LF7A 1JY2N 1L4AA 2H88C 5AW3B 5KLVE 1FS0E 4PD4H 2JR8A 4UDKE 3G9RA 3A3YB 2V4HA 3L35A 3HD7A 2K3RA 1BE3D 2V7QH 4FFFA 3KPEA 2FYUK 3AEGC 2R3SA 2VDTA 2AEYA 4FFHA 5B66H 4OH8B 4FFGA 3QZ4A 4ZKPA 3A0BE 1BDCA 4ZKUA 1EDKA
chains in the Genus database with same CATH topology
3AE1C 1GMJA 3WMYA 4ONZA 1Y7BA 3UGHA 2QQWA 1NYHA 4UDGA 4N2ZA 1Q90D 1KORA 2EXHA 4MLGA 4AK5A 4PV1B 1Y9BA 3SC7X 3D5ZA 4H44B 2P10A 4UDJA 1YRZA 3PIJA 1HJ0A 1KQGB 4UDKA 1VF5C 4Z1MH 2WSEJ 3ZXKA 1IK7A 2ZT9C 2IDBA 2QIWA 2V7QJ 3GF3A 3AKFA 3Q2YA 2ADEA 3AE8C 4KMIA 3LIHA 4O8PA 3AEBC 4KT0J 5FMDA 2OQQA 3LFIA 1DD3A 1WL7A 3GF7A 2QQUA 4QQSA 1Y9MA 4NOVA 5GLQA 3AEDC 4XFJA 3RWKX 4N2RA 1K04A 5FIXA 3AE3C 4KCAA 5B6TA 3FGAD 1K05A 3WAUA 3VSZA 1OW7A 1S5LX 3ABVC 3SFEC 3B71A 1KILE 5GLPA 2QJKC 1GYDB 1PL5A 2EXKA 3BYLA 3H25A 3AE5C 3U14A 2FYNC 2D2CC 2G8YA 3KF3A 2MKVA 5FKBA 1VL2A 3AE7C 1EXIA 5GLRA 4N4BA 3AEEC 2E75D 3AKIA 4AK7A 3RL0g 3ZXLA 1PIXA 5M1BA 1R8EA 3WPZA 3GLMA 4I7ZB 4KC8A 2E76B 3LEMA 2X8SA 3LV4A 5KLIC 2FBWC 3AEFC 3R4ZA 1W18A 1JB0J 4EQVA 5C0PA 3WMZA 2BEZF 2JO1A 2O01J 3D6YA 1S1CX 3Q5PA 3U75A 2WSFJ 3LDKA 3SFDC 4COTA 4PV1C 3C7FA 5B6SA 3AE9C 2YIUC 4H0LD 2YMKA 2YFTA 4U7JA 2D2CD 3AE4C 5FK7A 1ZMEC 3Q5RA 5FKCA 1DIPA 3PIGA 4O8NA 3EWKA 4PV1D 5JOWA 2E74D 4O8OA 3UGFA 1MKMA 3D60A 2J5UA 3IAOA 1PT2A 3BYJA 1Y4WA 3T97B 1YQ4C 5L8RJ 1OW8A 1U57A 5JOXA 4U6BA 3AE6C 3D70A 2X8FA 4AK6A 2XQRA 2JP3A 4TT3H 4R4MA 3VT0A 3WPYA 2K9YA 1VKDA 2E74B 1AJYA 5FMBA 3WN2A 2G3AA 3QEFA 5ANNA 3AEAC 3RK3E 3QC2A 4PVAA 3WPVA 4H44C 3O6QA 3WATA 5GLNA 4H0LB 4R4LA 5A8CA 2FXPA 3C7OA 2ZT9D 4OGQB 2ZT9B 3GMAA 2WPVB 2E75B 3BYKA 1NGMB 3VT1A 3WN0A 1OMIA 2WSCJ 5GLMA 1DD4A 5GLOA 4YTPC 1VF5D 5AYCA 4H13D 3KF5A 3R4YA 3D61A 2H89C 1YI7A 1Y9GA 3R67A 4KC7A 2OXBA 3C7HA 3Q5SA 3D5YA 3OM5A 3CU9A 3QEEA 3UGGA 1YIFA 1UYPA 1PV3A 3AKGA 3OM6A 5FK8A 3AECC 1HF9A 3OM4A 1W2TA 4U6DA 3WPUA 5JOZA 3P2NA 5FLWA 4H13B 3LDRA 3VSRA 3BYNA 2QJYC 1GYEB 3WASA 3QEDA 1ZP0C 3WN1A 4UDIA 4KCBA 3S9OA 5FMCA 3LW5J 1FDIA 4OGQD 2D2CB 3NQHA 2EXJA 1YQ3C 2E76C 2E74C 2EXIA 3C7EA 4Y28J 2B4WA 3KSTA 3Q1MA 4D47A 5KKZC 3D6ZA 3OM2A 5GLKA 3C7GA 2YFRA 4H0LC 1OW6A 5A7VB 3VSSA 3TAWA 4I7ZC 1ST8A 2BEQD 5A8DA 1OYGA 2QQVA 4OGQC 3VSFA 2YFSA 5GLLA 5JOYA 1TU3F 3ZXJA 4RKUJ 2ADDA 1VF5B 3LIGA 4YXDC 2AEZA 3VT2A 4PVIA 1RQUA 5AY9A 3AKHA 4IL6X 1WMKA 2QSIA 3AE2C 3C2UA 2WQYC 5AYEA 3IN6A 4GDOA 2AC1A 1KMIZ 4N1IA 1ZRTE 2E75C 1RQVA 4H13C 3Q3DA 2QJPC 4FFIA 3LF7A 2H88C 2NZ2A 4UDKE 2E76D 3G9RA 3K1UA 1FDOA 5A7VA 1EXJA 3D71A 1ZOYC 1KQFB 1KTMA 3OM7A 4FFFA 3AEGC 2VDTA 2AEYA 4FFHA 1GYHA 3C8VA 4FFGA 3QZ4A 5AYDA 4H44D 1UV4A 2X8TA 1UIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKD A;  2EXI A;  3C7E A;  2B4W A;  5FKB A;  3KST A;  3WMY A;  4ONZ A;  4D47 A;  5FMB A;  1Y7B A;  3WN2 A;  3UGH A;  2QQW A;  5GLR A;  3OM2 A;  4N4B A;  5GLK A;  3AKI A;  3C7G A;  4AK7 A;  2YFR A;  4UDG A;  4N2Z A;  3ZXL A;  3QEF A;  5ANN A;  2EXH A;  3QC2 A;  5A7V B;  4PVA A;  3WPV A;  4MLG A;  3VSS A;  3WPZ A;  3TAW A;  4AK5 A;  3WAT A;  1ST8 A;  5A8D A;  5GLN A;  1OYG A;  2QQV A;  5A8C A;  3VSF A;  3SC7 X;  3D5Z A;  2YFS A;  4UDJ A;  3C7O A;  5GLL A;  1YRZ A;  3PIJ A;  5JOY A;  4KC8 A;  3LEM A;  2X8S A;  4UDK A;  3LV4 A;  3ZXJ A;  3BYK A;  3VT1 A;  2ADD A;  3ZXK A;  3WN0 A;  3R4Z A;  1W18 A;  3LIG A;  5GLM A;  2AEZ A;  4EQV A;  5C0P A;  3VT2 A;  3WMZ A;  5GLO A;  3AKF A;  4PVI A;  5AY9 A;  5AYC A;  3U75 A;  2ADE A;  3LDK A;  4COT A;  4KMI A;  3KF5 A;  3R4Y A;  3LIH A;  3AKH A;  4O8P A;  5FMD A;  3D61 A;  3LFI A;  3C7F A;  5B6S A;  1YI7 A;  3C2U A;  5AYE A;  1Y9G A;  3R67 A;  1WL7 A;  2AC1 A;  4KC7 A;  2OXB A;  2QQU A;  4QQS A;  3C7H A;  3D5Y A;  1Y9M A;  4N1I A;  4NOV A;  5GLQ A;  3OM5 A;  3CU9 A;  2YFT A;  3QEE A;  3UGG A;  3RWK X;  1YIF A;  1UYP A;  4N2R A;  3AKG A;  3OM6 A;  5FIX A;  5FK7 A;  5FK8 A;  4FFI A;  3OM4 A;  4KCA A;  5FKC A;  1W2T A;  3LF7 A;  4U6D A;  3WPU A;  5B6T A;  3PIG A;  4O8N A;  3P2N A;  5JOZ A;  3WAU A;  3VSZ A;  5FLW A;  4UDK E;  3LDR A;  5JOW A;  3VSR A;  3BYN A;  3K1U A;  4O8O A;  3UGF A;  1MKM A;  5A7V A;  1GYE B;  3D60 A;  3WAS A;  3QED A;  1PT2 A;  3BYJ A;  4UDI A;  3WN1 A;  1Y4W A;  4KCB A;  5GLP A;  3OM7 A;  5FMC A;  1GYD B;  5JOX A;  4U6B A;  4FFF A;  2EXK A;  2VDT A;  2AEY A;  4FFH A;  3BYL A;  3NQH A;  2X8F A;  1GYH A;  2EXJ A;  4FFG A;  3U14 A;  2XQR A;  3QZ4 A;  5AYD A;  4AK6 A;  1UV4 A;  2X8T A;  3KF3 A;  3VT0 A;  3WPY A; 
#chains in the Genus database with same CATH topology
 1NTM J;  2XZR A;  1S5L H;  1LWU B;  1SQP K;  1GL2 D;  2QQW A;  2WPQ A;  2Q1K A;  3ITK A;  4K35 A;  3PTZ A;  3BVH A;  5KLV K;  3NMD A;  3L75 J;  3PHL A;  2Z4E A;  3D5Z A;  3KXD A;  4UDJ A;  1YRZ A;  2N1T D;  3V4Q A;  2R3C A;  1N7S A;  3L73 G;  4Z1M H;  4HH2 A;  1L0L K;  2IDB A;  2V7Q J;  3AKF A;  3M0A A;  5KJ7 D;  1KB9 I;  4UB8 H;  3AE8 C;  2LXC B;  4KMI A;  4LLH A;  3TGU G;  3CCS P;  2QM7 A;  3LFI A;  4C46 A;  3SWF A;  2AXC A;  3HD7 C;  3BAS A;  1RF1 B;  2QQU A;  2Q3I A;  5FIX A;  3E7K A;  3OAK A;  4JPZ B;  2C0W A;  2Y9Y A;  1SP4 A;  1CI6 A;  5B5E E;  1N86 A;  1GYD B;  2EXK A;  1BE3 E;  4N3Y B;  3BYL A;  3M0D C;  1VQ5 P;  5AW0 B;  1QLE D;  4DZO A;  4A7P A;  1JUN A;  3H1H G;  5C2M A;  5GLR A;  4N4B A;  3H1H E;  3AEE C;  5B5E H;  3M91 A;  4U3F G;  4AK7 A;  2B89 A;  3M9Q A;  2PP6 A;  1JY2 P;  1ZR2 A;  1SQV J;  1R8E A;  4Y99 B;  2ZFC A;  3PLN A;  4I7Z B;  3H32 A;  4ZMD A;  4GT1 A;  4BRY A;  4KC8 A;  1JMM A;  2E76 B;  3LV4 A;  1H8A A;  4HJG H;  5C0P A;  3KZI H;  1JCC A;  1SFC A;  3KYQ A;  3D6Y A;  3HE5 B;  3V2P A;  1S1C X;  3Q5P A;  3U75 A;  3FWL A;  3LDK A;  3L74 G;  1L2P A;  4L75 A;  3L72 J;  5CCG C;  1AQ5 A;  4PV1 C;  1NTK D;  1ZLL A;  5B6S A;  1ZR4 A;  1HGZ A;  1FJK A;  4I2L C;  2YMK A;  2YFT A;  3VMZ A;  2P7J A;  2Z5I A;  1Y8A A;  3WUV A;  2D2C D;  1KIL B;  5FKC A;  4O8N A;  4PV1 D;  1J1D C;  1SQX K;  5JOW A;  1AFO A;  1J2J B;  1VQ4 P;  3R2P A;  4O8O A;  3JCU E;  3D60 A;  3IAO A;  3M9H A;  1Y4W A;  3T97 B;  4JF7 A;  1BGY E;  2IFM A;  1QGK B;  5CCG A;  4I6M C;  1QVG O;  3AE6 C;  5TJH A;  1MV8 A;  2YXQ B;  2KIK A;  3TK1 A;  3PRJ A;  5KJ7 A;  2XQR A;  4R4M A;  3FWN A;  1DEB A;  3WPY A;  1YBK A;  1PP9 E;  3MIW A;  1AJY A;  3BRV B;  1EZV I;  2NPS B;  4QMA A;  2GM4 A;  5ANN A;  3AEA C;  3RK3 E;  3QC2 A;  3H1L D;  4H44 C;  2YKQ A;  1S9K E;  3TNU A;  3H6P A;  2K1A A;  3C7O A;  4W7Z A;  1JEK A;  3VP9 A;  3KZI E;  2ZT9 B;  1OVR A;  2E75 B;  2XU6 A;  3RGU A;  1NGM B;  1VQ9 P;  2KP8 A;  3LW5 H;  2A06 G;  2AXT H;  2R5D A;  5GLO A;  5CCH A;  3H1K J;  4H13 D;  3TF5 A;  3R4Y A;  5BU8 B;  3GG2 A;  2WPS A;  3R67 A;  3CLQ A;  3MP7 B;  4D6T G;  2OXB A;  1AQT A;  2YKP A;  2PFX A;  1IFM A;  1EZV G;  1H0T A;  3CCQ P;  3AKG A;  3OM6 A;  1EZV E;  5FK8 A;  3AEC C;  3V2N A;  3BCC E;  1VQ7 P;  1FZE A;  4H13 B;  2W90 A;  1OX3 A;  1LT9 B;  3WN1 A;  3HTK A;  2OGU A;  2E42 A;  1GL2 B;  3RL0 B;  4YPC A;  4OGQ D;  1VQK P;  3JSV C;  3V2R A;  3B5N B;  3G3Z A;  1YQ3 C;  5CHX A;  3RBZ A;  3TGU E;  2ZVO B;  1SQV D;  4Y28 J;  2B4W A;  3KST A;  1SQP J;  4D47 A;  2KB7 P;  1RE3 C;  1JY2 O;  2WT7 B;  1KB9 E;  1BGY G;  1L0L G;  1DX7 A;  1ZXG A;  3M9B A;  1ST8 A;  2BEQ D;  2YFS A;  2OYH A;  1S9K D;  1QVF O;  1NHL A;  1QL1 A;  3FXD A;  4JBZ A;  3PJS K;  3RK2 C;  1NTK J;  1NTM D;  2HLO A;  5KLV G;  3OJA B;  1PPJ E;  2C9L Y;  3OW2 O;  1PPJ G;  3CX5 H;  1DEE G;  3B5N A;  2HPC B;  2QSI A;  1PGJ A;  2M0B A;  3GHG B;  1KMI Z;  1FJP A;  1ZRT E;  3USS A;  1RQV A;  2B87 B;  2ZVN B;  1NWQ A;  1KFM A;  1W2B O;  1GK6 A;  1EDI A;  3BCC D;  2HYN A;  1EXJ A;  3D71 A;  2LXB A;  1KTM A;  1HH0 A;  2K9J B;  5CJ0 A;  1PGQ A;  3UIA A;  4DCK A;  1EQ7 A;  3C8V A;  5AYD A;  1UV4 A;  1KN7 A;  1OIP A;  2X8T A;  2FYZ A;  1KV4 A;  1E5W A;  1LTI C;  1HGV A;  3AE1 C;  1GMJ A;  1IFN A;  1N73 B;  5APY A;  3F5H A;  1SQQ G;  1ZN5 A;  2QJY B;  3CWB G;  3L70 D;  2OYI B;  1NAF A;  4KHX A;  1CSB A;  1KZU B;  1U7J A;  2E5T A;  1M8O B;  3TNU B;  5AW6 B;  4D6T E;  3U1A A;  3OA7 A;  2VRS A;  1KQG B;  1QEX A;  4UDK A;  2B9B A;  2W83 C;  1NU1 G;  5DJT B;  1P84 H;  2KS1 B;  3L73 E;  3GF3 A;  2WPR A;  2IZ1 A;  3Q2Y A;  1IFP A;  4GOE A;  4AUW A;  1FAV A;  4O8P A;  3AEB C;  2Y0D A;  4KT0 J;  1NTM G;  2AEJ A;  1IFD A;  1WL7 A;  1IFI A;  3SWY A;  2KYV A;  4QQS A;  4NOV A;  4XFJ A;  1S2E A;  3RWK X;  1IK9 A;  1K04 A;  3AE3 C;  2WTY A;  2R44 A;  1K05 A;  2AEF A;  1N7S C;  5TIS E;  3WAU A;  2QM8 A;  1LJ2 A;  1SQP D;  1OW7 A;  3RK2 D;  3ABV C;  2RN0 A;  4UB8 E;  1URQ D;  1R5L A;  1JY3 O;  2QE7 H;  3S1K A;  3MUD C;  3H1I D;  2QJK C;  1LT9 C;  2KOG A;  1URQ A;  3LIE A;  5CCH C;  1L0N K;  2D2C C;  2GA1 A;  1GU5 A;  2G8Y A;  4L74 A;  3TGU J;  2MKV A;  1SFC B;  5FKB A;  2FKW B;  2A06 D;  1EXI A;  2Q9I A;  2WMM A;  1URQ B;  3RL0 g;  1K8A Q;  3H32 B;  3L70 E;  5AVZ B;  1FC2 C;  1PP9 J;  4D6T D;  2X8S A;  2LR2 A;  2FBW C;  2FY8 A;  3R4Z A;  4EQV A;  2MJZ A;  2HFE D;  2W6J H;  1IZN B;  5B66 E;  2WSF J;  2IYO A;  3FX0 A;  3II6 A;  3CCJ P;  3BCC J;  1YI2 P;  1OWA A;  1T2K C;  1A02 F;  4IFF A;  1EDL A;  3VMY A;  1G1J A;  3H1H J;  2FYU E;  3LID A;  3WU2 E;  2YIU C;  1CI6 B;  4GKG A;  1BE3 G;  1X79 B;  1XTC C;  4U3F J;  3GHG C;  1M90 Q;  1Q7Y Q;  3AE4 C;  1SQV G;  3GW6 A;  1ZME C;  1M1J C;  2KS1 A;  1DIP A;  3P32 A;  3H1K D;  3F89 A;  1MKM A;  1LTJ B;  4JQ0 D;  2Q3E A;  1SQP E;  5L8R J;  1JCD A;  3JC2 2;  2ZYA A;  1NTZ G;  4XE5 B;  2OYI A;  1LNQ A;  4TT3 H;  4EIJ A;  1N73 A;  3H1I J;  2CPS A;  4UB6 E;  1GTW A;  5CJ4 A;  3L4F A;  1LTT C;  2A06 E;  5AW2 B;  1LWU C;  3H1J G;  1Q86 Q;  3WUT A;  2ZXX A;  3HD7 D;  2K9J A;  3CX5 E;  1NKN A;  4R4L A;  3L71 E;  3C9I A;  4JYB A;  5H2F H;  5AVR B;  2A45 H;  3A2A A;  5AVQ B;  2WPV B;  4WBA A;  4JYC A;  3VT1 A;  3H1L J;  1JNM A;  2B87 A;  1KFN A;  2KXP B;  4HKZ H;  2XNX A;  4YTP C;  3M0D A;  4DT0 A;  1N7L A;  4PD4 E;  2OTK E;  3GHG A;  1RE4 C;  1BGY D;  3D61 A;  1RY3 A;  2P1J A;  2WSS H;  2HPC A;  1HWT C;  1YJN P;  4KC7 A;  5KAF H;  1HBW A;  5GTI E;  3C7H A;  3D5Y A;  3OM5 A;  3QEE A;  4M3L A;  1RF1 C;  5KLI B;  1T3J A;  3CC2 P;  2W6B A;  1L0N G;  3CC7 P;  1L0N E;  1BCC J;  2P67 A;  5FLW A;  1PGO A;  3BYN A;  1FZG A;  2QJY C;  3L70 J;  1FOS E;  1SQX G;  1ZP0 C;  4UDI A;  3S9O A;  1IJD B;  2Y9Z A;  1R5S A;  3W67 A;  3CCM P;  3RK3 D;  2YKO A;  1YYC A;  2WT7 A;  1WRG A;  1DH3 A;  2E76 C;  1UII A;  2EXI A;  1FBM A;  2QVA A;  1KYO H;  3C1L A;  1GD2 E;  3D6Z A;  2Q6Q A;  2IYP A;  1NTK K;  2OAR A;  1OW6 A;  5A7V B;  3HUS B;  3TAW A;  4AQR D;  1QX8 A;  1YTZ I;  1SVF A;  2QQV A;  5KAI H;  3A7O A;  5JOY A;  1K9M Q;  1IO4 A;  4IOI H;  3H1H D;  1OZH A;  2ADD A;  3QH9 A;  1VF5 B;  3LIG A;  4YXD C;  3QWO C;  3VT2 A;  3H1I E;  1RQU A;  1H0T B;  5AY9 A;  3IFM A;  3AKH A;  4IL6 X;  1G2C B;  4PD4 D;  2WQY C;  3SWK A;  2AC1 A;  4RES B;  5AVT B;  3SSU A;  1L4A C;  3BAT A;  2P2U A;  1YJ9 P;  3L72 E;  3L75 G;  1KYO E;  2NZ2 A;  2R32 A;  1T2K D;  4GIF A;  1SLQ A;  2M3E A;  3VMA A;  2E76 D;  2UWJ E;  5A7V A;  3JCU H;  1VQL P;  1ZOY C;  1KQF B;  4RO0 A;  3OM7 A;  1KB9 D;  3VTP C;  2KLV A;  1LTB C;  4BWN A;  2N9Y B;  1LTG C;  4H44 D;  1SQX D;  1BSN A;  1UIX A;  2QA4 P;  1XTG B;  2ZJS E;  3WMY A;  1AVY A;  4ONZ A;  1Y7B A;  1RH5 B;  2KUB A;  3B5N D;  4N2Z A;  2FYU D;  1KIL D;  1KOR A;  2KLU A;  4GOF A;  4PV1 B;  3CL3 D;  3SC7 X;  4H44 B;  2P10 A;  3PIJ A;  1M56 D;  1L0L E;  1LP1 B;  1VF5 C;  4IFD K;  3G71 P;  5H2F E;  3H1L E;  3NXS A;  2ZT9 C;  3O8Z A;  2QIW A;  2O01 N;  3HRN A;  4L73 A;  4DOJ A;  3L37 A;  2ADE A;  3RBX A;  5FMD A;  3HTK B;  1DD3 A;  1FOS F;  1NO4 A;  3GF7 A;  3VMX A;  3HE5 A;  1YTZ T;  5BVZ A;  5B6T A;  1NTZ K;  1FDM A;  3NFQ A;  1Z56 A;  3CX5 D;  4BRY B;  2NPS C;  1S5L X;  3SFE C;  3CXH D;  3CCU P;  1FZF A;  3L73 J;  1NU1 J;  5GLP A;  5APW A;  1EZV D;  1LTJ C;  3TDK A;  1PL5 A;  2N1T A;  1ZW0 A;  3H25 A;  3M06 A;  3AE5 C;  3U14 A;  1BSH A;  3RL0 C;  2WSF H;  2FYN C;  2IZ0 A;  2KZI A;  1USE A;  3MD0 A;  1WT6 A;  5APU A;  2LKM A;  3P7K A;  3CME P;  4NPF X;  4C7N B;  3I56 P;  2AXT E;  2HOD A;  2HG5 D;  2PGD A;  3ZXL A;  3TGU D;  1NU1 D;  1LTJ A;  3MUD A;  1SQQ E;  2QEX P;  1SQV E;  3GLM A;  2NPS A;  3P8C D;  1BCC E;  2Y0E A;  1SQQ K;  3LEM A;  4EDF A;  3VOP A;  1S3J A;  5KLI C;  2JEE A;  4TLF A;  2BCC G;  3AEF C;  1W18 A;  2XND H;  1JY3 N;  3RK2 B;  1EDJ A;  2FYU J;  3E1R A;  3FXE A;  3KQG A;  1M1J B;  4COT A;  2HR3 A;  1M1K Q;  1FZC C;  3G4S P;  3MTU E;  5AVX B;  4H0L D;  3CMA P;  1HJB A;  2IBZ G;  5CMZ A;  1KIL A;  4I1L A;  2KI7 B;  1SQB J;  1VQM P;  1SQV K;  3EWK A;  5CCG D;  2E74 D;  2IBZ E;  3L71 G;  2FFD A;  5CCH D;  5AVU B;  1PT2 A;  1OW8 A;  5JOX A;  2WSC H;  2R5B A;  4U6B A;  1YJW P;  2IBZ I;  4O9B A;  2O3J A;  2FYN B;  4AK6 A;  4UB6 H;  1VQ8 P;  3L74 J;  3VT0 A;  5AW1 B;  2E74 B;  2P58 A;  4HYT B;  5FMB A;  5GTH H;  2OTL P;  2G3A A;  3QEF A;  4L76 A;  1SS1 A;  1MFZ A;  3L74 D;  4PVA A;  3WPV A;  1X9V A;  3O6Q A;  3EFF K;  1W5C E;  3HD7 B;  3I5C A;  1PZQ A;  2FXP A;  3L72 D;  3V5B A;  3GMA A;  2YMY A;  2I1K A;  1OXZ A;  1L4A B;  3U1C A;  4WY4 D;  4AYC A;  1OMI A;  3IF4 A;  2WSC J;  1DD4 A;  2FXM A;  1NTZ J;  2K88 A;  1IC2 A;  3H1K E;  4DJG A;  1BDD A;  2M5A A;  1S4X A;  1G1I A;  1SQB E;  3NTN A;  4EI2 A;  3KF5 A;  1VDF A;  3VN0 A;  1SQP G;  3L73 D;  1Y9G A;  1GK4 A;  3V4W A;  3Q5S A;  3EFG A;  1LTS C;  1NTZ D;  1YIF A;  3G6E P;  1UYP A;  3CXH I;  3H1J J;  1PV3 A;  1VQN P;  4PJ0 H;  1GW3 A;  1BGY J;  3OM4 A;  3WPU A;  2OTJ P;  1AVO A;  3P2N A;  2W27 A;  3EQ2 A;  1NOH A;  3A5T A;  2OYH C;  3VSR A;  1CW5 A;  1JO5 A;  1GYE B;  2I1J A;  3QED A;  1NH4 A;  1GDT A;  3H1L G;  5FMC A;  3CCV P;  1AA0 A;  1FDI A;  3NQH A;  5AVY B;  3H1K G;  3L71 D;  1RHZ B;  2NRG A;  5EFW B;  3H1J D;  2E74 C;  1SQB K;  1E79 H;  2A45 I;  4WB4 A;  1Q82 Q;  1VQP P;  3MHV A;  2ZXE B;  3Q1M A;  1P84 D;  4D6T J;  2RMZ A;  2J59 M;  4WWI A;  2B88 A;  4WY4 A;  3OM2 A;  5GLK A;  2Q7C A;  3A0H H;  3S4R A;  2ZYD A;  4H0L C;  1KD1 Q;  4N6J A;  1YHQ P;  4ZNC A;  5CBO A;  3VSS A;  2Y0C A;  4LGD E;  1JTH B;  1OYG A;  2XKM A;  3WUU A;  1H88 A;  1K73 Q;  3VSF A;  2Q5U A;  3CWB D;  3L70 G;  1SQX J;  1TU3 F;  3ZXJ A;  1M1J A;  1NTK E;  2H7H A;  4RKU J;  5AW7 B;  4EYY Q;  3A0H E;  4PVI A;  2IPP A;  1M57 D;  5CBN A;  3A0B H;  3IR9 A;  4C7R A;  4KJM A;  3CX5 I;  3C2U A;  1SQB D;  3KHU A;  5AYE A;  1LGH B;  1KQL A;  2IFN A;  2BCC E;  3CWB J;  3TYY A;  3CCR P;  1J1D B;  1FZA A;  3Q3D A;  1L0L J;  1HUC A;  2QJP C;  4FFI A;  2OYH B;  5APS A;  4CPG A;  2RH0 A;  1FZC A;  3WMM 0;  3K1U A;  1FDO A;  3MGN A;  3N7N A;  2PRR A;  5APT A;  3B4S A;  1GU4 A;  1KC8 Q;  2WSE H;  4U3F E;  4K3A A;  1NU1 K;  5KLV J;  2QG4 A;  3CD6 P;  1N7S D;  1NKZ B;  3L75 D;  1GYH A;  4IL6 E;  1RF0 C;  3I55 P;  3H1J E;  5AW8 B;  1FZB A;  5BU5 A;  5E79 H;  3UGH A;  3KDP B;  3CXH H;  4OVN F;  5GTH E;  1GL2 A;  5AW4 B;  1NYH A;  4UDG A;  3CPW O;  1LT9 A;  1Q90 D;  2JJL A;  2EXH A;  1VQ6 P;  4MLG A;  1Y47 A;  2KK7 A;  1D7M A;  4AK5 A;  3HE4 B;  3O6Q B;  1Y9B A;  3W68 A;  2N9B A;  2YO2 A;  4WY4 C;  1HJ0 A;  5APQ A;  3V2Q A;  3TSI A;  4BXL A;  1IFJ A;  2IBZ D;  2KSJ A;  4EOT A;  1LT1 A;  2WSE J;  5C39 A;  3ZXK A;  1IK7 A;  3RK3 C;  1KYO D;  2RKL A;  1YIJ P;  2GUV A;  3VYI A;  4WVZ A;  3LIH A;  1PFI A;  2OQQ A;  1J1E C;  3CCL P;  2KNC A;  1NAY A;  1SQQ J;  1Y9M A;  5GLQ A;  3AED C;  5GTI H;  3B5N C;  2W8Z A;  4N2R A;  2BAS A;  2FFD B;  2CK3 H;  2K37 A;  2BCC D;  4KCA A;  3FGA D;  3VSZ A;  3L74 E;  1PP9 G;  1OVU A;  3B71 A;  1Q2N A;  1KIL E;  3P8M C;  5AVW B;  1N8R Q;  1L0N D;  1EC5 A;  4U3F D;  2O01 H;  3MZW B;  1S72 P;  2C0X A;  1S5L E;  3KF3 A;  3L72 G;  3L75 E;  1KYO I;  1VL2 A;  1U7M A;  3AE7 C;  2O1J A;  3U59 A;  2IX7 C;  1L4A D;  2WZ7 A;  3L36 A;  5K5G B;  2E75 D;  3AKI A;  3T97 A;  2ZAE B;  1GL2 C;  1PIX A;  1GZL A;  5KLV D;  1NTM E;  5M1B A;  3WPZ A;  1Q81 Q;  1NTZ E;  1GW4 A;  1NJI Q;  5KAF E;  1OVV A;  1PPJ D;  4ASV A;  2YNY A;  2YXR B;  1RF0 A;  2HOD B;  4N78 E;  3RK3 B;  5KTB A;  4XA4 A;  4C7N A;  1X22 A;  1JB0 J;  3WMZ A;  1T8Z A;  2BEZ F;  2JO1 A;  1VQO P;  2O01 J;  2KSE A;  1ZRT D;  5AVS B;  2OYI C;  2L91 A;  3SFD C;  4NPE A;  5APV A;  2H43 A;  3H1I G;  5AW5 B;  3C7F A;  2N1T B;  2JWA A;  3AE9 C;  1TL2 A;  3WU2 H;  5AW9 B;  4U7J A;  1P84 E;  4HB1 A;  3K5B A;  1AV1 A;  2O1K A;  5FK7 A;  3RL0 D;  3Q5R A;  3PIG A;  2QJP B;  2Z5H A;  1N2D C;  2PAJ A;  3PH0 A;  3UGF A;  1JM0 A;  2J5U A;  3BYJ A;  1YQ4 C;  3HE4 A;  1A02 J;  1U57 A;  2BCC J;  1NU1 E;  3CWB E;  4ASW A;  3HUS C;  1RE4 A;  2WVR A;  1RE3 A;  1MZ9 A;  2KZJ A;  2WWW A;  3D70 A;  2JDI H;  2J58 A;  2FYU G;  2X8F A;  2JP3 A;  4W80 A;  1OFC X;  5DJU B;  2M3B A;  3BCC G;  1H89 A;  2K9Y A;  1VKD A;  4OWF A;  3WN2 A;  2WIT A;  2I8D A;  3N4X A;  1BE3 J;  1P84 I;  1LP1 A;  4W7Y A;  1X0T A;  5KKZ B;  2E5Y A;  3V6I A;  1SQX E;  1L0N J;  5KJ7 C;  2YO3 A;  2XV5 A;  1KQS O;  3WAT A;  1SQB G;  4H0L B;  5GLN A;  5A8C A;  3CI9 A;  4IFM A;  1JY3 P;  2DW3 A;  1HTL C;  1CZQ A;  3L71 J;  2H8P D;  2ZT9 D;  3CCE P;  2A45 G;  4PD4 I;  4OGQ B;  1QL2 A;  3BYK A;  1USD A;  3WN0 A;  1N73 C;  2ITA A;  5GLM A;  1RF1 A;  4N78 D;  2POH A;  1URQ C;  2GUS A;  1YIT P;  1VF5 D;  5AYC A;  1L0L D;  2N1T C;  4MN4 C;  3BRT B;  2W6A A;  1NTM K;  4Y99 C;  3B8E B;  2H89 C;  1YI7 A;  2QJK B;  1SFC D;  4NPD A;  1KIL C;  3CU9 A;  3UGG A;  1N7S B;  1HF9 A;  1JOC A;  5TIS H;  1KB9 H;  1MFT A;  1W2T A;  4U6D A;  1SFC C;  5JOZ A;  3LDR A;  3VP8 A;  3WAS A;  2KNC B;  2C9N Y;  4KCB A;  2JKV A;  1FU1 A;  3ZDM A;  1JTH A;  2OYO A;  2M8R A;  1NTK G;  3LW5 J;  1PGP A;  2AEM A;  1LWU A;  1G2C A;  2D2C B;  2SPZ A;  3CC4 P;  4PJ0 E;  2EXJ A;  2CPB A;  2L5G B;  4WY4 B;  1JMB A;  1VPC A;  3CXH E;  4GOD A;  3C7E A;  1FE6 A;  4B86 A;  1HVV A;  5KKZ C;  2FXO A;  3C7G A;  1MUU A;  2YFR A;  1T6A A;  2QRX A;  4I7Z C;  5A8D A;  4LC1 A;  1BCC G;  4OGQ C;  4IL6 H;  3HUS A;  1X8Y A;  5KAI E;  5GLL A;  2YIU B;  5APX A;  4YXW H;  1T3U A;  1M7L A;  2FFD C;  2NPS D;  1W2E A;  1SQQ D;  2AEZ A;  1ZV8 A;  3P8C E;  5E79 E;  1BCC D;  2E43 A;  1PP9 D;  2ZYG A;  1LTA C;  5AVV B;  1WMK A;  3AE2 C;  4RJT A;  3IN6 A;  4GDO A;  1FZC B;  2M5A B;  1J1E B;  2JWD A;  4N1I A;  1NVO A;  2E75 C;  3PP5 A;  2XDJ A;  4H13 C;  3E1I A;  3LF7 A;  1JY2 N;  1L4A A;  2H88 C;  5AW3 B;  5KLV E;  1FS0 E;  4PD4 H;  2JR8 A;  4UDK E;  3G9R A;  3A3Y B;  2V4H A;  3L35 A;  3HD7 A;  2K3R A;  1BE3 D;  2V7Q H;  4FFF A;  3KPE A;  2FYU K;  3AEG C;  2R3S A;  2VDT A;  2AEY A;  4FFH A;  5B66 H;  4OH8 B;  4FFG A;  3QZ4 A;  4ZKP A;  3A0B E;  1BDC A;  4ZKU A;  1EDK A; 
#chains in the Genus database with same CATH homology
 3AE1 C;  1GMJ A;  3WMY A;  4ONZ A;  1Y7B A;  3UGH A;  2QQW A;  1NYH A;  4UDG A;  4N2Z A;  1Q90 D;  1KOR A;  2EXH A;  4MLG A;  4AK5 A;  4PV1 B;  1Y9B A;  3SC7 X;  3D5Z A;  4H44 B;  2P10 A;  4UDJ A;  1YRZ A;  3PIJ A;  1HJ0 A;  1KQG B;  4UDK A;  1VF5 C;  4Z1M H;  2WSE J;  3ZXK A;  1IK7 A;  2ZT9 C;  2IDB A;  2QIW A;  2V7Q J;  3GF3 A;  3AKF A;  3Q2Y A;  2ADE A;  3AE8 C;  4KMI A;  3LIH A;  4O8P A;  3AEB C;  4KT0 J;  5FMD A;  2OQQ A;  3LFI A;  1DD3 A;  1WL7 A;  3GF7 A;  2QQU A;  4QQS A;  1Y9M A;  4NOV A;  5GLQ A;  3AED C;  4XFJ A;  3RWK X;  4N2R A;  1K04 A;  5FIX A;  3AE3 C;  4KCA A;  5B6T A;  3FGA D;  1K05 A;  3WAU A;  3VSZ A;  1OW7 A;  1S5L X;  3ABV C;  3SFE C;  3B71 A;  1KIL E;  5GLP A;  2QJK C;  1GYD B;  1PL5 A;  2EXK A;  3BYL A;  3H25 A;  3AE5 C;  3U14 A;  2FYN C;  2D2C C;  2G8Y A;  3KF3 A;  2MKV A;  5FKB A;  1VL2 A;  3AE7 C;  1EXI A;  5GLR A;  4N4B A;  3AEE C;  2E75 D;  3AKI A;  4AK7 A;  3RL0 g;  3ZXL A;  1PIX A;  5M1B A;  1R8E A;  3WPZ A;  3GLM A;  4I7Z B;  4KC8 A;  2E76 B;  3LEM A;  2X8S A;  3LV4 A;  5KLI C;  2FBW C;  3AEF C;  3R4Z A;  1W18 A;  1JB0 J;  4EQV A;  5C0P A;  3WMZ A;  2BEZ F;  2JO1 A;  2O01 J;  3D6Y A;  1S1C X;  3Q5P A;  3U75 A;  2WSF J;  3LDK A;  3SFD C;  4COT A;  4PV1 C;  3C7F A;  5B6S A;  3AE9 C;  2YIU C;  4H0L D;  2YMK A;  2YFT A;  4U7J A;  2D2C D;  3AE4 C;  5FK7 A;  1ZME C;  3Q5R A;  5FKC A;  1DIP A;  3PIG A;  4O8N A;  3EWK A;  4PV1 D;  5JOW A;  2E74 D;  4O8O A;  3UGF A;  1MKM A;  3D60 A;  2J5U A;  3IAO A;  1PT2 A;  3BYJ A;  1Y4W A;  3T97 B;  1YQ4 C;  5L8R J;  1OW8 A;  1U57 A;  5JOX A;  4U6B A;  3AE6 C;  3D70 A;  2X8F A;  4AK6 A;  2XQR A;  2JP3 A;  4TT3 H;  4R4M A;  3VT0 A;  3WPY A;  2K9Y A;  1VKD A;  2E74 B;  1AJY A;  5FMB A;  3WN2 A;  2G3A A;  3QEF A;  5ANN A;  3AEA C;  3RK3 E;  3QC2 A;  4PVA A;  3WPV A;  4H44 C;  3O6Q A;  3WAT A;  5GLN A;  4H0L B;  4R4L A;  5A8C A;  2FXP A;  3C7O A;  2ZT9 D;  4OGQ B;  2ZT9 B;  3GMA A;  2WPV B;  2E75 B;  3BYK A;  1NGM B;  3VT1 A;  3WN0 A;  1OMI A;  2WSC J;  5GLM A;  1DD4 A;  5GLO A;  4YTP C;  1VF5 D;  5AYC A;  4H13 D;  3KF5 A;  3R4Y A;  3D61 A;  2H89 C;  1YI7 A;  1Y9G A;  3R67 A;  4KC7 A;  2OXB A;  3C7H A;  3Q5S A;  3D5Y A;  3OM5 A;  3CU9 A;  3QEE A;  3UGG A;  1YIF A;  1UYP A;  1PV3 A;  3AKG A;  3OM6 A;  5FK8 A;  3AEC C;  1HF9 A;  3OM4 A;  1W2T A;  4U6D A;  3WPU A;  5JOZ A;  3P2N A;  5FLW A;  4H13 B;  3LDR A;  3VSR A;  3BYN A;  2QJY C;  1GYE B;  3WAS A;  3QED A;  1ZP0 C;  3WN1 A;  4UDI A;  4KCB A;  3S9O A;  5FMC A;  3LW5 J;  1FDI A;  4OGQ D;  2D2C B;  3NQH A;  2EXJ A;  1YQ3 C;  2E76 C;  2E74 C;  2EXI A;  3C7E A;  4Y28 J;  2B4W A;  3KST A;  3Q1M A;  4D47 A;  5KKZ C;  3D6Z A;  3OM2 A;  5GLK A;  3C7G A;  2YFR A;  4H0L C;  1OW6 A;  5A7V B;  3VSS A;  3TAW A;  4I7Z C;  1ST8 A;  2BEQ D;  5A8D A;  1OYG A;  2QQV A;  4OGQ C;  3VSF A;  2YFS A;  5GLL A;  5JOY A;  1TU3 F;  3ZXJ A;  4RKU J;  2ADD A;  1VF5 B;  3LIG A;  4YXD C;  2AEZ A;  3VT2 A;  4PVI A;  1RQU A;  5AY9 A;  3AKH A;  4IL6 X;  1WMK A;  2QSI A;  3AE2 C;  3C2U A;  2WQY C;  5AYE A;  3IN6 A;  4GDO A;  2AC1 A;  1KMI Z;  4N1I A;  1ZRT E;  2E75 C;  1RQV A;  4H13 C;  3Q3D A;  2QJP C;  4FFI A;  3LF7 A;  2H88 C;  2NZ2 A;  4UDK E;  2E76 D;  3G9R A;  3K1U A;  1FDO A;  5A7V A;  1EXJ A;  3D71 A;  1ZOY C;  1KQF B;  1KTM A;  3OM7 A;  4FFF A;  3AEG C;  2VDT A;  2AEY A;  4FFH A;  1GYH A;  3C8V A;  4FFG A;  3QZ4 A;  5AYD A;  4H44 D;  1UV4 A;  2X8T A;  1UIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...