4U6BA

Zg3597, a family 117 glycoside hydrolase, produced by the marine bacterium zobellia galactanivorans
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
350
structure length
343
Chain Sequence
b'DNELFSQFKYTRLKGFDYNNGDGTISRRDPSRPILVNGKYYIYYTKRDTKVPPIGWNRAKEATDEIPSTDWDLCEIWYATSEDGTTWKEEGVAIARPEKPKPGWRSVATPDILVWKGKYYLYYQAFNEPSGLRGDWCPVSVSYADSPDGPWTHGGDSVIPFGKKGEWDQDATHDPQPIVYKGKIHLYYKAAYNKYAVGHGLAIADDPLGPFEKHPLNPVMTSGHETTYFPFKEGVATLAIKDGNERYTMQYAKDGVNFEIASVVSLAPTAAAPFAADAFTDSGNGRGVTWGLCHFTNASNNPKKGYSIIARFDCDLSLDVDDPFYKNTGVWHRPEVYFAQAPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical lipoprotein
publication title Biochemical and structural investigation of two paralogous glycoside hydrolases from Zobellia galactanivorans: novel insights into the evolution, dimerization plasticity and catalytic mechanism of the GH117 family.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Hydrolase
total genus 73
structure length 343
sequence length 350
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.-:
pdb deposition date 2014-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 4u6bA00
3QC2A 2XQRA 1Y9GA 5GLRA 3D5ZA 1WL7A 5AYDA 3C7HA 2EXJA 4U6DA 1VKDA 5GLQA 4UDJA 5ANNA 2X8TA 5A8DA 3WPZA 3R67A 1YIFA 4UDIA 1GYEB 4FFHA 3ZXKA 1YI7A 5FMCA 5FMBA 3LFIA 1W18A 4MLGA 3UGHA 3AKIA 4O8PA 5FKCA 3LIHA 3C7EA 5AYEA 4NOVA 3BYKA 2ADEA 1ST8A 3BYNA 5GLMA 3VT1A 3AKHA 4PVAA 4COTA 4ONZA 5FK8A 3LDRA 3VT2A 4KMIA 3VSZA 5GLLA 3VT0A 3C2UA 2QQVA 3K1UA 3QEDA 3WN0A 3ZXLA 5A8CA 5B6SA 2AC1A 5JOWA 5A7VA 5FMDA 4AK5A 3WMYA 2QQUA 2QQWA 3PIJA 4FFFA 3WPYA 3CU9A 5FK7A 2EXIA 4U6BA 5GLPA 3D60A 4EQVA 2EXKA 3AKGA 5GLOA 1Y7BA 3QEFA 2X8FA 1UYPA 5AYCA 3QZ4A 3D61A 2AEZA 3LEMA 4KCAA 3AKFA 2ADDA 3U14A 1OYGA 5JOYA 2EXHA 3OM2A 3OM4A 1YRZA 3WATA 4D47A 5C0PA 2YFRA 4AK7A 3C7FA 3NQHA 3KSTA 4N1IA 1Y9MA 2OXBA 3LF7A 5GLKA 3R4ZA 4FFGA 3VSRA 3WMZA 4O8OA 2YFTA 3RWKX 5FKBA 3KF5A 4UDGA 2AEYA 4KCBA 5AY9A 3WAUA 3BYJA 3TAWA 5FLWA 3VSSA 3UGFA 1GYHA 4PVIA 3LV4A 4FFIA 3WN2A 1GYDB 4QQSA 3QEEA 3OM6A 3KF3A 4N4BA 4N2ZA 4O8NA 5A7VB 3LDKA 5JOZA 1Y4WA 3WPUA 1PT2A 1UV4A 5FIXA 5JOXA 3OM7A 2X8SA 4KC8A 4AK6A 4UDKA 3VSFA 2VDTA 3ZXJA 3OM5A 4UDKE 4N2RA 3SC7X 4KC7A 3PIGA 3BYLA 3U75A 3P2NA 3C7GA 5B6TA 1W2TA 2B4WA 3WN1A 2YFSA 5GLNA 3C7OA 3R4YA 3WASA 3LIGA 3WPVA 3UGGA 3D5YA
chains in the Genus database with same CATH superfamily
3QC2A 1TL2A 2XQRA 1Y9GA 5GLRA 3D5ZA 1WL7A 5AYDA 3C7HA 2EXJA 4U6DA 1VKDA 5GLQA 4UDJA 5ANNA 2X8TA 5A8DA 3WPZA 3R67A 1YIFA 4UDIA 1GYEB 4FFHA 3ZXKA 1YI7A 5FMCA 5FMBA 3LFIA 1W18A 4MLGA 3UGHA 3AKIA 4O8PA 5FKCA 3LIHA 3C7EA 5AYEA 4NOVA 3BYKA 2ADEA 1ST8A 3BYNA 5GLMA 3VT1A 3AKHA 4PVAA 4COTA 4ONZA 5FK8A 3LDRA 3VT2A 4KMIA 3VSZA 5GLLA 3VT0A 3C2UA 2QQVA 3K1UA 3QEDA 3WN0A 3ZXLA 5A8CA 5B6SA 2AC1A 5JOWA 5A7VA 5FMDA 4AK5A 3WMYA 2QQUA 2QQWA 3PIJA 4FFFA 3WPYA 3CU9A 5FK7A 2EXIA 4U6BA 5GLPA 3D60A 4EQVA 2EXKA 3AKGA 5GLOA 1Y7BA 3QEFA 2X8FA 1UYPA 5AYCA 3QZ4A 5C2MA 3D61A 2AEZA 3LEMA 4KCAA 3AKFA 2ADDA 3U14A 1OYGA 5JOYA 2EXHA 3OM2A 3OM4A 1YRZA 3WATA 4D47A 5C0PA 2YFRA 4AK7A 3C7FA 3NQHA 3KSTA 4N1IA 1Y9MA 2OXBA 3LF7A 5GLKA 3R4ZA 4FFGA 3VSRA 3WMZA 4O8OA 2YFTA 3RWKX 5FKBA 3KF5A 4UDGA 2AEYA 4KCBA 5AY9A 3WAUA 3BYJA 3TAWA 5FLWA 3VSSA 3UGFA 1GYHA 4PVIA 3LV4A 4FFIA 3WN2A 1GYDB 4QQSA 3QEEA 3OM6A 3KF3A 4N4BA 4N2ZA 4O8NA 5A7VB 3LDKA 5JOZA 1Y4WA 3WPUA 1PT2A 1UV4A 5FIXA 5JOXA 3OM7A 2X8SA 4KC8A 4AK6A 4UDKA 3VSFA 2VDTA 3ZXJA 3OM5A 4UDKE 4N2RA 3SC7X 4KC7A 3PIGA 3BYLA 3U75A 3P2NA 3C7GA 5B6TA 1W2TA 2B4WA 3WN1A 2YFSA 5GLNA 3C7OA 3R4YA 3WASA 3LIGA 3WPVA 3UGGA 3D5YA
chains in the Genus database with same CATH topology
3QC2A 2XQRA 1Y9GA 5GLRA 3D5ZA 1WL7A 5AYDA 3C7HA 2EXJA 4U6DA 1VKDA 5GLQA 4UDJA 5ANNA 2X8TA 5A8DA 3WPZA 3R67A 1YIFA 4UDIA 1GYEB 4FFHA 3ZXKA 1YI7A 5FMCA 5FMBA 3LFIA 1W18A 4MLGA 3UGHA 3AKIA 4O8PA 5FKCA 3LIHA 3C7EA 5AYEA 4NOVA 3BYKA 2ADEA 1ST8A 3BYNA 5GLMA 3VT1A 3AKHA 4PVAA 4COTA 4ONZA 5FK8A 3LDRA 3VT2A 4KMIA 3VSZA 5GLLA 3VT0A 3C2UA 2QQVA 3K1UA 3QEDA 3WN0A 3ZXLA 5A8CA 5B6SA 2AC1A 5JOWA 5A7VA 5FMDA 4AK5A 3WMYA 2QQUA 2QQWA 3PIJA 4FFFA 3WPYA 3CU9A 5FK7A 2EXIA 4U6BA 5GLPA 3D60A 4EQVA 2EXKA 3AKGA 5GLOA 1Y7BA 3QEFA 2X8FA 1UYPA 5AYCA 3QZ4A 3D61A 2AEZA 3LEMA 4KCAA 3AKFA 2ADDA 3U14A 1OYGA 5JOYA 2EXHA 3OM2A 3OM4A 1YRZA 3WATA 4D47A 5C0PA 2YFRA 4AK7A 3C7FA 3NQHA 3KSTA 4N1IA 1Y9MA 2OXBA 3LF7A 5GLKA 3R4ZA 4FFGA 3VSRA 3WMZA 4O8OA 2YFTA 3RWKX 5FKBA 3KF5A 4UDGA 2AEYA 4KCBA 5AY9A 3WAUA 3BYJA 3TAWA 5FLWA 3VSSA 3UGFA 1GYHA 4PVIA 3LV4A 4FFIA 3WN2A 1GYDB 4QQSA 3QEEA 3OM6A 3KF3A 4N4BA 4N2ZA 4O8NA 5A7VB 3LDKA 5JOZA 1Y4WA 3WPUA 1PT2A 1UV4A 5FIXA 5JOXA 3OM7A 2X8SA 4KC8A 4AK6A 4UDKA 3VSFA 2VDTA 3ZXJA 3OM5A 4UDKE 4N2RA 3SC7X 4KC7A 3PIGA 3BYLA 3U75A 3P2NA 3C7GA 5B6TA 1W2TA 2B4WA 3WN1A 2YFSA 5GLNA 3C7OA 3R4YA 3WASA 3LIGA 3WPVA 3UGGA 3D5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QC2 A;  2XQR A;  1Y9G A;  5GLR A;  3D5Z A;  1WL7 A;  5AYD A;  3C7H A;  2EXJ A;  4U6D A;  1VKD A;  5GLQ A;  4UDJ A;  5ANN A;  2X8T A;  5A8D A;  3WPZ A;  3R67 A;  1YIF A;  4UDI A;  1GYE B;  4FFH A;  3ZXK A;  1YI7 A;  5FMC A;  5FMB A;  3LFI A;  1W18 A;  4MLG A;  3UGH A;  3AKI A;  4O8P A;  5FKC A;  3LIH A;  3C7E A;  5AYE A;  4NOV A;  3BYK A;  2ADE A;  1ST8 A;  3BYN A;  5GLM A;  3VT1 A;  3AKH A;  4PVA A;  4COT A;  4ONZ A;  5FK8 A;  3LDR A;  3VT2 A;  4KMI A;  3VSZ A;  5GLL A;  3VT0 A;  3C2U A;  2QQV A;  3K1U A;  3QED A;  3WN0 A;  3ZXL A;  5A8C A;  5B6S A;  2AC1 A;  5JOW A;  5A7V A;  5FMD A;  4AK5 A;  3WMY A;  2QQU A;  2QQW A;  3PIJ A;  4FFF A;  3WPY A;  3CU9 A;  5FK7 A;  2EXI A;  4U6B A;  5GLP A;  3D60 A;  4EQV A;  2EXK A;  3AKG A;  5GLO A;  1Y7B A;  3QEF A;  2X8F A;  1UYP A;  5AYC A;  3QZ4 A;  3D61 A;  2AEZ A;  3LEM A;  4KCA A;  3AKF A;  2ADD A;  3U14 A;  1OYG A;  5JOY A;  2EXH A;  3OM2 A;  3OM4 A;  1YRZ A;  3WAT A;  4D47 A;  5C0P A;  2YFR A;  4AK7 A;  3C7F A;  3NQH A;  3KST A;  4N1I A;  1Y9M A;  2OXB A;  3LF7 A;  5GLK A;  3R4Z A;  4FFG A;  3VSR A;  3WMZ A;  4O8O A;  2YFT A;  3RWK X;  5FKB A;  3KF5 A;  4UDG A;  2AEY A;  4KCB A;  5AY9 A;  3WAU A;  3BYJ A;  3TAW A;  5FLW A;  3VSS A;  3UGF A;  1GYH A;  4PVI A;  3LV4 A;  4FFI A;  3WN2 A;  1GYD B;  4QQS A;  3QEE A;  3OM6 A;  3KF3 A;  4N4B A;  4N2Z A;  4O8N A;  5A7V B;  3LDK A;  5JOZ A;  1Y4W A;  3WPU A;  1PT2 A;  1UV4 A;  5FIX A;  5JOX A;  3OM7 A;  2X8S A;  4KC8 A;  4AK6 A;  4UDK A;  3VSF A;  2VDT A;  3ZXJ A;  3OM5 A;  4UDK E;  4N2R A;  3SC7 X;  4KC7 A;  3PIG A;  3BYL A;  3U75 A;  3P2N A;  3C7G A;  5B6T A;  1W2T A;  2B4W A;  3WN1 A;  2YFS A;  5GLN A;  3C7O A;  3R4Y A;  3WAS A;  3LIG A;  3WPV A;  3UGG A;  3D5Y A; 
#chains in the Genus database with same CATH topology
 3QC2 A;  1TL2 A;  2XQR A;  1Y9G A;  5GLR A;  3D5Z A;  1WL7 A;  5AYD A;  3C7H A;  2EXJ A;  4U6D A;  1VKD A;  5GLQ A;  4UDJ A;  5ANN A;  2X8T A;  5A8D A;  3WPZ A;  3R67 A;  1YIF A;  4UDI A;  1GYE B;  4FFH A;  3ZXK A;  1YI7 A;  5FMC A;  5FMB A;  3LFI A;  1W18 A;  4MLG A;  3UGH A;  3AKI A;  4O8P A;  5FKC A;  3LIH A;  3C7E A;  5AYE A;  4NOV A;  3BYK A;  2ADE A;  1ST8 A;  3BYN A;  5GLM A;  3VT1 A;  3AKH A;  4PVA A;  4COT A;  4ONZ A;  5FK8 A;  3LDR A;  3VT2 A;  4KMI A;  3VSZ A;  5GLL A;  3VT0 A;  3C2U A;  2QQV A;  3K1U A;  3QED A;  3WN0 A;  3ZXL A;  5A8C A;  5B6S A;  2AC1 A;  5JOW A;  5A7V A;  5FMD A;  4AK5 A;  3WMY A;  2QQU A;  2QQW A;  3PIJ A;  4FFF A;  3WPY A;  3CU9 A;  5FK7 A;  2EXI A;  4U6B A;  5GLP A;  3D60 A;  4EQV A;  2EXK A;  3AKG A;  5GLO A;  1Y7B A;  3QEF A;  2X8F A;  1UYP A;  5AYC A;  3QZ4 A;  5C2M A;  3D61 A;  2AEZ A;  3LEM A;  4KCA A;  3AKF A;  2ADD A;  3U14 A;  1OYG A;  5JOY A;  2EXH A;  3OM2 A;  3OM4 A;  1YRZ A;  3WAT A;  4D47 A;  5C0P A;  2YFR A;  4AK7 A;  3C7F A;  3NQH A;  3KST A;  4N1I A;  1Y9M A;  2OXB A;  3LF7 A;  5GLK A;  3R4Z A;  4FFG A;  3VSR A;  3WMZ A;  4O8O A;  2YFT A;  3RWK X;  5FKB A;  3KF5 A;  4UDG A;  2AEY A;  4KCB A;  5AY9 A;  3WAU A;  3BYJ A;  3TAW A;  5FLW A;  3VSS A;  3UGF A;  1GYH A;  4PVI A;  3LV4 A;  4FFI A;  3WN2 A;  1GYD B;  4QQS A;  3QEE A;  3OM6 A;  3KF3 A;  4N4B A;  4N2Z A;  4O8N A;  5A7V B;  3LDK A;  5JOZ A;  1Y4W A;  3WPU A;  1PT2 A;  1UV4 A;  5FIX A;  5JOX A;  3OM7 A;  2X8S A;  4KC8 A;  4AK6 A;  4UDK A;  3VSF A;  2VDT A;  3ZXJ A;  3OM5 A;  4UDK E;  4N2R A;  3SC7 X;  4KC7 A;  3PIG A;  3BYL A;  3U75 A;  3P2N A;  3C7G A;  5B6T A;  1W2T A;  2B4W A;  3WN1 A;  2YFS A;  5GLN A;  3C7O A;  3R4Y A;  3WAS A;  3LIG A;  3WPV A;  3UGG A;  3D5Y A; 
#chains in the Genus database with same CATH homology
 3QC2 A;  2XQR A;  1Y9G A;  5GLR A;  3D5Z A;  1WL7 A;  5AYD A;  3C7H A;  2EXJ A;  4U6D A;  1VKD A;  5GLQ A;  4UDJ A;  5ANN A;  2X8T A;  5A8D A;  3WPZ A;  3R67 A;  1YIF A;  4UDI A;  1GYE B;  4FFH A;  3ZXK A;  1YI7 A;  5FMC A;  5FMB A;  3LFI A;  1W18 A;  4MLG A;  3UGH A;  3AKI A;  4O8P A;  5FKC A;  3LIH A;  3C7E A;  5AYE A;  4NOV A;  3BYK A;  2ADE A;  1ST8 A;  3BYN A;  5GLM A;  3VT1 A;  3AKH A;  4PVA A;  4COT A;  4ONZ A;  5FK8 A;  3LDR A;  3VT2 A;  4KMI A;  3VSZ A;  5GLL A;  3VT0 A;  3C2U A;  2QQV A;  3K1U A;  3QED A;  3WN0 A;  3ZXL A;  5A8C A;  5B6S A;  2AC1 A;  5JOW A;  5A7V A;  5FMD A;  4AK5 A;  3WMY A;  2QQU A;  2QQW A;  3PIJ A;  4FFF A;  3WPY A;  3CU9 A;  5FK7 A;  2EXI A;  4U6B A;  5GLP A;  3D60 A;  4EQV A;  2EXK A;  3AKG A;  5GLO A;  1Y7B A;  3QEF A;  2X8F A;  1UYP A;  5AYC A;  3QZ4 A;  3D61 A;  2AEZ A;  3LEM A;  4KCA A;  3AKF A;  2ADD A;  3U14 A;  1OYG A;  5JOY A;  2EXH A;  3OM2 A;  3OM4 A;  1YRZ A;  3WAT A;  4D47 A;  5C0P A;  2YFR A;  4AK7 A;  3C7F A;  3NQH A;  3KST A;  4N1I A;  1Y9M A;  2OXB A;  3LF7 A;  5GLK A;  3R4Z A;  4FFG A;  3VSR A;  3WMZ A;  4O8O A;  2YFT A;  3RWK X;  5FKB A;  3KF5 A;  4UDG A;  2AEY A;  4KCB A;  5AY9 A;  3WAU A;  3BYJ A;  3TAW A;  5FLW A;  3VSS A;  3UGF A;  1GYH A;  4PVI A;  3LV4 A;  4FFI A;  3WN2 A;  1GYD B;  4QQS A;  3QEE A;  3OM6 A;  3KF3 A;  4N4B A;  4N2Z A;  4O8N A;  5A7V B;  3LDK A;  5JOZ A;  1Y4W A;  3WPU A;  1PT2 A;  1UV4 A;  5FIX A;  5JOX A;  3OM7 A;  2X8S A;  4KC8 A;  4AK6 A;  4UDK A;  3VSF A;  2VDT A;  3ZXJ A;  3OM5 A;  4UDK E;  4N2R A;  3SC7 X;  4KC7 A;  3PIG A;  3BYL A;  3U75 A;  3P2N A;  3C7G A;  5B6T A;  1W2T A;  2B4W A;  3WN1 A;  2YFS A;  5GLN A;  3C7O A;  3R4Y A;  3WAS A;  3LIG A;  3WPV A;  3UGG A;  3D5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...