3R4YA

Crystal structure of alpha-neoagarobiose hydrolase (alpha-nabh) from saccharophagus degradans 2-40
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
362
structure length
360
Chain Sequence
KLSKASLRAIERGYDEKGPEWLFEFDITPLKGDLAYEEGVIRRDPSAVLKVDDEYHVWYTKGEGETVGFGSDNPEDKVFPWDKTEVWHATSKDKITWKEIGPAIQRGAAGAYDDRAVFTPEVLRHNGTYYLVYQTVKAPYLNRSLEHIAIAYSDSPFGPWTKSDAPILSPENDGVWDTDEDNRFLVKEKGSFDSHKVHDPCLMFFNNRFYLYYKGETMGESMNMGGREIKHGVAIADSPLGPYTKSEYNPITNSGHEVAVWPYKGGMATMLTTDGPEKNTCQWAEDGINFDIMSHIKGAPEAVGFFRPDSDDPISGIEWGLSHKYDASWNWNYLCFFKTRRQVLDAGSYQQTGDSGAVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase family 32, N terminal
publication title Crystal structure of a key enzyme in the agarolytic pathway, alpha-neoagarobiose hydrolase from Saccharophagus degradans 2-40
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 85
structure length 360
sequence length 362
chains with identical sequence B
ec nomenclature ec 3.2.1.-:
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.640 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3r4yA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3r4yA02
3D5YA 5GLRA 3QEDA 3AKHA 4KMIA 2X8FA 3BYLA 3NQHA 4UDKA 5FMCA 1GYEB 2AEZA 5GLLA 3OM4A 2QQUA 3WPZA 4KC7A 4COTA 4AK7A 1GYDB 1Y7BA 3LEMA 3TAWA 5FLWA 3OM2A 4FFGA 1VKDA 3UGGA 2YFTA 3R67A 3WN2A 5B6TA 3R4ZA 3C7FA 3LIGA 3WATA 2EXIA 2X8SA 5AYEA 5GLKA 3C7GA 5A7VA 3P2NA 1MKMA 3AKIA 3OM6A 4N2ZA 2ADDA 5FKCA 3ZXLA 3C2UA 3VT2A 3UGHA 4O8OA 5GLPA 3ZXKA 3U14A 4EQVA 1YRZA 4O8NA 3R4YA 2AC1A 3PIJA 4NOVA 3D5ZA 4KCBA 3VT1A 4AK6A 3RWKX 1ST8A 3WN0A 3WPYA 3AKGA 4MLGA 5FKBA 3AKFA 1Y9GA 3LF7A 2QQWA 3WN1A 3WASA 5ANNA 3QEFA 1Y4WA 4KC8A 1WL7A 4N4BA 5C0PA 3LV4A 1GYHA 2VDTA 4ONZA 4UDKE 5GLQA 5GLNA 3VSSA 4U6DA 2QQVA 4N2RA 3QZ4A 5FK8A 1OYGA 3VSFA 1YIFA 2OXBA 3PIGA 1UYPA 3LDRA 4O8PA 5FMBA 3SC7X 3U75A 3WAUA 5GLOA 5GLMA 5JOZA 5AY9A 3WPUA 1W18A 3ZXJA 1Y9MA 3QEEA 2EXKA 3BYNA 2AEYA 3OM7A 3WPVA 3D60A 4UDJA 1UV4A 4UDIA 4KCAA 2YFRA 3D61A 3KSTA 1W2TA 2EXJA 3K1UA 5AYDA 3KF3A 4AK5A 5A8DA 5JOWA 4FFFA 3WMYA 4U6BA 4N1IA 4FFIA 3LIHA 5JOXA 3QC2A 2YFSA 5FMDA 5JOYA 3LDKA 2X8TA 3VT0A 1YI7A 4QQSA 3WMZA 3LFIA 5A8CA 4D47A 4UDGA 3C7OA 4PVIA 2EXHA 3C7EA 3CU9A 2ADEA 5B6SA 4PVAA 5AYCA 3KF5A 5FK7A 3BYJA 2B4WA 4FFHA 3VSRA 3UGFA 3C7HA 3BYKA 1PT2A 5FIXA 2XQRA 3OM5A 5A7VB 3VSZA
chains in the Genus database with same CATH superfamily
2X8FA 2E76D 5K5GB 4OGQD 3Q5PA 1NTMJ 4BWNA 1S1CX 2AXTE 2WPSA 3WN2A 1GMJA 2WSFJ 4OH8B 2OGUA 3L73D 1JM0A 4K3AA 3G6EP 2BASA 2OYHC 2DW3A 1VQPP 1JY3N 3CWBD 1NTKE 1VQMP 4N2ZA 5TISH 3PP5A 1YTZT 1L4AD 3HUSA 3L75E 2K9JB 1QVGO 3HE4A 2CPSA 3AE6C 3PIJA 3H1JE 3M06A 3L74G 1JY2P 3E7KA 1EDJA 3CMAP 3LF7A 1XTCC 3TNUA 3B4SA 3V2NA 5KAIH 2W8ZA 3T97B 4ZNCA 2E43A 2PRRA 4I7ZC 1YIJP 1S5LH 1LTTC 2QIWA 2IYPA 2ZT9B 3USSA 2XKMA 4WB4A 2JWDA 2KSEA 1ZRTD 4WY4B 1PP9G 4W7YA 2H43A 4EYYQ 4OWFA 1EXJA 3CCRP 1JB0J 3TGUD 2OTKE 5A8DA 1J1EC 5CCGC 2YFSA 1QLED 4B86A 1T8ZA 2MKVA 3CCUP 3C7OA 4PVAA 1R5SA 1L0LJ 2Q6QA 5AW5B 1NTKK 1PT2A 1S5LX 4Y99C 1KILC 1QX8A 1PGJA 3H1HG 1P84D 3WPZA 4KHXA 2B88A 1NTME 2NPSA 3KYQA 1GYDB 1LTBC 2KIKA 1FOSE 1BSHA 1S3JA 3KHUA 3JCUE 3C7FA 1BE3G 1IJDB 1PL5A 1M1JA 3P2NA 4Z1MH 3CXHD 1HH0A 5B5EE 2L5GB 4WBAA 1CSBA 1LGHB 2K9YA 2CK3H 5AVYB 1FJPA 3WN0A 2BCCJ 4IFDK 1VPCA 4H13D 5KJ7C 4IL6X 1HJBA 3PRJA 2Q3EA 1LJ2A 1N86A 4ZKUA 3L72J 3H1IG 3ZXJA 4O9BA 3SWKA 1E5WA 3BCCD 3MZWB 1NWQA 1NTZJ 1MUUA 3O8ZA 3FXEA 1OW7A 3KF3A 4AK5A 3M91A 4H44B 3VMAA 1EC5A 5TISE 1NTMK 2W27A 5JOXA 3M0AA 3EFFK 4JF7A 2P1JA 4UDGA 4C7NA 1R5LA 1L0LE 2W6AA 3FGAD 2Y0DA 3HTKB 3V2QA 2YO3A 1FE6A 5KAIE 1BGYJ 2WVRA 1SQPJ 5APUA 5AVZB 1LTJB 2KZIA 3UIAA 1M7LA 2RMZA 1HTLC 1S5LE 3N7NA 2OYOA 3L71G 2P7JA 1FZEA 2XU6A 3G4SP 3IR9A 1KV4A 5KTBA 1M90Q 2POHA 1JTHA 1NOHA 4WY4C 1T2KC 3WUUA 1U7MA 1GU4A 3HD7D 1VF5D 3D5ZA 4HYTB 2KS1B 2BCCE 2YO2A 2WPRA 2M3BA 3KXDA 3F5HA 3CL3D 2C9LY 1YJ9P 2ZVOB 3QZ4A 3L72E 2WPVB 4GOEA 2E75B 1L0LK 2HODB 2WSEH 3OM7A 2HYNA 3H1JG 1FC2C 1FZCA 4N6JA 3HE5B 1FDMA 3W68A 3RK2D 3EQ2A 1KQSO 3LFIA 2R3CA 1ZLLA 4AQRD 1VQKP 2LR2A 1KQGB 5FK7A 1GL2C 2Y0EA 4OVNF 2ZYGA 1MZ9A 2Y9YA 5AVQB 3NTNA 1IZNB 2FYZA 1L0NJ 4HJGH 2GUSA 1Y47A 5CCHD 4H0LD 3HD7A 1LNQA 2QQUA 4UB6H 3CCEP 2KLUA 4YXDC 3L70J 1EZVI 1VL2A 4YXWH 2WSEJ 2QA4P 1LTIC 2JP3A 1OVRA 3M0DC 2HPCB 2B9BA 4D6TJ 3C7GA 1Q7YQ 4XE5B 5CJ4A 4N78D 1LWUA 1SP4A 1KILA 1GK4A 1N7SD 2XV5A 4KCBA 2E42A 1NTMG 4H44C 3CCQP 2QQWA 2Z5HA 3HRNA 3AE4C 3ZDMA 3LV4A 2R5BA 3PJSK 4JQ0D 1FU1A 3PLNA 3TK1A 1FJKA 3U75A 4U3FJ 3FWLA 4GDOA 3WU2H 1NAYA 2QJKB 1LTJC 1JCCA 3WPVA 3D60A 3E1RA 1PP9E 1ZP0C 2E74D 2IX7C 2M8RA 1JO5A 1HJ0A 1H88A 5CCHA 1N73B 1G1IA 1YI7A 4BRYB 1JCDA 1BDCA 2OYHB 1BCCD 1K9MQ 1QVFO 1W2BO 5KLVJ 4YPCA 1IFJA 1KORA 4OGQC 2A06D 1G2CB 1YITP 5FIXA 2QVAA 1SQBD 3B5ND 1L0NE 5CBNA 1SFCB 2D2CD 4KC7A 3MUDC 2YIUC 3L70E 2OQQA 4ZKPA 1VKDA 4I7ZB 1MV8A 1L0LG 3C9IA 3E1IA 3LIGA 3K5BA 3GMAA 1PIXA 4D6TE 1RE3A 3U1CA 4DT0A 1KYOD 1Q2NA 1OMIA 2K9JA 1NJIQ 3R4YA 4CPGA 1K04A 3H1LD 3L4FA 5B66H 2N1TD 1FS0E 2C0XA 3T97A 3QEFA 5GLNA 1N2DC 2H88C 2M5AB 3RL0g 3WAUA 1YQ4C 4U3FE 4UB6E 2EXKA 2Q7CA 2AEYA 4Y99B 4WY4A 2YXRB 3G9RA 5CMZA 4AUWA 2Q5UA 4KCAA 1L0NK 1W2TA 2BCCG 1KN7A 2WSCJ 2H8PD 3Q5RA 3FWNA 1HF9A 5TJHA 3VT0A 1JY3P 1GDTA 1NGMB 4UB8H 5AYCA 5KLVE 4JPZB 2B4WA 1OW8A 3V2RA 1EZVE 1NTZG 2LXCB 5A7VB 3D5YA 1OW6A 1NAFA 2OYIC 1NTKD 5GLLA 5AW4B 3L71E 3Q1MA 3L75D 4DCKA 3WU2E 2MJZA 2J59M 3L73J 1P84I 4NPFX 2BEQD 3CWBJ 2FYNB 2UWJE 5AYEA 2O01N 2QJKC 3AKIA 1Q90D 1BGYG 1SQPG 1AV1A 3AE5C 4H13C 1J1DC 3CPWO 1KB9D 3U14A 1IK9A 3OA7A 4NOVA 1KFNA 3RK3B 2IBZD 3CXHI 3FXDA 3CCSP 2W6JH 2IZ0A 1N73C 2IYOA 1P84H 1IO4A 1LP1B 2KNCB 1VQ8P 5BU5A 2OXBA 1RF0A 2ZJSE 1HGVA 2XNDH 5KLVK 1M8OB 2NPSD 3PTZA 2AEMA 2I8DA 2ZAEB 2YFRA 1FZBA 1SFCC 3KSTA 3GF3A 2FFDA 5KAFH 1EDIA 1USDA 2L91A 5APTA 2Y0CA 1S9KD 1GD2E 2I1KA 2ADEA 5B6SA 1DD3A 5B66E 3HTKA 3MHVA 5KKZB 2IDBA 1A02F 1IFDA 1VQOP 1PPJD 1ZOYC 3BVHA 1GYEB 1WT6A 2J58A 2KOGA 1T6AA 1VQ5P 1K73Q 1SQQD 3L73E 1LT9A 3TAWA 4IOIH 3OM2A 1JMBA 3VN0A 1QL1A 3JSVC 4HH2A 1KFMA 4IL6H 1L0NG 4O8OA 5GLPA 3ZXKA 4EQVA 3IN6A 1AA0A 3VT1A 2KS1A 4UB8E 3L70G 4MLGA 2GUVA 5FKBA 5CJ0A 4GIFA 3R2PA 3VMYA 2LXBA 1WL7A 4N4BA 1K8AQ 4BXLA 2QQVA 4D6TG 2B87B 3PIGA 1RQUA 3LDRA 3BCCJ 1TU3F 3P32A 3AEGC 1GL2B 1ZRTE 2HODA 5AW6B 3KPEA 3P7KA 1NU1G 1WRGA 3RK2C 3H1KG 1YTZI 3K1UA 2G8YA 4RJTA 3HE5A 3RL0D 2G3AA 5JOWA 1JMMA 1URQB 3D6YA 1SLQA 3S1KA 2FKWB 2W6BA 2FYNC 2W83C 2V7QJ 4U3FG 2ITAA 3QH9A 3CX5D 2JR8A 4H0LC 2WZ7A 4KT0J 3CCLP 1X8YA 3OM5A 5GTIE 1P84E 3RK3C 1RH5B 2FYUD 3SWYA 3QEDA 1OIPA 5AW3B 2KXPB 1EXIA 3II6A 4COTA 3TSIA 1FOSF 4I1LA 1Y7BA 5AVXB 2P10A 4PJ0H 2YFTA 2BCCD 3GF7A 5KLVG 1FZGA 2HPCA 3WATA 1N7SC 3AEAC 5KAFE 3A0HH 1EZVG 3A0BH 2P2UA 1YHQP 5AVWB 3L72D 4GOFA 1GK6A 1DH3A 4AK6A 2HR3A 2Y9ZA 2KP8A 2IFMA 1CI6B 4LC1A 1PGPA 5KLIB 1AVOA 4PV1B 2VRSA 3JC22 1Y4WA 3SFDC 2FXPA 1NYHA 4UDKE 1RE4C 2XDJA 2E76B 1OYGA 1KMIZ 4OGQB 5AW0B 5GLMA 3BCCE 1W18A 5E79H 1JUNA 5KKZC 1LT1A 3U59A 3U1AA 5CCGD 4WWIA 1SQXD 2YIUB 2N9BA 1SQVD 3MD0A 1L4AB 4IL6E 1N73A 3QC2A 1FZAA 2YXQB 3SWFA 1GZLA 4BRYA 3GHGB 3GLMA 2OYHA 1DX7A 2FY8A 2EXHA 2K37A 1KILD 2XNXA 4ASVA 1FBMA 2D2CC 1G2CA 4RKUJ 3UGFA 3C7HA 1NTZE 1RF1B 1EDKA 2OTJP 1H0TB 5GLRA 3AKHA 3BYLA 3MTUE 2SPZA 1M56D 5AW2B 2Z5IA 4AK7A 1NHLA 2KYVA 3L74D 4LLHA 5BVZA 2QJPC 5AVRB 3WMM0 1H89A 5APXA 1AFOA 1OVVA 1BGYE 1PGQA 1SQPE 1KQFB 1DEEG 2RKLA 5FKCA 4QMAA 3UGHA 5KJ7D 2RH0A 3M9BA 1KYOI 1S2EA 2A45I 3F89A 4ZMDA 5CCGA 1URQC 3L73G 1Y9GA 1DIPA 4W80A 2IPPA 2QG4A 1PP9D 3CI9A 3CWBG 1GYHA 2V4HA 1KQLA 5FMBA 4IFFA 1UYPA 4O8PA 3P8CD 2C0WA 1NU1J 1NTZK 3SSUA 3H1KJ 2ZXXA 4R4LA 2OYIB 4PJ0E 3HUSC 1ZMEC 4EOTA 3A0HE 3MP7B 3A0BE 3AE3C 1JOCA 1BCCJ 3H1HD 5A8CA 2KI7B 4EI2A 3C7EA 2JDIH 2JO1A 3ABVC 1SQBJ 4H13B 1SQPK 1J1DB 2KLVA 2R44A 2FXOA 1BE3D 3B71A 1X0TA 3VMZA 2RN0A 4JYBA 1MFTA 3NQHA 1Q82Q 5KJ7A 3W67A 5KLIC 4PV1C 3RK3E 4W7ZA 1ZW0A 4DOJA 5E79E 1YI2P 2ZT9D 1PV3A 4WY4D 2KUBA 2E76C 2QE7H 1IFPA 2LKMA 4N78E 1LTAC 2P58A 1CZQA 3H1LJ 2K88A 3I56P 4JBZA 3H1ID 3AKGA 1KB9I 1L4AC 2OARA 3L37A 1USEA 3GHGC 1FZCB 1ZV8A 1LP1A 4I2LC 2IBZI 4KC8A 2I1JA 2WSCH 3CCMP 1RQVA 2NPSC 3AEFC 1AQTA 5FK8A 3VSFA 1YIFA 4AYCA 1RF1C 3N4XA 2FXMA 1NU1E 1VDFA 3P8MC 1ZN5A 3H1KE 3BRTB 3TF5A 1OX3A 3CD6P 1X22A 2QJYC 1KB9H 1EZVD 4FFFA 4PD4D 1S72P 3HD7B 4NPDA 3KQGA 1VF5B 3BCCG 2A06E 4YTPC 3L71D 3C8VA 4FFHA 2YMKA 3GW6A 1NTKJ 4U7JA 1IK7A 3L75J 3LIEA 1YJWP 4A7PA 2YKQA 2C9NY 5C2MA 3H32B 1GU5A 1YYCA 2QRXA 4FFGA 1W5CE 3AE9C 2O1KA 2EXIA 4XA4A 4H44D 5EFWB 1Q81Q 3VT2A 3RK2B 1NO4A 1NU1K 3H1LE 3V2PA 5GTHH 1YRZA 4O8NA 3A3YB 1AQ5A 1JEKA 4LGDE 4L75A 2P67A 3TDKA 3I5CA 3H1JD 2WTYA 1JY2O 1Y8AA 3EWKA 4WVZA 3V4WA 5H2FH 2VDTA 3NMDA 2YKPA 3RBXA 2B87A 4H0LB 1GL2A 5GLOA 5AY9A 1NKNA 1W2EA 2PGDA 2JEEA 1UV4A 3G71P 1SS1A 2HLOA 1IFNA 2EXJA 5GTIH 1KC8Q 3M9QA 1URQA 3WMYA 4U6BA 2PP6A 1VQLP 4N1IA 1U7JA 3LIHA 5FMDA 3M0DA 4D47A 1N7SB 1XTGB 2H7HA 3AEBC 2KZJA 3QWOC 2O3JA 4JYCA 3AEDC 3TGUJ 2GM4A 2ZVNB 3CXHH 3CX5I 1HBWA 5FMCA 1SQQJ 1FZCC 2E75D 1R8EA 3A5TA 1G1JA 1Y9BA 1NTMD 3AECC 5APYA 1CW5A 3VMXA 4GKGA 2E74B 3CCJP 1EDLA 3VOPA 4IFMA 1LTJA 1QL2A 3M9HA 1MKMA 2NZ2A 3VP8A 1KB9E 4EDFA 2AEJA 2IBZE 3CX5H 2KSJA 1KD1Q 1X9VA 1CI6A 3WUTA 2Q9IA 3AKFA 3HD7C 3CWBE 3B5NB 1VF5C 3C1LA 5APSA 2KB7P 1J2JB 2D2CB 2V7QH 3IF4A 2WITA 3PH0A 2WPQA 3D61A 2K3RA 1LWUC 3MUDA 1AVYA 4RO0A 2WT7B 1H8AA 1S9KE 2AXCA 1RHZB 1L4AA 4FFIA 1JY2N 2R32A 1VQ9P 1NH4A 2QJPB 3GHGA 5JOYA 1ZXGA 1QEXA 3OAKA 5GTHE 1GW4A 4L74A 1HGZA 2HFED 4PVIA 3O6QB 2XZRA 2N1TB 3KF5A 1RY3A 1VQ4P 5AVTB 1RF1A 3VSRA 1S4XA 3TGUE 2FYUJ 1PPJE 1KZUB 1L0LD 1N7LA 1H0TA 1Z56A 5H2FE 2O01H 3V5BA 3V4QA 4KMIA 1DD4A 1SQQE 1BCCG 2KK7A 3MIWA 3IFMA 2A06G 3UGGA 2JJLA 5CCHC 5B6TA 1SQBG 2AEFA 4R4MA 4GODA 3C2UA 3HUSB 3LW5H 2AC1A 3HE4B 4XFJA 3AE1C 3AE8C 4HB1A 3OW2O 2QSIA 3WASA 2O1JA 2FFDB 5ANNA 3TNUB 2A45G 3CXHE 3VSSA 2O01J 4N2RA 1PZQA 1ZR2A 1SFCD 3WPUA 3H1LG 3QEEA 1UIIA 2FBWC 1HWTC 1RE3C 3EFGA 2OYIA 1SQXJ 3OJAB 5AVSB 4Y28J 3D6ZA 3Q2YA 4K35A 1SQVJ 1NTZD 3L35A 1SQQK 1M1KQ 1IC2A 1OVUA 1LTSC 3I55P 3LDKA 4L73A 3CX5E 3LW5J 3BRVB 2E74C 2OTLP 2M3EA 1LT9B 3A2AA 1NKZB 3BYJA 2FYUE 2Q1KA 1GTWA 1T3UA 2ZT9C 3KZIH 3VP9A 5DJTB 4UDKA 1BGYD 1SQPD 2AEZA 2QEXP 3L74J 2M0BA 3VYIA 3B5NC 2WMMA 2Z4EA 2NPSB 1UIXA 3CC2P 5GLKA 3OM6A 1M1JB 1NTKG 2YNYA 3ZXLA 3CC4P 1SFCA 1YQ3C 5AW7B 3L75G 2QJYB 3TYYA 1TL2A 3RWKX 3WPYA 1PP9J 3B8EB 2YKOA 3CC7P 2ZFCA 2IZ1A 1Q86Q 5M1BA 1VQ6P 5C0PA 3IAOA 5GLQA 3BATA 1M57D 3CCVP 4NPEA 2N1TC 1OZHA 3SC7X 5JOZA 5CHXA 4RESB 2IBZG 2FYUK 5AW9B 1SQXE 1X79B 1SQVE 3RBZA 3WUVA 3H1HJ 1FZFA 1FAVA 1IFIA 2J5UA 3A7OA 5APWA 2M5AA 1KILE 2HG5D 1SVFA 2K1AA 4PD4I 3RK3D 4HKZH 4KJMA 1NVOA 4C7NB 1BE3J 1RF0C 1KYOH 2A45H 2E5TA 4EIJA 1L2PA 1YBKA 3H25A 1L0ND 4MN4C 5DJUB 1BSNA 3L74E 2FFDC 2R3SA 5APQA 3H32A 3V6IA 3L70D 3R67A 3KDPB 4PD4H 3TGUG 3RL0B 2CPBA 5A7VA 1PPJG 2ADDA 3H1IJ 1JTHB 5AVUB 3NXSA 4D6TD 3L36A 1JNMA 1SQXK 5AW8B 1PGOA 1SQQG 3ITKA 1SQVK 1NU1D 2W90A 1T2KD 1K05A 3H1KD 2WQYC 5BU8B 1D7MA 3KZIE 2QM7A 1LTGC 3P8CE 1LT9C 1OXZA 3LIDA 4L76A 1N8RQ 5L8RJ 1Y9MA 2AXTH 2WWWA 1ZR4A 2BEZF 4U3FD 4UDIA 1BDDA 3CMEP 1MFZA 4N3YB 3BASA 1HVVA 1GW3A 2KNCA 4GT1A 3H1HE 4TLFA 5AW1B 2IFNA 1EQ7A 2JKVA 1U57A 3L71J 2PAJA 2X8TA 3WMZA 1N7SA 2H89C 3CU9A 2N9YB 1M1JC 1VQNP 3FX0A 1JY3O 1IFMA 5APVA 1AJYA 4DZOA 4C46A 1BE3E 4DJGA 3BYKA 2ZYDA 2WSSH 2E75C 5KLVD 4M3LA 5C39A 3VSZA 1A02J 3OM4A 1BCCE 3AE2C 1GL2D 2NRGA 3Q5SA 1PFIA 1RE4A 3SFEC 1J1EB 3LEMA 5FLWA 1VQ7P 1SQBE 2GA1A 1OFCX 1FDOA 3R4ZA 1HUCA 2Q3IA 2X8SA 1KTMA 2FYUG 3Q3DA 3VTPC 3H1IE 3G3ZA 1URQD 1LWUB 4TT3H 3CLQA 3H1JJ 1KILB 5AVVB 3RGUA 1ST8A 3D70A 4I6MC 4ASWA 2QM8A 3GG2A 5CBOA 3WN1A 3B5NA 1KYOE 1YJNP 4ONZA 3AE7C 4U6DA 2PFXA 3L72G 1WMKA 2E5YA 1E79H 3AEEC 3BYNA 4C7RA 2R5DA 4UDJA 2WSFH 2ZYAA 3JCUH 4PD4E 2WT7A 5AYDA 1OWAA 2ZXEB 3D71A 3S9OA 5B5EH 3NFQA 4QQSA 3PHLA 1FDIA 1SQBK 3O6QA 3RL0C 1QGKB 2N1TA 2YMYA 2B89A 3S4RA 3H6PA 2JWAA 4PV1D 1SQXG 2XQRA 1T3JA 3MGNA 1SQVG 1DEBA
chains in the Genus database with same CATH topology
5GLRA 3AKHA 4KMIA 2X8FA 3BYLA 2E76D 1DD4A 2D2CD 4OGQD 4KC7A 3Q5PA 2YIUC 4AK7A 1S1CX 2OQQA 1VKDA 3UGGA 2QJPC 3WN2A 4I7ZB 1GMJA 2WSFJ 5B6TA 3LIGA 3GMAA 1PIXA 4R4MA 1KQFB 4N2ZA 5FKCA 3C2UA 1OMIA 3UGHA 3AE6C 3R4YA 2AC1A 3PIJA 4XFJA 1K04A 3AE1C 3AE8C 1Y9GA 3LF7A 2QSIA 1DIPA 3WASA 5ANNA 3QEFA 3T97B 1GYHA 5GLNA 3VSSA 2O01J 4N2RA 2H88C 5FMBA 4I7ZC 1UYPA 4O8PA 3RL0g 3WAUA 1YQ4C 3WPUA 2QIWA 3QEEA 2EXKA 2ZT9B 2FBWC 2AEYA 4R4LA 3G9RA 4KCAA 4Y28J 1ZMEC 3D6ZA 3Q2YA 1W2TA 1EXJA 2WSCJ 1JB0J 5A8DA 3Q5RA 3AE3C 1HF9A 2YFSA 3LDKA 2MKVA 3VT0A 5A8CA 3LW5J 3C7OA 2E74C 3C7EA 1NGMB 2JO1A 4PVAA 3ABVC 5AYCA 3BYJA 2B4WA 4H13B 1PT2A 1OW8A 2ZT9C 1S5LX 5A7VB 3B71A 3D5YA 1OW6A 3NQHA 4UDKA 2AEZA 5GLLA 3WPZA 5KLIC 4PV1C 3RK3E 3Q1MA 2ZT9D 1GYDB 1PV3A 2BEQD 2E76C 1UIXA 3C7FA 5AYEA 5GLKA 1PL5A 3P2NA 2QJKC 3AKIA 4Z1MH 3OM6A 1Q90D 3ZXLA 3AE5C 4H13C 1YQ3C 3U14A 2K9YA 4NOVA 3RWKX 3WN0A 3WPYA 3AKGA 4H13D 4IL6X 5M1BA 4KC8A 5C0PA 3IAOA 5GLQA 1RQVA 3AEFC 5FK8A 3VSFA 1YIFA 2OXBA 3SC7X 5JOZA 3ZXJA 2YFRA 3KSTA 3GF3A 2QJYC 1OW7A 3KF3A 4AK5A 4H44B 4FFFA 2J5UA 5JOXA 1KILE 1VF5B 4UDGA 2ADEA 4YTPC 5B6SA 3C8VA 1DD3A 3FGAD 4FFHA 2YMKA 2IDBA 4U7JA 1ZOYC 1IK7A 3H25A 1GYEB 3TAWA 3OM2A 4FFGA 3AE9C 3R67A 2EXIA 5A7VA 4H44D 2ADDA 3VT2A 4O8OA 5GLPA 3ZXKA 4EQVA 3IN6A 1YRZA 4O8NA 1VF5D 3D5ZA 3VT1A 4MLGA 5FKBA 1K05A 2WQYC 3EWKA 1WL7A 4N4BA 2VDTA 2QQVA 3QZ4A 4H0LB 3PIGA 1RQUA 3LDRA 2WPVB 5GLOA 1TU3F 3AEGC 5AY9A 2E75B 5L8RJ 1ZRTE 1Y9MA 2BEZF 3OM7A 1UV4A 4UDIA 2EXJA 3K1UA 2G8YA 2G3AA 5JOWA 3WMYA 4U6BA 4N1IA 3D6YA 3LIHA 5FMDA 1U57A 2X8TA 3WMZA 2FYNC 3LFIA 4D47A 2H89C 2V7QJ 3CU9A 3AEBC 1KQGB 4H0LC 5FK7A 4KT0J 1AJYA 3AEDC 3BYKA 2E75C 3OM5A 3VSZA 3QEDA 5FMCA 4H0LD 3OM4A 2QQUA 3AE2C 1EXIA 4COTA 2E75D 4YXDC 1R8EA 3Q5SA 1VL2A 3SFEC 1Y9BA 3LEMA 1Y7BA 2WSEJ 5FLWA 2P10A 3AECC 2YFTA 2JP3A 1FDOA 3GF7A 3R4ZA 3WATA 2X8SA 3AEAC 1KTMA 2E74B 3C7GA 3Q3DA 2NZ2A 1MKMA 4TT3H 4KCBA 4AK6A 1ST8A 4H44C 3D70A 3AKFA 4PV1B 2QQWA 3WN1A 3AE4C 1Y4WA 1VF5C 3SFDC 2FXPA 3LV4A 1NYHA 4ONZA 4UDKE 3AE7C 4U6DA 2E76B 1OYGA 1KMIZ 2D2CB 3U75A 4OGQB 1WMKA 5GLMA 3AEEC 1W18A 4GDOA 5KKZC 3BYNA 3WPVA 3D60A 4UDJA 1ZP0C 3D61A 5AYDA 2E74D 3D71A 1HJ0A 4FFIA 3S9OA 3QC2A 5JOYA 1YI7A 4QQSA 3GLMA 1FDIA 4PVIA 3O6QA 2EXHA 3KF5A 2D2CC 1KORA 4RKUJ 4OGQC 3VSRA 3UGFA 3C7HA 4PV1D 5FIXA 2XQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5Y A;  5GLR A;  3QED A;  3AKH A;  4KMI A;  2X8F A;  3BYL A;  3NQH A;  4UDK A;  5FMC A;  1GYE B;  2AEZ A;  5GLL A;  3OM4 A;  2QQU A;  3WPZ A;  4KC7 A;  4COT A;  4AK7 A;  1GYD B;  1Y7B A;  3LEM A;  3TAW A;  5FLW A;  3OM2 A;  4FFG A;  1VKD A;  3UGG A;  2YFT A;  3R67 A;  3WN2 A;  5B6T A;  3R4Z A;  3C7F A;  3LIG A;  3WAT A;  2EXI A;  2X8S A;  5AYE A;  5GLK A;  3C7G A;  5A7V A;  3P2N A;  1MKM A;  3AKI A;  3OM6 A;  4N2Z A;  2ADD A;  5FKC A;  3ZXL A;  3C2U A;  3VT2 A;  3UGH A;  4O8O A;  5GLP A;  3ZXK A;  3U14 A;  4EQV A;  1YRZ A;  4O8N A;  3R4Y A;  2AC1 A;  3PIJ A;  4NOV A;  3D5Z A;  4KCB A;  3VT1 A;  4AK6 A;  3RWK X;  1ST8 A;  3WN0 A;  3WPY A;  3AKG A;  4MLG A;  5FKB A;  3AKF A;  1Y9G A;  3LF7 A;  2QQW A;  3WN1 A;  3WAS A;  5ANN A;  3QEF A;  1Y4W A;  4KC8 A;  1WL7 A;  4N4B A;  5C0P A;  3LV4 A;  1GYH A;  2VDT A;  4ONZ A;  4UDK E;  5GLQ A;  5GLN A;  3VSS A;  4U6D A;  2QQV A;  4N2R A;  3QZ4 A;  5FK8 A;  1OYG A;  3VSF A;  1YIF A;  2OXB A;  3PIG A;  1UYP A;  3LDR A;  4O8P A;  5FMB A;  3SC7 X;  3U75 A;  3WAU A;  5GLO A;  5GLM A;  5JOZ A;  5AY9 A;  3WPU A;  1W18 A;  3ZXJ A;  1Y9M A;  3QEE A;  2EXK A;  3BYN A;  2AEY A;  3OM7 A;  3WPV A;  3D60 A;  4UDJ A;  1UV4 A;  4UDI A;  4KCA A;  2YFR A;  3D61 A;  3KST A;  1W2T A;  2EXJ A;  3K1U A;  5AYD A;  3KF3 A;  4AK5 A;  5A8D A;  5JOW A;  4FFF A;  3WMY A;  4U6B A;  4N1I A;  4FFI A;  3LIH A;  5JOX A;  3QC2 A;  2YFS A;  5FMD A;  5JOY A;  3LDK A;  2X8T A;  3VT0 A;  1YI7 A;  4QQS A;  3WMZ A;  3LFI A;  5A8C A;  4D47 A;  4UDG A;  3C7O A;  4PVI A;  2EXH A;  3C7E A;  3CU9 A;  2ADE A;  5B6S A;  4PVA A;  5AYC A;  3KF5 A;  5FK7 A;  3BYJ A;  2B4W A;  4FFH A;  3VSR A;  3UGF A;  3C7H A;  3BYK A;  1PT2 A;  5FIX A;  2XQR A;  3OM5 A;  5A7V B;  3VSZ A; 
#chains in the Genus database with same CATH topology
 2X8F A;  2E76 D;  5K5G B;  4OGQ D;  3Q5P A;  1NTM J;  4BWN A;  1S1C X;  2AXT E;  2WPS A;  3WN2 A;  1GMJ A;  2WSF J;  4OH8 B;  2OGU A;  3L73 D;  1JM0 A;  4K3A A;  3G6E P;  2BAS A;  2OYH C;  2DW3 A;  1VQP P;  1JY3 N;  3CWB D;  1NTK E;  1VQM P;  4N2Z A;  5TIS H;  3PP5 A;  1YTZ T;  1L4A D;  3HUS A;  3L75 E;  2K9J B;  1QVG O;  3HE4 A;  2CPS A;  3AE6 C;  3PIJ A;  3H1J E;  3M06 A;  3L74 G;  1JY2 P;  3E7K A;  1EDJ A;  3CMA P;  3LF7 A;  1XTC C;  3TNU A;  3B4S A;  3V2N A;  5KAI H;  2W8Z A;  3T97 B;  4ZNC A;  2E43 A;  2PRR A;  4I7Z C;  1YIJ P;  1S5L H;  1LTT C;  2QIW A;  2IYP A;  2ZT9 B;  3USS A;  2XKM A;  4WB4 A;  2JWD A;  2KSE A;  1ZRT D;  4WY4 B;  1PP9 G;  4W7Y A;  2H43 A;  4EYY Q;  4OWF A;  1EXJ A;  3CCR P;  1JB0 J;  3TGU D;  2OTK E;  5A8D A;  1J1E C;  5CCG C;  2YFS A;  1QLE D;  4B86 A;  1T8Z A;  2MKV A;  3CCU P;  3C7O A;  4PVA A;  1R5S A;  1L0L J;  2Q6Q A;  5AW5 B;  1NTK K;  1PT2 A;  1S5L X;  4Y99 C;  1KIL C;  1QX8 A;  1PGJ A;  3H1H G;  1P84 D;  3WPZ A;  4KHX A;  2B88 A;  1NTM E;  2NPS A;  3KYQ A;  1GYD B;  1LTB C;  2KIK A;  1FOS E;  1BSH A;  1S3J A;  3KHU A;  3JCU E;  3C7F A;  1BE3 G;  1IJD B;  1PL5 A;  1M1J A;  3P2N A;  4Z1M H;  3CXH D;  1HH0 A;  5B5E E;  2L5G B;  4WBA A;  1CSB A;  1LGH B;  2K9Y A;  2CK3 H;  5AVY B;  1FJP A;  3WN0 A;  2BCC J;  4IFD K;  1VPC A;  4H13 D;  5KJ7 C;  4IL6 X;  1HJB A;  3PRJ A;  2Q3E A;  1LJ2 A;  1N86 A;  4ZKU A;  3L72 J;  3H1I G;  3ZXJ A;  4O9B A;  3SWK A;  1E5W A;  3BCC D;  3MZW B;  1NWQ A;  1NTZ J;  1MUU A;  3O8Z A;  3FXE A;  1OW7 A;  3KF3 A;  4AK5 A;  3M91 A;  4H44 B;  3VMA A;  1EC5 A;  5TIS E;  1NTM K;  2W27 A;  5JOX A;  3M0A A;  3EFF K;  4JF7 A;  2P1J A;  4UDG A;  4C7N A;  1R5L A;  1L0L E;  2W6A A;  3FGA D;  2Y0D A;  3HTK B;  3V2Q A;  2YO3 A;  1FE6 A;  5KAI E;  1BGY J;  2WVR A;  1SQP J;  5APU A;  5AVZ B;  1LTJ B;  2KZI A;  3UIA A;  1M7L A;  2RMZ A;  1HTL C;  1S5L E;  3N7N A;  2OYO A;  3L71 G;  2P7J A;  1FZE A;  2XU6 A;  3G4S P;  3IR9 A;  1KV4 A;  5KTB A;  1M90 Q;  2POH A;  1JTH A;  1NOH A;  4WY4 C;  1T2K C;  3WUU A;  1U7M A;  1GU4 A;  3HD7 D;  1VF5 D;  3D5Z A;  4HYT B;  2KS1 B;  2BCC E;  2YO2 A;  2WPR A;  2M3B A;  3KXD A;  3F5H A;  3CL3 D;  2C9L Y;  1YJ9 P;  2ZVO B;  3QZ4 A;  3L72 E;  2WPV B;  4GOE A;  2E75 B;  1L0L K;  2HOD B;  2WSE H;  3OM7 A;  2HYN A;  3H1J G;  1FC2 C;  1FZC A;  4N6J A;  3HE5 B;  1FDM A;  3W68 A;  3RK2 D;  3EQ2 A;  1KQS O;  3LFI A;  2R3C A;  1ZLL A;  4AQR D;  1VQK P;  2LR2 A;  1KQG B;  5FK7 A;  1GL2 C;  2Y0E A;  4OVN F;  2ZYG A;  1MZ9 A;  2Y9Y A;  5AVQ B;  3NTN A;  1IZN B;  2FYZ A;  1L0N J;  4HJG H;  2GUS A;  1Y47 A;  5CCH D;  4H0L D;  3HD7 A;  1LNQ A;  2QQU A;  4UB6 H;  3CCE P;  2KLU A;  4YXD C;  3L70 J;  1EZV I;  1VL2 A;  4YXW H;  2WSE J;  2QA4 P;  1LTI C;  2JP3 A;  1OVR A;  3M0D C;  2HPC B;  2B9B A;  4D6T J;  3C7G A;  1Q7Y Q;  4XE5 B;  5CJ4 A;  4N78 D;  1LWU A;  1SP4 A;  1KIL A;  1GK4 A;  1N7S D;  2XV5 A;  4KCB A;  2E42 A;  1NTM G;  4H44 C;  3CCQ P;  2QQW A;  2Z5H A;  3HRN A;  3AE4 C;  3ZDM A;  3LV4 A;  2R5B A;  3PJS K;  4JQ0 D;  1FU1 A;  3PLN A;  3TK1 A;  1FJK A;  3U75 A;  4U3F J;  3FWL A;  4GDO A;  3WU2 H;  1NAY A;  2QJK B;  1LTJ C;  1JCC A;  3WPV A;  3D60 A;  3E1R A;  1PP9 E;  1ZP0 C;  2E74 D;  2IX7 C;  2M8R A;  1JO5 A;  1HJ0 A;  1H88 A;  5CCH A;  1N73 B;  1G1I A;  1YI7 A;  4BRY B;  1JCD A;  1BDC A;  2OYH B;  1BCC D;  1K9M Q;  1QVF O;  1W2B O;  5KLV J;  4YPC A;  1IFJ A;  1KOR A;  4OGQ C;  2A06 D;  1G2C B;  1YIT P;  5FIX A;  2QVA A;  1SQB D;  3B5N D;  1L0N E;  5CBN A;  1SFC B;  2D2C D;  4KC7 A;  3MUD C;  2YIU C;  3L70 E;  2OQQ A;  4ZKP A;  1VKD A;  4I7Z B;  1MV8 A;  1L0L G;  3C9I A;  3E1I A;  3LIG A;  3K5B A;  3GMA A;  1PIX A;  4D6T E;  1RE3 A;  3U1C A;  4DT0 A;  1KYO D;  1Q2N A;  1OMI A;  2K9J A;  1NJI Q;  3R4Y A;  4CPG A;  1K04 A;  3H1L D;  3L4F A;  5B66 H;  2N1T D;  1FS0 E;  2C0X A;  3T97 A;  3QEF A;  5GLN A;  1N2D C;  2H88 C;  2M5A B;  3RL0 g;  3WAU A;  1YQ4 C;  4U3F E;  4UB6 E;  2EXK A;  2Q7C A;  2AEY A;  4Y99 B;  4WY4 A;  2YXR B;  3G9R A;  5CMZ A;  4AUW A;  2Q5U A;  4KCA A;  1L0N K;  1W2T A;  2BCC G;  1KN7 A;  2WSC J;  2H8P D;  3Q5R A;  3FWN A;  1HF9 A;  5TJH A;  3VT0 A;  1JY3 P;  1GDT A;  1NGM B;  4UB8 H;  5AYC A;  5KLV E;  4JPZ B;  2B4W A;  1OW8 A;  3V2R A;  1EZV E;  1NTZ G;  2LXC B;  5A7V B;  3D5Y A;  1OW6 A;  1NAF A;  2OYI C;  1NTK D;  5GLL A;  5AW4 B;  3L71 E;  3Q1M A;  3L75 D;  4DCK A;  3WU2 E;  2MJZ A;  2J59 M;  3L73 J;  1P84 I;  4NPF X;  2BEQ D;  3CWB J;  2FYN B;  2UWJ E;  5AYE A;  2O01 N;  2QJK C;  3AKI A;  1Q90 D;  1BGY G;  1SQP G;  1AV1 A;  3AE5 C;  4H13 C;  1J1D C;  3CPW O;  1KB9 D;  3U14 A;  1IK9 A;  3OA7 A;  4NOV A;  1KFN A;  3RK3 B;  2IBZ D;  3CXH I;  3FXD A;  3CCS P;  2W6J H;  2IZ0 A;  1N73 C;  2IYO A;  1P84 H;  1IO4 A;  1LP1 B;  2KNC B;  1VQ8 P;  5BU5 A;  2OXB A;  1RF0 A;  2ZJS E;  1HGV A;  2XND H;  5KLV K;  1M8O B;  2NPS D;  3PTZ A;  2AEM A;  2I8D A;  2ZAE B;  2YFR A;  1FZB A;  1SFC C;  3KST A;  3GF3 A;  2FFD A;  5KAF H;  1EDI A;  1USD A;  2L91 A;  5APT A;  2Y0C A;  1S9K D;  1GD2 E;  2I1K A;  2ADE A;  5B6S A;  1DD3 A;  5B66 E;  3HTK A;  3MHV A;  5KKZ B;  2IDB A;  1A02 F;  1IFD A;  1VQO P;  1PPJ D;  1ZOY C;  3BVH A;  1GYE B;  1WT6 A;  2J58 A;  2KOG A;  1T6A A;  1VQ5 P;  1K73 Q;  1SQQ D;  3L73 E;  1LT9 A;  3TAW A;  4IOI H;  3OM2 A;  1JMB A;  3VN0 A;  1QL1 A;  3JSV C;  4HH2 A;  1KFM A;  4IL6 H;  1L0N G;  4O8O A;  5GLP A;  3ZXK A;  4EQV A;  3IN6 A;  1AA0 A;  3VT1 A;  2KS1 A;  4UB8 E;  3L70 G;  4MLG A;  2GUV A;  5FKB A;  5CJ0 A;  4GIF A;  3R2P A;  3VMY A;  2LXB A;  1WL7 A;  4N4B A;  1K8A Q;  4BXL A;  2QQV A;  4D6T G;  2B87 B;  3PIG A;  1RQU A;  3LDR A;  3BCC J;  1TU3 F;  3P32 A;  3AEG C;  1GL2 B;  1ZRT E;  2HOD A;  5AW6 B;  3KPE A;  3P7K A;  1NU1 G;  1WRG A;  3RK2 C;  3H1K G;  1YTZ I;  3K1U A;  2G8Y A;  4RJT A;  3HE5 A;  3RL0 D;  2G3A A;  5JOW A;  1JMM A;  1URQ B;  3D6Y A;  1SLQ A;  3S1K A;  2FKW B;  2W6B A;  2FYN C;  2W83 C;  2V7Q J;  4U3F G;  2ITA A;  3QH9 A;  3CX5 D;  2JR8 A;  4H0L C;  2WZ7 A;  4KT0 J;  3CCL P;  1X8Y A;  3OM5 A;  5GTI E;  1P84 E;  3RK3 C;  1RH5 B;  2FYU D;  3SWY A;  3QED A;  1OIP A;  5AW3 B;  2KXP B;  1EXI A;  3II6 A;  4COT A;  3TSI A;  1FOS F;  4I1L A;  1Y7B A;  5AVX B;  2P10 A;  4PJ0 H;  2YFT A;  2BCC D;  3GF7 A;  5KLV G;  1FZG A;  2HPC A;  3WAT A;  1N7S C;  3AEA C;  5KAF E;  3A0H H;  1EZV G;  3A0B H;  2P2U A;  1YHQ P;  5AVW B;  3L72 D;  4GOF A;  1GK6 A;  1DH3 A;  4AK6 A;  2HR3 A;  2Y9Z A;  2KP8 A;  2IFM A;  1CI6 B;  4LC1 A;  1PGP A;  5KLI B;  1AVO A;  4PV1 B;  2VRS A;  3JC2 2;  1Y4W A;  3SFD C;  2FXP A;  1NYH A;  4UDK E;  1RE4 C;  2XDJ A;  2E76 B;  1OYG A;  1KMI Z;  4OGQ B;  5AW0 B;  5GLM A;  3BCC E;  1W18 A;  5E79 H;  1JUN A;  5KKZ C;  1LT1 A;  3U59 A;  3U1A A;  5CCG D;  4WWI A;  1SQX D;  2YIU B;  2N9B A;  1SQV D;  3MD0 A;  1L4A B;  4IL6 E;  1N73 A;  3QC2 A;  1FZA A;  2YXQ B;  3SWF A;  1GZL A;  4BRY A;  3GHG B;  3GLM A;  2OYH A;  1DX7 A;  2FY8 A;  2EXH A;  2K37 A;  1KIL D;  2XNX A;  4ASV A;  1FBM A;  2D2C C;  1G2C A;  4RKU J;  3UGF A;  3C7H A;  1NTZ E;  1RF1 B;  1EDK A;  2OTJ P;  1H0T B;  5GLR A;  3AKH A;  3BYL A;  3MTU E;  2SPZ A;  1M56 D;  5AW2 B;  2Z5I A;  4AK7 A;  1NHL A;  2KYV A;  3L74 D;  4LLH A;  5BVZ A;  2QJP C;  5AVR B;  3WMM 0;  1H89 A;  5APX A;  1AFO A;  1OVV A;  1BGY E;  1PGQ A;  1SQP E;  1KQF B;  1DEE G;  2RKL A;  5FKC A;  4QMA A;  3UGH A;  5KJ7 D;  2RH0 A;  3M9B A;  1KYO I;  1S2E A;  2A45 I;  3F89 A;  4ZMD A;  5CCG A;  1URQ C;  3L73 G;  1Y9G A;  1DIP A;  4W80 A;  2IPP A;  2QG4 A;  1PP9 D;  3CI9 A;  3CWB G;  1GYH A;  2V4H A;  1KQL A;  5FMB A;  4IFF A;  1UYP A;  4O8P A;  3P8C D;  2C0W A;  1NU1 J;  1NTZ K;  3SSU A;  3H1K J;  2ZXX A;  4R4L A;  2OYI B;  4PJ0 E;  3HUS C;  1ZME C;  4EOT A;  3A0H E;  3MP7 B;  3A0B E;  3AE3 C;  1JOC A;  1BCC J;  3H1H D;  5A8C A;  2KI7 B;  4EI2 A;  3C7E A;  2JDI H;  2JO1 A;  3ABV C;  1SQB J;  4H13 B;  1SQP K;  1J1D B;  2KLV A;  2R44 A;  2FXO A;  1BE3 D;  3B71 A;  1X0T A;  3VMZ A;  2RN0 A;  4JYB A;  1MFT A;  3NQH A;  1Q82 Q;  5KJ7 A;  3W67 A;  5KLI C;  4PV1 C;  3RK3 E;  4W7Z A;  1ZW0 A;  4DOJ A;  5E79 E;  1YI2 P;  2ZT9 D;  1PV3 A;  4WY4 D;  2KUB A;  2E76 C;  2QE7 H;  1IFP A;  2LKM A;  4N78 E;  1LTA C;  2P58 A;  1CZQ A;  3H1L J;  2K88 A;  3I56 P;  4JBZ A;  3H1I D;  3AKG A;  1KB9 I;  1L4A C;  2OAR A;  3L37 A;  1USE A;  3GHG C;  1FZC B;  1ZV8 A;  1LP1 A;  4I2L C;  2IBZ I;  4KC8 A;  2I1J A;  2WSC H;  3CCM P;  1RQV A;  2NPS C;  3AEF C;  1AQT A;  5FK8 A;  3VSF A;  1YIF A;  4AYC A;  1RF1 C;  3N4X A;  2FXM A;  1NU1 E;  1VDF A;  3P8M C;  1ZN5 A;  3H1K E;  3BRT B;  3TF5 A;  1OX3 A;  3CD6 P;  1X22 A;  2QJY C;  1KB9 H;  1EZV D;  4FFF A;  4PD4 D;  1S72 P;  3HD7 B;  4NPD A;  3KQG A;  1VF5 B;  3BCC G;  2A06 E;  4YTP C;  3L71 D;  3C8V A;  4FFH A;  2YMK A;  3GW6 A;  1NTK J;  4U7J A;  1IK7 A;  3L75 J;  3LIE A;  1YJW P;  4A7P A;  2YKQ A;  2C9N Y;  5C2M A;  3H32 B;  1GU5 A;  1YYC A;  2QRX A;  4FFG A;  1W5C E;  3AE9 C;  2O1K A;  2EXI A;  4XA4 A;  4H44 D;  5EFW B;  1Q81 Q;  3VT2 A;  3RK2 B;  1NO4 A;  1NU1 K;  3H1L E;  3V2P A;  5GTH H;  1YRZ A;  4O8N A;  3A3Y B;  1AQ5 A;  1JEK A;  4LGD E;  4L75 A;  2P67 A;  3TDK A;  3I5C A;  3H1J D;  2WTY A;  1JY2 O;  1Y8A A;  3EWK A;  4WVZ A;  3V4W A;  5H2F H;  2VDT A;  3NMD A;  2YKP A;  3RBX A;  2B87 A;  4H0L B;  1GL2 A;  5GLO A;  5AY9 A;  1NKN A;  1W2E A;  2PGD A;  2JEE A;  1UV4 A;  3G71 P;  1SS1 A;  2HLO A;  1IFN A;  2EXJ A;  5GTI H;  1KC8 Q;  3M9Q A;  1URQ A;  3WMY A;  4U6B A;  2PP6 A;  1VQL P;  4N1I A;  1U7J A;  3LIH A;  5FMD A;  3M0D A;  4D47 A;  1N7S B;  1XTG B;  2H7H A;  3AEB C;  2KZJ A;  3QWO C;  2O3J A;  4JYC A;  3AED C;  3TGU J;  2GM4 A;  2ZVN B;  3CXH H;  3CX5 I;  1HBW A;  5FMC A;  1SQQ J;  1FZC C;  2E75 D;  1R8E A;  3A5T A;  1G1J A;  1Y9B A;  1NTM D;  3AEC C;  5APY A;  1CW5 A;  3VMX A;  4GKG A;  2E74 B;  3CCJ P;  1EDL A;  3VOP A;  4IFM A;  1LTJ A;  1QL2 A;  3M9H A;  1MKM A;  2NZ2 A;  3VP8 A;  1KB9 E;  4EDF A;  2AEJ A;  2IBZ E;  3CX5 H;  2KSJ A;  1KD1 Q;  1X9V A;  1CI6 A;  3WUT A;  2Q9I A;  3AKF A;  3HD7 C;  3CWB E;  3B5N B;  1VF5 C;  3C1L A;  5APS A;  2KB7 P;  1J2J B;  2D2C B;  2V7Q H;  3IF4 A;  2WIT A;  3PH0 A;  2WPQ A;  3D61 A;  2K3R A;  1LWU C;  3MUD A;  1AVY A;  4RO0 A;  2WT7 B;  1H8A A;  1S9K E;  2AXC A;  1RHZ B;  1L4A A;  4FFI A;  1JY2 N;  2R32 A;  1VQ9 P;  1NH4 A;  2QJP B;  3GHG A;  5JOY A;  1ZXG A;  1QEX A;  3OAK A;  5GTH E;  1GW4 A;  4L74 A;  1HGZ A;  2HFE D;  4PVI A;  3O6Q B;  2XZR A;  2N1T B;  3KF5 A;  1RY3 A;  1VQ4 P;  5AVT B;  1RF1 A;  3VSR A;  1S4X A;  3TGU E;  2FYU J;  1PPJ E;  1KZU B;  1L0L D;  1N7L A;  1H0T A;  1Z56 A;  5H2F E;  2O01 H;  3V5B A;  3V4Q A;  4KMI A;  1DD4 A;  1SQQ E;  1BCC G;  2KK7 A;  3MIW A;  3IFM A;  2A06 G;  3UGG A;  2JJL A;  5CCH C;  5B6T A;  1SQB G;  2AEF A;  4R4M A;  4GOD A;  3C2U A;  3HUS B;  3LW5 H;  2AC1 A;  3HE4 B;  4XFJ A;  3AE1 C;  3AE8 C;  4HB1 A;  3OW2 O;  2QSI A;  3WAS A;  2O1J A;  2FFD B;  5ANN A;  3TNU B;  2A45 G;  3CXH E;  3VSS A;  2O01 J;  4N2R A;  1PZQ A;  1ZR2 A;  1SFC D;  3WPU A;  3H1L G;  3QEE A;  1UII A;  2FBW C;  1HWT C;  1RE3 C;  3EFG A;  2OYI A;  1SQX J;  3OJA B;  5AVS B;  4Y28 J;  3D6Z A;  3Q2Y A;  4K35 A;  1SQV J;  1NTZ D;  3L35 A;  1SQQ K;  1M1K Q;  1IC2 A;  1OVU A;  1LTS C;  3I55 P;  3LDK A;  4L73 A;  3CX5 E;  3LW5 J;  3BRV B;  2E74 C;  2OTL P;  2M3E A;  1LT9 B;  3A2A A;  1NKZ B;  3BYJ A;  2FYU E;  2Q1K A;  1GTW A;  1T3U A;  2ZT9 C;  3KZI H;  3VP9 A;  5DJT B;  4UDK A;  1BGY D;  1SQP D;  2AEZ A;  2QEX P;  3L74 J;  2M0B A;  3VYI A;  3B5N C;  2WMM A;  2Z4E A;  2NPS B;  1UIX A;  3CC2 P;  5GLK A;  3OM6 A;  1M1J B;  1NTK G;  2YNY A;  3ZXL A;  3CC4 P;  1SFC A;  1YQ3 C;  5AW7 B;  3L75 G;  2QJY B;  3TYY A;  1TL2 A;  3RWK X;  3WPY A;  1PP9 J;  3B8E B;  2YKO A;  3CC7 P;  2ZFC A;  2IZ1 A;  1Q86 Q;  5M1B A;  1VQ6 P;  5C0P A;  3IAO A;  5GLQ A;  3BAT A;  1M57 D;  3CCV P;  4NPE A;  2N1T C;  1OZH A;  3SC7 X;  5JOZ A;  5CHX A;  4RES B;  2IBZ G;  2FYU K;  5AW9 B;  1SQX E;  1X79 B;  1SQV E;  3RBZ A;  3WUV A;  3H1H J;  1FZF A;  1FAV A;  1IFI A;  2J5U A;  3A7O A;  5APW A;  2M5A A;  1KIL E;  2HG5 D;  1SVF A;  2K1A A;  4PD4 I;  3RK3 D;  4HKZ H;  4KJM A;  1NVO A;  4C7N B;  1BE3 J;  1RF0 C;  1KYO H;  2A45 H;  2E5T A;  4EIJ A;  1L2P A;  1YBK A;  3H25 A;  1L0N D;  4MN4 C;  5DJU B;  1BSN A;  3L74 E;  2FFD C;  2R3S A;  5APQ A;  3H32 A;  3V6I A;  3L70 D;  3R67 A;  3KDP B;  4PD4 H;  3TGU G;  3RL0 B;  2CPB A;  5A7V A;  1PPJ G;  2ADD A;  3H1I J;  1JTH B;  5AVU B;  3NXS A;  4D6T D;  3L36 A;  1JNM A;  1SQX K;  5AW8 B;  1PGO A;  1SQQ G;  3ITK A;  1SQV K;  1NU1 D;  2W90 A;  1T2K D;  1K05 A;  3H1K D;  2WQY C;  5BU8 B;  1D7M A;  3KZI E;  2QM7 A;  1LTG C;  3P8C E;  1LT9 C;  1OXZ A;  3LID A;  4L76 A;  1N8R Q;  5L8R J;  1Y9M A;  2AXT H;  2WWW A;  1ZR4 A;  2BEZ F;  4U3F D;  4UDI A;  1BDD A;  3CME P;  1MFZ A;  4N3Y B;  3BAS A;  1HVV A;  1GW3 A;  2KNC A;  4GT1 A;  3H1H E;  4TLF A;  5AW1 B;  2IFN A;  1EQ7 A;  2JKV A;  1U57 A;  3L71 J;  2PAJ A;  2X8T A;  3WMZ A;  1N7S A;  2H89 C;  3CU9 A;  2N9Y B;  1M1J C;  1VQN P;  3FX0 A;  1JY3 O;  1IFM A;  5APV A;  1AJY A;  4DZO A;  4C46 A;  1BE3 E;  4DJG A;  3BYK A;  2ZYD A;  2WSS H;  2E75 C;  5KLV D;  4M3L A;  5C39 A;  3VSZ A;  1A02 J;  3OM4 A;  1BCC E;  3AE2 C;  1GL2 D;  2NRG A;  3Q5S A;  1PFI A;  1RE4 A;  3SFE C;  1J1E B;  3LEM A;  5FLW A;  1VQ7 P;  1SQB E;  2GA1 A;  1OFC X;  1FDO A;  3R4Z A;  1HUC A;  2Q3I A;  2X8S A;  1KTM A;  2FYU G;  3Q3D A;  3VTP C;  3H1I E;  3G3Z A;  1URQ D;  1LWU B;  4TT3 H;  3CLQ A;  3H1J J;  1KIL B;  5AVV B;  3RGU A;  1ST8 A;  3D70 A;  4I6M C;  4ASW A;  2QM8 A;  3GG2 A;  5CBO A;  3WN1 A;  3B5N A;  1KYO E;  1YJN P;  4ONZ A;  3AE7 C;  4U6D A;  2PFX A;  3L72 G;  1WMK A;  2E5Y A;  1E79 H;  3AEE C;  3BYN A;  4C7R A;  2R5D A;  4UDJ A;  2WSF H;  2ZYA A;  3JCU H;  4PD4 E;  2WT7 A;  5AYD A;  1OWA A;  2ZXE B;  3D71 A;  3S9O A;  5B5E H;  3NFQ A;  4QQS A;  3PHL A;  1FDI A;  1SQB K;  3O6Q A;  3RL0 C;  1QGK B;  2N1T A;  2YMY A;  2B89 A;  3S4R A;  3H6P A;  2JWA A;  4PV1 D;  1SQX G;  2XQR A;  1T3J A;  3MGN A;  1SQV G;  1DEB A; 
#chains in the Genus database with same CATH homology
 5GLR A;  3AKH A;  4KMI A;  2X8F A;  3BYL A;  2E76 D;  1DD4 A;  2D2C D;  4OGQ D;  4KC7 A;  3Q5P A;  2YIU C;  4AK7 A;  1S1C X;  2OQQ A;  1VKD A;  3UGG A;  2QJP C;  3WN2 A;  4I7Z B;  1GMJ A;  2WSF J;  5B6T A;  3LIG A;  3GMA A;  1PIX A;  4R4M A;  1KQF B;  4N2Z A;  5FKC A;  3C2U A;  1OMI A;  3UGH A;  3AE6 C;  3R4Y A;  2AC1 A;  3PIJ A;  4XFJ A;  1K04 A;  3AE1 C;  3AE8 C;  1Y9G A;  3LF7 A;  2QSI A;  1DIP A;  3WAS A;  5ANN A;  3QEF A;  3T97 B;  1GYH A;  5GLN A;  3VSS A;  2O01 J;  4N2R A;  2H88 C;  5FMB A;  4I7Z C;  1UYP A;  4O8P A;  3RL0 g;  3WAU A;  1YQ4 C;  3WPU A;  2QIW A;  3QEE A;  2EXK A;  2ZT9 B;  2FBW C;  2AEY A;  4R4L A;  3G9R A;  4KCA A;  4Y28 J;  1ZME C;  3D6Z A;  3Q2Y A;  1W2T A;  1EXJ A;  2WSC J;  1JB0 J;  5A8D A;  3Q5R A;  3AE3 C;  1HF9 A;  2YFS A;  3LDK A;  2MKV A;  3VT0 A;  5A8C A;  3LW5 J;  3C7O A;  2E74 C;  3C7E A;  1NGM B;  2JO1 A;  4PVA A;  3ABV C;  5AYC A;  3BYJ A;  2B4W A;  4H13 B;  1PT2 A;  1OW8 A;  2ZT9 C;  1S5L X;  5A7V B;  3B71 A;  3D5Y A;  1OW6 A;  3NQH A;  4UDK A;  2AEZ A;  5GLL A;  3WPZ A;  5KLI C;  4PV1 C;  3RK3 E;  3Q1M A;  2ZT9 D;  1GYD B;  1PV3 A;  2BEQ D;  2E76 C;  1UIX A;  3C7F A;  5AYE A;  5GLK A;  1PL5 A;  3P2N A;  2QJK C;  3AKI A;  4Z1M H;  3OM6 A;  1Q90 D;  3ZXL A;  3AE5 C;  4H13 C;  1YQ3 C;  3U14 A;  2K9Y A;  4NOV A;  3RWK X;  3WN0 A;  3WPY A;  3AKG A;  4H13 D;  4IL6 X;  5M1B A;  4KC8 A;  5C0P A;  3IAO A;  5GLQ A;  1RQV A;  3AEF C;  5FK8 A;  3VSF A;  1YIF A;  2OXB A;  3SC7 X;  5JOZ A;  3ZXJ A;  2YFR A;  3KST A;  3GF3 A;  2QJY C;  1OW7 A;  3KF3 A;  4AK5 A;  4H44 B;  4FFF A;  2J5U A;  5JOX A;  1KIL E;  1VF5 B;  4UDG A;  2ADE A;  4YTP C;  5B6S A;  3C8V A;  1DD3 A;  3FGA D;  4FFH A;  2YMK A;  2IDB A;  4U7J A;  1ZOY C;  1IK7 A;  3H25 A;  1GYE B;  3TAW A;  3OM2 A;  4FFG A;  3AE9 C;  3R67 A;  2EXI A;  5A7V A;  4H44 D;  2ADD A;  3VT2 A;  4O8O A;  5GLP A;  3ZXK A;  4EQV A;  3IN6 A;  1YRZ A;  4O8N A;  1VF5 D;  3D5Z A;  3VT1 A;  4MLG A;  5FKB A;  1K05 A;  2WQY C;  3EWK A;  1WL7 A;  4N4B A;  2VDT A;  2QQV A;  3QZ4 A;  4H0L B;  3PIG A;  1RQU A;  3LDR A;  2WPV B;  5GLO A;  1TU3 F;  3AEG C;  5AY9 A;  2E75 B;  5L8R J;  1ZRT E;  1Y9M A;  2BEZ F;  3OM7 A;  1UV4 A;  4UDI A;  2EXJ A;  3K1U A;  2G8Y A;  2G3A A;  5JOW A;  3WMY A;  4U6B A;  4N1I A;  3D6Y A;  3LIH A;  5FMD A;  1U57 A;  2X8T A;  3WMZ A;  2FYN C;  3LFI A;  4D47 A;  2H89 C;  2V7Q J;  3CU9 A;  3AEB C;  1KQG B;  4H0L C;  5FK7 A;  4KT0 J;  1AJY A;  3AED C;  3BYK A;  2E75 C;  3OM5 A;  3VSZ A;  3QED A;  5FMC A;  4H0L D;  3OM4 A;  2QQU A;  3AE2 C;  1EXI A;  4COT A;  2E75 D;  4YXD C;  1R8E A;  3Q5S A;  1VL2 A;  3SFE C;  1Y9B A;  3LEM A;  1Y7B A;  2WSE J;  5FLW A;  2P10 A;  3AEC C;  2YFT A;  2JP3 A;  1FDO A;  3GF7 A;  3R4Z A;  3WAT A;  2X8S A;  3AEA C;  1KTM A;  2E74 B;  3C7G A;  3Q3D A;  2NZ2 A;  1MKM A;  4TT3 H;  4KCB A;  4AK6 A;  1ST8 A;  4H44 C;  3D70 A;  3AKF A;  4PV1 B;  2QQW A;  3WN1 A;  3AE4 C;  1Y4W A;  1VF5 C;  3SFD C;  2FXP A;  3LV4 A;  1NYH A;  4ONZ A;  4UDK E;  3AE7 C;  4U6D A;  2E76 B;  1OYG A;  1KMI Z;  2D2C B;  3U75 A;  4OGQ B;  1WMK A;  5GLM A;  3AEE C;  1W18 A;  4GDO A;  5KKZ C;  3BYN A;  3WPV A;  3D60 A;  4UDJ A;  1ZP0 C;  3D61 A;  5AYD A;  2E74 D;  3D71 A;  1HJ0 A;  4FFI A;  3S9O A;  3QC2 A;  5JOY A;  1YI7 A;  4QQS A;  3GLM A;  1FDI A;  4PVI A;  3O6Q A;  2EXH A;  3KF5 A;  2D2C C;  1KOR A;  4RKU J;  4OGQ C;  3VSR A;  3UGF A;  3C7H A;  4PV1 D;  5FIX A;  2XQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...