4FFFA

Crystal structure of levan fructotransferase from arthrobacter ureafaciens
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
479
structure length
479
Chain Sequence
AVYHMTPPSGWLCDPQRPVTTHGAYQLYYLHSDQNNGPGGWDHASTTDGVAFTHHGTVMPLRPDFPVWSGSAVVDTANTAGFGAGAVVALATQPTDGVRKYQEQYLYWSTDGGFTFTALPDPVIVNTDGRAATTPAEIENAEWFRDPKIHWDTARGEWVCVIGRLRYAAFYTSPNLRDWTLRRNFDYPNHALGGIECPDLFEITADDGTRHWVLAASMDAYGIGLPMTYAYWTGTWDGEQFHADDLTPQWLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKYAARDVPTDASDGYNGQNSIVRELRLARQPGGWYTLLSTPVAALTNYVTATTTLPDRTVDGSAVLPWNGRAYEIELDIAWDTATNVGISVGRSPDGTRHTNIGKYGADLYVDRGPSDLAGYSLAPYSRAAAPIDPGARSVHLRILVDTQSVEVFVNAGHTVLSQQVHFAEGDTGISLYTDGGPAHFTGIVVREIGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Levan fructotransferase
publication title Structural and functional basis for substrate specificity and catalysis of levan fructotransferase.
pubmed doi rcsb
source organism Arthrobacter ureafaciens
total genus 121
structure length 479
sequence length 479
chains with identical sequence B, C, D
ec nomenclature ec 4.2.2.16: Levan fructotransferase (DFA-IV-forming).
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4fffA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 4fffA01
3C7OA 3R67A 4U6DA 5JOWA 3D60A 4KC7A 4NOVA 3ZR5A 3LV4A 4KCBA 3VSFA 4UDGA 3AKFA 3WPVA 1UV4A 3U75A 3RWKX 4CCEA 2ADEA 3KSTA 2ADDA 3LDKA 5A7VB 3CU9A 1OYGA 4CCCA 3ZR6A 3AKGA 1YIFA 4UFLA 5FKBA 3BYJA 5AYCA 4N2RA 5GLMA 3VSRA 3LIGA 4JQTA 5B6SA 3LFIA 4N2ZA 4B1LA 3C7FA 4PVIA 4FFIA 3QEFA 4KMIA 3WPYA 4EQVA 3WN2A 5JOXA 1GYDB 5GLOA 5GLKA 3KF3A 1WL7A 1Y9MA 5GLNA 1YRZA 3VSZA 2QQWA 4KC8A 2YFRA 5A8CA 3IMMA 5A7VA 4AK7A 5FLWA 3VSSA 3WMZA 1Y4WA 1YI7A 4FFHA 2X8SA 3D61A 5FK7A 3OM7A 3C7HA 4UDJA 4O8NA 1W18A 3HBKA 3PIJA 3UGFA 3NMBA 3BYKA 5B6TA 2AEZA 3LEMA 2B4WA 5FMDA 4UFMA 5FMBA 4HXCA 4ONZA 1UYPA 3KF5A 3QEDA 5GLRA 3H3LA 5JOYA 2YFSA 2EXHA 3OSDA 3WN1A 4N1IA 2X8FA 4QQSA 3WMYA 3BYNA 2QQUA 4MLGA 4UFJA 3U14A 2VDTA 1GYEB 1Y7BA 3OM2A 3R4ZA 3OM5A 1PT2A 3VT0A 3LIHA 3WATA 3ZXJA 4UFKA 4UDIA 4B1MA 5FK8A 5GLLA 3NQHA 5ANNA 5GLQA 4KCAA 4UFIA 3P2NA 5JOZA 3LF7A 3PIGA 4FFGA 2EXJA 3WPZA 3ZXKA 3C2UA 5AY9A 3VT2A 3AKIA 3ZXLA 3S5QA 4U6BA 5GLPA 3C7GA 3QC2A 1GYHA 5FKCA 3WAUA 4PVAA 5FIXA 2AC1A 5AYDA 5A8DA 3UGHA 4UDKE 2X8TA 3C7EA 3OM6A 3D5YA 2EXKA 2YFTA 3QZ4A 3K1UA 3OM4A 3WASA 4D47A 4AZZA 1W2TA 3AKHA 3UGGA 1Y9GA 4AK5A 4QHZA 2AEYA 3U1XA 4UDKA 5C0PA 4COTA 3D5ZA 1VKDA 3SC7X 3VT1A 2EXIA 3WPUA 5AYEA 2OXBA 5FMCA 2QQVA 4N4BA 4AK6A 3BYLA 3WN0A 4O8OA 1ST8A 2XQRA 4FFFA 4UFHA 4O8PA 3LDRA 3QEEA 3TAWA 4CCDA 3R4YA
chains in the Genus database with same CATH superfamily
1WKYA 2CHHA 1CAXB 1UAIA 2NZ9A 3SLIA 1AR62 5ACA1 1ND2C 4KCBA 1H8TB 1HX6A 3NV2A 3FE5A 5AVAA 4D6QA 4DEQA 1ZZ6A 2VQAA 4WM7A 5FPAA 3ROUA 1ODNA 1YCIA 3KCCA 4DOUA 5GZEA 1D0GA 4K1YA 1ULFA 4XJAA 3ZR6A 2ZMNA 2VH9A 3AMHA 1TEIA 2PHTA 1EP0A 3PUHA 3O0XA 2JDKA 1BBT1 1W06A 2ZEYA 2X5IB 4Q1PA 3VKMA 3BIWE 4XF1A 1GYKA 4QPIA 5JSOA 4LBJA 3H3ZA 4BZ4A 1XNTA 1JZ5A 4HKOA 3ACIA 2QQNA 2VBBA 4P9XA 4DQAA 2PHDA 5CFCA 2R6QA 2VAUA 4OI2A 1UKGA 3VBSB 1ZREA 3EXUA 3IIAA 3DN7A 1NZCA 2R043 2W1QA 4TZDA 2XHKA 2WINB 2VL4A 4IEZA 2IVJA 2NPIA 1E5SA 3N9MA 3GZEA 3K77A 3VBHB 4AI2A 4COVA 4HVQA 4JAAA 3O1UA 3BYKA 4WM8C 3J8F1 2BP6A 1RUH2 1PZ7A 2A73B 4JGYB 3V64A 1PK6B 4Y5SA 2VCMA 2WLPA 5FXXA 1BVVA 2QZ2A 1DYKA 3HQXA 5A6ZA 2GNMA 1ONAA 3OGJA 5GJ6A 1JBCA 4QX8A 3RZJA 2QJVA 2JDUA 3OSDA 2DU0A 2OZJA 3V0AB 4GB31 1UU5A 4R9CA 4Q4X1 4XQWA 4NUBA 4NPMA 4EN6B 4O61A 1PT2A 4B4RA 5F6KA 4H3WA 2CYFA 3MIFA 4OMDA 4Z07A 2A3WA 3RS6A 3UJQA 1PZ8A 3AX4A 4YG0A 1R1ZA 3JCIA 3PTRB 3WG3A 5FO8B 3MLLA 1O59A 5AC93 3B01A 3QZ4A 2D97A 1RJ7A 1JYCA 3AJZA 1GZTA 1VRBA 2BU9A 2P3KA 2WIIB 4LULA 2EXJA 2WO2A 3ZXKA 5JCTA 5FPUA 1YJKA 3I8TA 2DUQA 5CKNA 4ZU4A 2C6SA 3WQ1A 3NNGA 2I2SA 2W95A 1JYXA 3QACA 2HYXA 2QNKA 4UAPA 4Q0VA 1JZ4A 1ZZ9A 1RUD1 2ZKNA 1OH3A 3POFA 5FYMA 1CJPA 4B29A 1PO23 3PVBB 5C5TA 2IXHA 4W65A 3AKSA 3WUDA 2ES3A 2Z79A 2IXKA 1F8VA 4K9SA 4N8MA 2ZGPA 3K1UA 5DUUA 5A80A 1OQ1A 1W2OA 3O12A 4FT8A 1KDMA 5FPVA 4AE2A 5KHJA 1MEC1 1RB8G 3ZN5A 5L73A 5I91A 1YNAA 4CDWC 1PGW2 4CDXA 5C9AC 3VDBA 5H9PA 1U5YA 5LA1A 4MG2A 3NAPB 4CDWB 2XJUA 3VBOA 4TN7A 3MFAA 3SCHA 3ZN6B 1UOGA 5FZ9A 4BQYA 2Y64A 3MI8A 1W9TA 2UYAA 3IN9A 3CHXA 1Q8OA 2JDZA 4AVBA 5FYZA 5A6YA 5J09A 4PDWA 1LRHA 2V4AA 2NLRA 3D3AA 1W3XA 5FYUA 3WEZA 2JDYA 1BLZA 2GNDA 1AR81 1RUC3 3N7LA 4L0PA 1LULA 4NPLA 1JZ3A 3KD4A 1HN1A 1WW6A 1SBDA 1SQ4A 3I2JA 3KVAA 1QJFA 2VE1A 4DY5A 5HCAA 4Q29A 3D5OA 1QJX3 1RUF3 2OUJA 2Y6HA 3D8CA 3OBTA 4GZ9A 4LE4A 4RQPA 4KG0A 3WXPA 1JU4A 4IEUA 4IW3A 3CU9A 4JTNA 3DL3A 3WW4A 1TNRA 1GLHA 2DVDA 2HEYF 5EQUA 5FR3A 3AMNA 4L99A 1W99A 1MQTA 3LD8A 1AR71 3ZYHA 3VSRA 1ZZCA 4GKXA 2DFCA 2YU1A 2BNOA 1HDKA 1OOPA 1K3IA 3GBWA 4NWVA 3RMYA 2W91A 3KCYA 3UETA 4LITA 1JYTA 2P4EA 4R8HA 4OZXA 1ZBA3 4XIKA 4N43A 3FHAA 2OYZA 1OD3A 3VKLA 4MYEA 5A7VA 3CJXA 1VBE3 3ZXAC 1D2QA 2PMWB 2YPDA 1JUIA 1V6JA 2YHJA 1W39A 3HQRA 2XPJA 3WMZA 1ENXA 4QKBA 4BQ4A 3C7HA 1RGSA 3AL5A 4OUMA 5CFDA 1WLTA 1RITA 3I97A 1GQGA 3J7LA 1QJU3 4FQ4A 4FTSA 1NE4A 5EJ1B 1EV13 2HWE1 4LTAA 3KQRA 4FPLA 4Z1VA 1GKBA 5DQ0A 1E5HA 3GHMA 1JZ6A 3T0DA 2YBSA 4KH9A 1UYPA 3APBA 3QEDA 3WQ0A 2Z4FA 2R7EB 2J22A 3PVEA 2FHRA 2UWBA 3ES4A 4QQLA 2RDSA 3B9CA 2WNOA 4OI4A 4RA0A 4UFJA 3VV1A 2RMU3 2CGNA 4LBOA 3HT2A 2ZGNA 3WATA 3RWNA 3ZXJA 2OKXA 3AZWA 4HONA 3I2GA 1IS4A 3QD6A 1XNKA 2WUHA 5BPXA 3FMGA 3KWVA 2YFZA 3WDUA 4QXCA 4I09A 1ACCA 1OI6A 3AKPA 4GWNA 5LY2A 4LKFA 1DYOA 3P2NA 1WA6X 2ZGUA 1R64A 4YM1A 2KA3A 3DYMA 4OHXA 2PQQA 4CP9A 1UPSA 2Y0OA 2ZEXA 1RVF3 3N35A 5DUXA 3RYKA 5F32A 2ILMA 1FPN1 2GN7A 2D3RA 3I3MA 3KSCA 4XJZA 5IUQA 1Z7S1 1IQAA 1RMU1 3VBFC 5AYDA 4FXKB 1ULEA 3OJBA 3UGHA 1GNYA 2CAUA 2BNNA 4XAEA 2HEWF 2WJSA 5FYTA 4QQ2A 3RJ2X 2BPA2 2X05A 3QH6A 4FPCA 2XVLA 5IJRA 5T54A 2VVDA 1AJKA 3AZXA 4AK5A 3UGGA 4META 3ZXEA 2PAEA 2K2SA 2J1EA 2YC4A 4AI1A 1W8UA 2AENA 4YZ1A 3AKQA 1W6NA 2RJKA 2WRAA 5FZ7A 4OHYA 2WZR3 1S0EA 1X8MA 3OGVA 2JIGA 1A78A 5CADA 2DBIA 5GZCA 1TME3 2VNRA 1TMF1 3ZFEC 2EXIA 1UZWA 2PLV2 2RJ2A 2WYFA 1X36A 1BVP1 2VMIA 4FPFA 4MVTA 1XRUA 1PO12 3USUB 4KQ7A 1H2MA 5DZFA 3T0BA 3MZHA 1UXXX 1MVQA 1HRV3 3C7OA 3K3OA 4EWEA 1JHJA 4K40A 3TOJA 3WVJA 1HV1A 1UZ0A 3OGGA 5LBFA 2VM9A 3SEEA 1E5IA 3WV6A 4EE2A 5KXDA 5A7NA 1CZSA 1D7PM 1WD3A 1YQ2A 1K12A 4ZXEA 2ZGTA 3J9SA 4EWDA 4WM7C 3VBUA 3CKHA 3RFRA 4DIQA 1SLAA 2VO5A 4M4PA 2VMGA 2G4IA 3KV6A 4HK8A 1VBA1 2WA3A 4Q4V3 3M3EA 4IE4A 4FOYA 4QU2A 1LB2A 3EHKA 2C26A 1IS3A 1AUYA 4DXTA 1PMJX 1H6YA 2BDRA 3CF6E 3PUSA 4MGIE 1W9SA 4FOWA 4A3ZA 3W9AA 5C8CA 1GYDB 4A3XA 4NRQA 2WNVA 5FYSA 2BWAA 4MH0E 3GZUC 3NJYA 5GZDA 1KD7A 4FPGA 4UI9L 5I8TA 1FATA 3K75B 3NVCA 4GIQA 5CFCC 3VDDC 1QQP1 5A8CA 2MEV1 4QPIB 2VNGA 5FO7B 1QJY3 1H1MA 5FLWA 5FZGA 3GM8A 3JD72 5E88A 1Y4WA 1NA1B 1YC61 2YYOA 4COZA 1FOD3 3MLJA 3D61A 2HJIA 1HXS2 5F3EA 4CCOA 5CFCB 1REDA 4P00B 4XFHA 2B42B 2VZOA 4Y1YA 2Y34A 1OKOA 2FDGA 2MNGA 2VGDA 3HVDA 4AI0A 2RG4A 3IZOA 3WP5A 5BNNA 4B7EA 5FMBA 2W92A 3HNYM 3NNMA 4KWJA 3BODA 2O1QA 4CDUA 2BTVC 4CUGA 1UOFA 1A34A 5GLRA 5JOYA 1PIV1 1OPOA 4Q4Y3 3CO2A 2JG8A 4GMP0 5JLVA 1ZRFA 4QQSA 3OCPA 4B4QA 1ZVFA 3ZSMA 2ZX2A 3UT0A 1S0BA 3MIGA 1OH4A 1XOYA 1VE0A 1O5UA 4W6XA 4ATEA 2FDKA 2ZACA 1Q8VA 5DZGA 1Q3EA 3LCPA 2XKOA 3ZMOA 5ANNA 2YY1A 1SBFA 4BOWA 1C28A 1LEMA 2RE9A 1K45A 3JBG2 4ZU7A 1RUI2 5F3CA 1PVXA 2P1BA 3LF7A 4ATFA 4WVZA 5IT6A 2R041 4LHLA 5A7QA 3AYDA 2QQJA 4LBNA 3S5QA 3ZMNA 3L9JT 1LHNA 3PUQA 5K0UB 3AVRA 3OUJA 5DN2A 2WQ4A 2AC1A 3VZLA 1G9CA 3UK9A 1NT0A 5FXZA 5IVJA 5IK5A 3DXUA 3C7EA 3HNBM 4JKMA 4YW4A 5FYVA 1WLWA 4XHBA 3WASA 3ACGA 2F4PA 4RHV3 1AYM1 2WWJA 2HWF2 3WQBA 1R093 4NHXA 4JGZA 1UYXA 5DDJ3 3E5XA 4A6SA 1JOJA 2JENA 3O0VA 2A6VA 2HWB3 3M2MA 4IEYA 4OCTA 5HI0A 4ISRA 1XSRA 1HN0A 2RHPA 4XW3A 5IAVA 4QPGA 3USSA 3WY6A 5AC91 4BHPA 1H0BA 3VBOC 1JHNA 4LBLA 4CDXB 2X09A 3H1MA 1H9PA 2X29A 4H55A 3ASIA 1GU3A 2QQIA 1EUUA 4QHOA 3VBOB 2EAAA 1PX3A 4PDWC 1DG6A 3K48A 1EAH3 2VMFA 4KC7A 1Y9QA 3U11A 2JDNA 2XDVA 4QX7A 5BNPA 3ZOIA 4PDWB 1WMDA 3OGRA 1PO21 2XJVA 2CWMA 4YZ3A 1IOAA 4RQPC 3RWKX 1GANA 1BK0A 5IK4A 1GV9A 3VN4A 4QKFA 1KXGA 1ZA7A 3BTYA 5FKBA 3HOBA 1JUHA 2LROA 3OB8A 3GF6A 3VD4A 1MQTC 2A70A 2D3PA 1YLLA 1WCDJ 4CEWA 3C7FA 5DUVA 4FFIA 4Q4W2 3QEFA 1DGWA 5FUNA 3M70A 4EQVA 4EN7B 2XOMA 2W9XA 1MQTB 1NYWA 4YM3A 2E26A 2BVBA 2WT0A 2CWSA 4E2GA 3VSZA 1YRZA 2WDBA 1OOPB 4BJ0A 2NMOA 1UW8A 3L2YA 5T3NA 4CCKA 1X9TA 4AEKA 1CR7A 5CAZA 2P37A 1RUC1 4N43B 1ULOA 1A8MA 1LESA 1SHWB 5DABA 3KV9A 5BNOC 3NMBA 4KL1A 5CFDC 2CGPA 3DUIA 1UL9A 1QJX1 1RUF1 1CZTA 4QX5A 3ZFGA 3WP6A 5KXBA 5A3MA 4Y33A 3BTZA 3D0SA 2WSVA 3P3NA 2A6ZA 1CIYA 4CUCA 4Q27A 1UZVA 3HMYA 1VJ2A 1W8WA 1UOJA 4AVCA 2W52A 1W9YA 2Q4SA 2RS12 1CESA 1FT9A 4XCAA 4XF3A 2QQMA 4AGGA 1SLIA 4RL7A 3SISA 3WHTA 4LK6A 2AREA 1SFYA 2FCUA 4YW2A 3K4ZA 4YGBA 5CBLA 2OVUA 3E97A 1ZBA1 2D98A 2ZGKA 4JGYA 4XFIA 1F35A 3OEBA 1FNZA 1NLRA 2I07B 4QHBA 5IWFA 3RQ0A 4CTEA 4YZ2A 1ZBE3 1JYNA 2Z42A 3WD5A 1U5XA 3V0AA 4IGPA 3ETPA 1LHVA 1ZBA2 2L9LA 3JUUA 4PF5A 5JXGA 4AEDC 5C7GA 1FYUA 1QJU1 3FUQA 4ZU5A 4A44A 3PTYA 1EV11 2RDNA 1ZRRA 3U4SA 3O1OA 4CP9B 4LO6B 3DF0A 1FX5A 1LGBA 1VBE2 2K9ZA 1MEC3 3K4AA 5EV7A 4P5HA 1VB4A 2JE8A 4D7SA 1IG3A 2Z5WA 2XUMA 1OD5A 4AAPA 1EV12 1ASJ2 5FY9A 5A70A 1LENA 2RMU1 1UYZA 1DQ5A 3NV1A 4N53A 3ZFFA 1DF0A 4QX2A 3SHRA 4Z2AA 2XBO2 1UY0A 2QQKA 5IK7A 1HQLA 4Q0PA 1IG0A 3BYWA 4A42A 1W6NB 1NKGA 1J3RA 4QPWA 4AVSA 2R30A 4IUGA 3QH7A 4LIUA 1QXRA 4CCDA 3WNLA 3BN6A 1RVF1 4XUNA 3R67A 1W6MA 1UY3A 3J26N 1DZQA 2IWGB 4Y5TA 1JZ8A 3HEIA 3ZR5A 3V0BA 3ES1A 3SQOA 3LAGA 4CCNA 1NCRC 4XIOA 4O65A 2HBUA 1HB1A 5FY8A 3I2HA 4D7TA 3RGBA 1RVF2 4LO5B 3ZN6A 1MS3A 3S30A 1C8M2 3T3YA 2DURA 4Z92B 1VBD3 2IXJA 1ENQA 1HLCA 2VXRA 2VD7A 5FZ6A 2XONA 1O5LA 2ZCWA 3ZIXA 5AFEA 3KCXA 1X8EA 2R1DA 3VBUB 4LR4A 3A0KA 4ORFA 4AL9A 1YQCA 1TME1 1K42A 3GJAA 3GALA 1HB4A 2A3XA 2VZSA 1J84A 2JDMA 2KD7A 5ABJA 4F3JA 3ZX7A 2WNVC 5JUVA 2VMEA 1AX2A 3I2OA 5KHHA 1FMD1 1RUG2 2QCSB 2VY0A 3CBNA 5LBEA 2WZR2 2B8MA 1AR92 3HAGA 1HRV1 4GH4C 2O0OA 5C8CB 5FXWA 3X29B 4FAHA 1J3PA 4LMFA 1VMHA 4FTBA 1LOAA 4JKLA 1RXFA 4O8NA 1FI2A 3HBKA 5FMOL 1V6NA 3OUIA 4ZXKA 5F7UA 1NAEA 3S7EA 1F4HA 2R0HA 2HKXA 3LEMA 4GA9A 1BEV3 4MGZE 4COWA 3IB3A 3WLUA 1HRV2 4BK5A 5BV6A 1OKQA 2Y6GA 5CVRA 2XUEA 3T09A 3WF4A 5C3PA 2WT2A 4E4HA 3WW2A 5I0SA 1SLBA 3H0OA 5C71A 1NCQA 4CDUC 3RRDA 1KEXA 1OUSA 4YVWC 5JMOA 2ARAA 4MADA 4RGGA 4Y22A 3BU7A 5BNNB 1W28A 2DCYA 1GYEB 3CMGA 5LK5A 2J1AA 4CDUB 5J7MA 1OF4A 3M8LA 3JXSA 2WFPA 5HCHA 1R1A2 2JG8B 2Z2SB 5EYXA 4P08A 1BKZA 2VOKA 2Y26A 1NLSA 3SCGA 4YPJA 4Q4V2 3WCSA 4Q8KA 4XBQA 2F4LA 1PNFA 1QJY1 3MF6A 5EXOA 1GWMA 3VT2A 3AKIA 3OPZA 4Y4RA 4LHSA 1UMHA 1W6QA 1FOD1 2HWC3 4IEVA 4IXLA 4NIHA 2GDFA 2VOWA 4CU9A 3QOPA 4ONUA 4XYXA 1BCXA 5FYBA 1GYHA 3WAUA 2QQOA 3GCXA 1GUIA 1OLMA 1LOFA 2J1VA 4C91A 1QJY2 4QU1A 4DEVA 1ULGA 4NHMA 3D5YA 1VP6A 2IXIA 5T5PA 1UNBA 2XWBB 3VDAA 5B4XA 4M0HA 4QX0A 1LNSA 3DYPA 3BTXA 2VW0A 1OXCA 4KBBA 2DUOA 4JGZC 2C9KA 5FUIA 3D5ZA 2RVAA 4FPKA 5K9YA 2ORZA 3NJVA 1ENSA 2FCTA 5CA6A 2D5HA 1V6OA 2JECA 1UIKA 3SKJE 3E6DA 4Y4YA 4Q4Y2 4JGZB 3S6PA 3WDWA 5FOJB 4AK6A 5DG1A 3HPNA 1ST8A 4Y24A 2ZHMA 4UWDA 2WO7A 5F5CA 4JRLA 1W04A 3R0RA 1O8PA 1T2XA 2ORXA 4QPGB 4RGAA 3N3HA 5FYIA 4WVWA 1MZEA 2RM22 4U6DA 1W8HA 1US2A 3LSEA 2B7YA 5J36A 5FY0A 4E2QA 2K0GA 3I59A 1NY71 3NNJA 2GSYA 4NIIA 1SFPA 3O0WA 1VBA3 1AHSA 5CZKA 2XJTA 3LA3A 2ADDA 3PJQA 4U36A 4AGVA 4AOCA 4CZSA 4RHV1 4CCCA 2RR13 5BNPB 3OG2A 3U37A 2JICA 4OUSA 3JZVA 1S4CA 3LIGA 5DDJ1 1F9KA 3FHQA 2V4VA 2VTXA 2BOIA 2XGXA 2R0FA 5F5AA 3UV9A 4BMBA 3O1VA 4HLTA 2HWB1 4AXOA 3LSDA 4AFMA 4ASMB 2JEMA 4N9HA 2E33A 1VALA 4R4XA 4W8JA 2V73A 1RUJ3 5IW0A 3VB9A 2BNMA 4A7ZA 1R092 1OMIA 3BOPA 1AL23 3IDAA 4CEWB 3DKQA 2QQWA 2R073 4FP3A 5CYYA 5DDJ2 1F2NA 4RR3A 3WG1A 4P5YA 2RS52 4WVMB 3W5NA 4S2GA 2WBKA 2HWB2 4PBOA 2FD8A 1VLNA 1EAH1 1VAMA 4HT1T 1OPMA 2RJLA 4QKDA 4UDJA 2XLAA 3JQXA 2WC2A 3AXEA 2EF6A 1WZXA 2X5IC 1S1AA 2ZHLA 3RYRA 1YQ8A 1PIV3 5ACA2 1V6IA 5F39A 3VBRA 2NP0A 4Q26A 3KF5A 4YZ4A 3N7JA 2W39A 2ZHKA 1XNCA 1YEWA 5C4WA 3MIDA 4AFBA 4BXFA 3THDA 3VUOA 3G6JB 2VG9A 3VBSC 3BYNA 3A23A 3BUCA 3N9LA 5F3IA 3ZFGB 2VDTA 1NA1A 1Y7BA 4XTPA 5T5LA 3OM2A 5FLJA 1HIXA 3VZNA 3ZIWA 3DPRA 4DUXA 3O1SA 3NW4A 2XR4A 3VBHC 1BBT2 4IE5A 2B46X 1DQ6A 5D8AB 1H2KA 2IXLA 2ET1A 4JGYC 3B3QE 1PK6C 1Y3TA 3AMMA 1NQDA 1I1EA 4KG8A 3WDYA 4HN0A 2A6XA 3ALQA 5AY9A 4W6WA 2I74A 2E7AA 1U0AA 5FRAA 5H9SA 4RFRB 1YQ6A 2CTVA 3OD4A 3ATGA 4IEWA 3AZVA 3T2PA 5JSRA 2ZPXA 1IS6A 5E1RA 2ZMLA 3K3NA 3ENRA 3RZKA 4JDMA 4UDKE 1AYM3 1AX0A 3AKTA 3J8F2 4P9LA 1G86A 3S57A 1IGOA 4DXZA 1H30A 2YROA 5JPNB 3BPSA 4NR1A 1SZBA 4TWTA 1QXJA 5T5OA 5JI9A 2NM1A 2GN3A 4QHZA 3ZO0B 3VD5A 4K1ZA 4HKWA 2VXJA 5IVFA 1LHUA 1ZRIA 5FBZA 5K0UA 1S0FA 4K8RB 1Q5OA 4GB32 4XJUA 1B35A 1D4M3 4Q4X2 4N53C 5JAXA 2XL7A 5AYEA 2W87A 4CEYB 1O3SA 4N4BA 3AMPA 2E31A 5E8AA 4IE7A 2IFRA 5SV5A 1U5ZA 1ZBE1 4OMCA 2XB6C 4N53B 3ZFFB 4ISQA 1YQ5A 5FJKA 3TAWA 3LWCA 3B5LB 3IIIA 1YFUA 1S0CA 3WNMA 1LAJA 3R4YA 3WINE 5FZCA 4IDZA 2EA7A 2B9UA 4HK9A 4JDNA 1JOBA 4AFCA 2KM2A 1QOTA 5DPNA 5KHIA 1H8VA 1UOBA 5A7PA 1KFUL 3B9IA 3H8RA 1W6MB 5LA0A 1ULPA 3HN3A 3NAPC 3Q8CA 4MXVA 2W5FA 3RZGA 1RUD2 1STMA 2D3SA 3V0BB 1ND3B 1W0NA 4UFLA 4KMQA 1G9BA 3MGUA 4XQDA 3FLRA 5ERLA 1J58A 1GFF2 3I2KA 4HETA 1MEC2 4HKLA 3VHOA 4QQHA 2Q1MA 2BBAA 2WN3A 5FZIA 3WPYA 3BOWA 1GQHA 4QDRA 3MW4A 4FBFA 2OS2A 2GU9A 5D1IA 4LIVA 2D44A 2CNAA 1YWKA 2HWD3 3AMQA 5A3WA 1A6CA 3WF1A 1XE0A 2MPFA 3MYXA 3LOBA 1UPIA 3B93A 1QXPA 4B3NA 1NUKA 4I30A 4AK7A 5ABJB 2DVBA 2BEOA 1HRI3 2ARCA 2VQTA 1EY2A 3PUIA 4FP2A 5J1XA 1S0IA 5IK8A 2YBPA 3RNSA 1H1AA 3WW1A 2YGLA 1AR82 3WDVA 4YFWA 3CJIB 4LORA 4I3GA 4BXSV 1CX1A 1REFA 4UFMA 5BXXA 2DWRA 1OQEA 1XBFA 1VBD1 3ORJA 4S2FA 5DXDA 3J7NA 4N1IA 3VZJA 4J1WA 4YW5A 4E4DX 2GH8A 3HJRA 5ANQA 5CB7A 2D93A 1AR72 1DZTA 1N1VA 3RYPA 1NCQB 2F6BA 3AZZA 3M3IA 4HPKB 5IATA 4IEXA 1DBNA 2CSGA 2E7QA 2BOJA 4Y22B 3AXDA 5D21A 5FPBA 2H0BA 1QNYA 3BKZA 5TSWA 1I5ZA 4EN0A 4XC9A 2FCVA 4COUA 1ZRDA 2VZ1A 4IETA 4LK7A 3GXUA 2Z69A 1B09A 3NJZA 5AFBA 2FDIA 1RHI3 2ZMKA 3GZTB 3ZYRA 1OF3A 1SLLA 1BEV1 1NQJA 2WNEA 2J1UA 4YSFA 1W6QB 4M3CE 1LOFC 4XACA 1US3A 2JKXA 3QBQA 1SLCA 2PHWA 1YFWA 2HWE2 2XQXA 1ZA4A 2D7FA 2YXSA 3POYA 4Q1RA 4XXAA 2PAMA 2Y8KA 5DAQA 4JVAA 3VKOA 5A3NA 5A7WA 1DHKB 2YU2A 3LA2A 5KHGA 3H8XA 3OTFA 5C3RA 1VBB3 4NROA 4JZRA 5EP9A 1W9WA 3ILRA 4FQZA 1RUOA 3N9QA 2OUHA 2ET7A 4ZPIA 1JW6A 2B4KA 5JSPA 4HG6B 2VC9A 4BMEA 3AL6A 4O8OA 2DVAA 2EIDA 4P14A 4D0QA 2W1WA 2WZPP 4CU7A 4QXKA 2HWC1 4AEMA 4NIGA 4XBLA 1JOPA 1Y43B 1ZZ7A 4ES9A 3AP4A 4DFSA 2Q30A 1FPN2 1KGYA 2EIGA 5K7PA 1VBC3 4HSJA 2B39A 1Z7S2 2VOVA 3WZ1A 1MVEA 2EIBA 4IV3B 1RMU2 2ETEA 2HWC2 5A7OA 3U75A 4FO9A 5JXJA 1N1TA 3H8OA 1CJDA 4SBVA 4M0NA 3AKGA 3TAYA 1YIFA 2R063 4YRDA 3BYJA 3I59B 4UT5A 1O6UA 4PF1A 4F7ZA 1UKRA 2XVKA 3ON7A 5FYCA 3THTA 4JX0A 1FMD3 3PUAA 3O7OA 1DLCA 5LEJA 4XFGA 5DUWA 2DUPA 4OFGA 3N36A 5F8PA 1WWYA 1CZVA 2G9FA 1TMF2 2ZOEB 3KF3A 4ASLA 4OI1A 1V9U3 4PHZA 2RS33 3DKWA 4CA9A 4GXLA 1M06G 4MX3A 3RJRA 4N9IA 4RR3C 3OBRA 1YI7A 2XKPA 3H3UA 2Y6LA 3T4HB 3AP7A 5FPZA 1OQDA 5L7OA 1XSQA 4RR3B 5KR7A 4LO7A 1UZZA 1TVGA 4WBBA 2E6VA 5B2GB 1W05A 4GMP3 3BVCA 3M3OA 2VZUA 1XNAA 4EWAA 3IDBB 3PMSA 2Y33A 1WMEA 1YUDA 2RR11 5FYYA 2YFSA 1RXGA 1S2KA 2Q8DA 2JD4A 3ACHA 2X8FA 3K51A 4CCJA 2ZX1A 4QPIC 2J1SA 4I0WB 1WMFA 2WAOA 3VBRB 3WDXA 2WT1A 3ZYPA 1NA1C 1VBA2 3TRSB 3H9AA 3O14A 5C4WB 2JWPA 4PLOA 4UW3A 5FDBA 3U4XA 3E5UA 1V6KA 1OA4A 3N9PA 4DUVA 1RUJ1 5G04L 2E9QA 5GLLA 1AL21 4B8EA 5F1RA 3NO8A 5IVEA 1QH7A 2R071 2VUJA 1XNBA 3DPRB 3MW2A 2VTFA 3ZSEA 3PIGA 4YGDA 1VMFA 3TYJA 4BQ5A 4UW5A 5J96B 3WPZA 3C2UA 4XILA 3ZDVA 5LRSA 3LOIA 4C1XA 1EYBA 1QQP2 5JWPA 2MEV2 4LPLA 1SBEA 1S0DA 2VU9A 5DMYA 3CZJA 4Z82A 3C7GA 2FMYA 1W8ZA 2FZ2A 3U78A 3LKJA 5FKCA 5LCWL 2VR4A 4C0HA 1MPXA 4KU8A 3AZYA 2X8TA 3W5MA 5CISA 3KV4A 5GLTA 1J59A 2I45A 5A7SA 1COV3 4XPVA 3OM4A 1UY4A 4AZZA 2R16A 1W2TA 4UXAA 1DGLA 3VKNA 3Q8AA 5C3QA 1LOCA 2WS93 1PIV2 3GDBA 4P9GA 3POIA 1ZX5A 5A6XA 3JU9A 4HFSA 4C8DA 5K0UC 1QIQA 4BIFA 4V2VA 5FPLA 4LEJA 1GP5A 3FBMA 4O8PA 1CPMA 2VUDA 2WO3A 1B35B 5FXVA 1AXYA 1C4RA 1L7RA 4H2AA 1UD1A 2QDRA 4HN1A 3VZMA 3N9NA 2AR6A 1CAWA 2R042 3R6SA 1F4AA 3FUOA 1UQXA 1WW7A 3VSFA 5JIAA 1WCSA 4OUEA 1E5RA 1QEXA 4E8DA 4UDGA 1WCKA 4IEQA 4CE8A 2ZGRA 4CCEA 3KSTA 4DMIA 1C5IA 3RZZA 3ZPOA 4CDXC 2GC2A 5FLIA 2E7TA 1MS9A 1WBLA 1ALYA 3IDCB 1NOVA 1BHGA 1W8NA 1CAUA 4N2ZA 1AYM2 2ZGSA 2GH2A 1W3VA 1D4M1 2WLQA 1PVC3 2OT7A 2Q1ZB 3OYWA 4JV4A 3C8XA 3R4DB 1XC6A 5H9QA 1R083 4X8PA 4IV1A 5AC92 1GZWA 1WA4A 1LU1A 1N3PA 4NAOA 1AR63 1VAVA 4RD7A 3KM5A 5FLHA 5KC6A 3SNMA 5FK7A 4FSJA 3OM7A 3I54A 1W18A 4NWWA 3PIJA 4OZOA 3WHUA 3MUZ1 2RDQA 1HB2A 3BU0A 5B6TA 4D7YA 3B02A 3TEYA 2PXJA 2W3JA 4DRVA 1G8WA 1G6NA 2PHUA 2ZX0A 1U12A 4J25A 1PO22 1JZ7A 2JIJA 3RI9A 4YFZA 4QXBA 4NN0A 4PLNA 4WVMA 1OOPC 5EHDA 3P5BA 3GCWA 2XLGA 3M3CA 3I7DA 5FZLA 4IGQA 2UWAA 4N43C 4LBQD 3SITA 2D6MA 1P8JA 2VTXJ 3POEA 5T5JA 4LUKA 2HWD1 2TBVA 4B1MA 1DZRA 3IMNA 4NHLA 5L9RA 4AEJA 3OBZA 3R05A 4ZKTB 4F83A 1YXWA 1CAVA 4KCAA 1PMIA 2P6HA 4RS5A 4AR2A 1G9DA 3VD9A 4D3WA 3ME2A 2WNUA 3ZXLA 1VR3A 4GQ7A 4L11A 1HRI1 2BFUL 1K5MB 2WZ8A 4QDSA 5FZ8A 2C1FA 3VDCA 5LWBA 2YMZA 3NV4A 5F5QA 4A2UA 4TTGA 1RUH3 2WL1A 5H9RA 4XHXA 1N1YA 1T6BX 1RUC2 1UMIA 2NN8A 3MV11 5C3SA 5GZGA 2OPWA 2E53A 1X82A 1JZ2A 1JYVA 5D8AA 1ND2A 2JJ6A 4KWLA 2YFTA 1QJX2 1RUF2 5FWJA 4BQ1A 4MUVA 1POQA 3KGZA 1GQPA 1Z78A 1AYN1 1KDKA 1W8FA 3U1XA 2EALA 2B45X 1SLTA 2JB8A 4IEPA 4COTA 3M1HA 1KITA 5A7WB 3VT1A 2DCTA 3FHIB 2WABA 4WZCA 5CEHA 3NNLA 3WCRA 4AQ2A 1NXMA 2DV9A 4MZUA 4XFAA 5JZGB 3VZKA 4GAZA 4MO3M 4NE9A 3MIHA 2Q8OA 3AFGA 3WF2A 2OX0A 5FP3A 4EZHA 3EYPA 1GWKA 3G7DA 1T6GC 2YBKA 1TL2A 5JXHA 1XB9A 3A22A 2VJXA 1G7YA 2QE3A 4JKKA 1RHI1 3E1F1 4Q2FA 1W6PA 4OVEA 2DU1A 4XMAA 5CKQA 5FZ1A 2JDAA 3ACFA 4P9YA 1DQ4A 1QJU2 4C90A 3AYAA 1FV2A 1W0OA 4GJYA 3UJOA 4CEYA 4TSVA 1MS5A 1VIWB 2YPJA 2ZZJA 4WM8A 4ARYA 3WPVA 3OPTA 2BBVA 4CP2A 4GALA 3NWKA 2JX9A 5FY5A 4XZUG 3VGIA 1UF2C 1D0HA 2WYSA 1VBB1 2ZZQA 4XABA 5J98B 3W58A 1S2BA 1W6OA 3LFIA 4B1LA 3U10A 2XL9A 3S5AA 2RMU2 2ZTNA 4DZGA 1AF9A 5GLOA 2LM3A 3MV01 3FLTA 5LASA 3POWA 4YG6A 1QOSA 2MHFA 1VRH3 1S55A 1AZDA 3O1RA 4OULA 1NG0A 2YFRA 1XYOA 2Y6KA 3IAPA 1ND3A 1SG3A 3QLQA 2C9AA 5CG8A 4JDOA 1PGL1 3MIBA 2P3IA 3GBGA 3URFA 4BWOA 4QT6A 4YW3A 2WQZC 1HQWA 4XDQA 4QDQA 3VBUC 5L7OC 1VBC1 3LGRA 4GD4A 3PU8A 1A8DA 1GZCA 2J1TA 3V56A 2VZ3A 4TXWA 2QUOA 3RZMA 2ZEZA 5L7OB 2JKBA 5E6HA 4E4ZA 2R061 2EXHA 3WN1A 5LA9A 5FYHA 2ZGQA 2V09A 2JG9A 1NZIA 4NO4A 4XF9A 4R9DA 5C8CC 4PBPA 4NIAA 2UY9A 2VCCA 2XWJB 4JTOA 4XZPA 1WCQA 3CJIA 5C9AA 2XJPA 1TME2 3PHMA 4QAWA 4A7KA 1CGPA 4N7IA 3TNPB 3WG2A 1V9U1 1YJLA 2RS31 3ELNA 4IE6A 4EN9B 5JOZA 4MGTA 3ZXDA 3MW3A 2CAVA 3VKFC 4WV8A 1FMD2 2VMHA 2ZXQA 3B94A 3RI8A 4PCRA 1GOGA 3DYOA 4Y1VA 3T4VA 1C3HA 5BNNC 3ZXFA 2AUYA 4XCBA 1V9U2 2ZX4A 5FIXA 3LPGA 2VULA 2WFF1 4HPKA 4EV0A 4FPJA 2W1SA 3WDTA 4GMP1 4LBMA 1H2NA 1XPWA 2GALA 2JG8C 1WW5A 1MS8A 3NKGA 4OHWA 1UMZA 2J1RA 3OY8A 4KNCA 4PLMA 4UYBA 2JDPA 1EUTA 3TEZA 3Q8FA 3MUY1 3WF3A 1L3JA 3KMHA 4BA6A 4LE3A 1MZFA 2DTYA 2QVSB 1IPJA 2Q8CA 4OHVA 5C0PA 4QXHA 3SC7X 2BUKA 4IEOA 4BCUA 2OXBA 4E27A 2XH6A 1UY1A 3AC0A 3ZYFA 4CSWA 5FZBA 3S0MA 2VZQA 3GHNA 2XQRA 4KGQA 4LHNA 3B69A 2A71A 2Q1FA 4D6RA 3N7MA 1QF3A 3D82A 3VD7A 4K20A 4H7MA 1D2SA 4P02B 4X8NA 4FTEA 4TLGA 4O9EA 5IVYA 1H9WA 3CIHA 4QB1A 4MSVA 1FOD2 5IHRA 2YC2A 3LV4A 4XXPA 5CNAA 3VL8A 4X6RB 1CPNA 2PHRA 2WA4A 4I01A 3ZKUA 4I3PA 1CAWB 5A3TA 1UV4A 1COV1 4CRQA 2G9ZA 1XNDA 3UESA 1H2LA 1LECA 3I2FA 3MBWA 4LOSA 1BMV1 2NMNA 2DVFA 1CQ9A 1VMJA 5B6SA 2WS91 1SCRA 2QZ3A 2GMPA 4AVVA 4QPGC 3ZM8A 1O4ZA 5FCCA 1GP6A 1AJOA 1S2EA 2PLV3 2YV8A 2A3YA 5EJZB 2PN5A 3H1WA 1XE7A 3A0NA 3THPA 4A45A 3K2OA 2VECA 3WN2A 2Q0AA 1PO13 2VQUA 2DDUA 4XQ4A 4K21A 1CAUB 4M4RA 4IV3A 3UKTA 2RV9A 2AGSA 3OYWB 5AVPA 4BM8A 1JU3A 3VSSA 2P5BA 4SLIA 1JYWA 5BNPC 3PU3A 2PQSA 4HMZA 3WX5A 4IV1B 1GZWB 1U5IA 2VOTA 2ZGMA 5EJ3A 5FFOC 3D6EA 5T55A 4QPYA 1DYPA 4W50A 4QMAA 5FMDA 5JVVA 4DRRA 5IVVA 2GP3A 3RZLA 4AQTA 3VBFA 4CXYA 1NY72 4ET7A 3H3LA 2J7MA 4KGGA 4CEWC 1BZWA 1O3TA 2AACA 1ZZ8A 1N3QA 1WMXA 4MLGA 5FMOS 1PM4A 4ZHNA 4RHV2 2XJRA 3U14A 4XMIA 2PA7A 2DF7A 3FLPA 1HJGA 1PVC1 2C0ZA 3UL2A 2VNVA 4NIDA 4YM2A 4QM8A 4MGQA 4QGMA 2D43A 2XXZA 4UDIA 5I8YA 2P17A 5I93A 3UNPA 4FI9A 5FY1A 1R081 3NQHA 4N90A 4UW6A 3ZFEA 3JD73 4UFIA 4A4AA 3Q8BA 2GMMA 2GAUA 3AP9A 4ZY9A 1AR61 3PDQA 2XMLA 3EB7A 1HW5A 3LA7A 3ZSJA 4BH9A 4OQ9A 2VZRA 2UWCA 1CAVB 3AP6A 3ETQA 3I2IA 4RS5B 5I0TA 2IVIB 1OURA 4QQOA 1EAH2 2WKKA 3ZFGC 4BLJA 4LA3A 2WNUB 2D6OX 3KHCA 2W1UA 5DZEA 4LBKA 2JXAA 5BNQA 4A41A 3NRUA 1Q43A 2IC1A 1IKPA 1DQ0A 2G1MA 2EXKA 1QGLA 2KR2A 1UX6A 5D8AC 1NX9A 2WAAA 4D47A 1UN1A 2DCZA 2UYBA 2VW2A 4W4ZA 1FNYA 3TBDA 3RVHA 1UU4A 2R32A 4Y20A 4D69A 3IWZA 1H1IA 1OT5A 2AYHA 3SCFA 3DEMA 5F2WA 1ND2B 3ZDSA 4ZZ5A 4UDKA 5FO9B 1H6XA 2K46A 2W68A 3HBZA 5D2AA 4NHYA 2UURA 5FZAA 4BPZA 2DTWA 2QQVA 3JBG3 1RUI3 1Z0HA 2EVXA 3WN0A 3POJA 1UXZA 1DQ2A 3OPWA 3E6BA 4Y26A 4UF0A 3MHZA 3UKVA 1C1LA 3A21A 5LEKA 2BZDA 2BWCA 2PYTA 4XF4A 3VDDA 1PZ9A 5L9BA 4CP0A 1RUH1 3WQ7A 4BIOA 1BXHA 1SCSA 2ZJCA 3THCA 3AJYA 1IS5A 2VPVA 2ZEWA 4BB3A 4LXLA 4BISA 3WP3A 1SDWA 4CVUA 4P9IA 1Q56A 4AFDA 5B4NA 4WVVA 1YIPA 3I3BA 2HH9A 4K3UA 1POV3 3SXWA 2HWF3 2EICA 4CEYC 5GLWA 2FDFA 1W6PB 2EIEA 1QU0A 2ZHNA 5AYCA 1HV0A 3EBRA 4KWUA 3ZFFC 1AVBA 3T1MA 5L36A 1MZ6A 1S0JA 5G05L 4FPYA 3O1TA 4WM8B 4PVIA 5C5UA 4E4SA 1SFNA 1PGSA 2UU8A 1BYHA 3ILNA 5LATA 5C70A 1W6OB 4G9SB 2VW1A 4JC1A 4QB2A 1KFXL 4HL0A 4L8QA 3AFKA 1JS9A 2BGPA 2VZVA 1LHOA 1QDOA 3IMMA 4R4ZA 4ZONA 2JE9A 4UOJA 2R49A 1GWLA 1ND3C 1CIWA 1ZBE2 4HOOA 1FXZA 4QB6A 4Q0UA 3LB9A 1M4WA 1VPHA 4DY3A 3P1IA 1KS4A 4D6SA 2ZAHA 3CNAA 4XUOA 1POV0 5HPOA 4P9JA 2B9VA 3FWEA 3HR9A 3P6BA 3TEXA 5JR2A 4LQRA 5GKAC 3IT8A 5IFPA 3MLKA 1PGW1 4HVOA 4QGNA 1C1FA 4KWKA 3BIEA 4Q4W3 1H4HA 1GP4A 2JG9C 1GOFA 4F8AA 3R4ZA 4LKDA 2GC3A 2D5FA 3E5QA 2JB4A 1MR5A 5A32B 3W20A 4AI9A 1Q8SA 4KBZA 3A4UA 5L9VA 4YARA 3U0ZA 2JG9B 3R4SA 2BERA 2BYVE 4N2RA 3CJIC 4XUPA 1QDCA 4PIZA 1VRH1 4FCAA 5DAVA 2QQLA 1G9FA 4G4FA 1GMMA 4LBQA 5FY4A 1PM7A 4GWMA 5C9AB 1XYPA 4XJ9A 3PLQA 4CXWA 3RSJA 3GNEA 1REEA 1RL3A 4OQ8A 2JE7A 3ZSKA 1VRH2 4LLOA 1ZNPA 5A8DA 3I49A 1HQNA 5FZOA 5I0UA 2WQ8A 1TNFA 1NCQC 2ERFA 3ILFA 4AVAA 3AP5A 1AYN3 4ASKA 1KJLA 2QBXA 2BQPA 3ZYGA 1IZ3A 4HSLA 5CIRA 2FDJA 3CEWA 1X33A 1W8OA 2ARXA 2TEPA 2RS13 2TNFA 4AQ6A 1K5MA 3A7QA 3POBA 1MS0A 1VBD2 4M3CA 5HV4A 3H1YA 1UZYA 5C2MA 1YHFA 5FJHA 3OY8B 4XFCA 4V2WA 1QWRA 3O1MA 4XVHA 5EYYA 2CDOA 3CQOA 3DGTA 4DS0A 5A33A 1UIJA 3GBFA 3LZZA 1FAYA 4FFFA 2NYYA 3NL1A 3EQEA 1D4VB 2V5DA 1O4YA 2WWUA 5HBAA 2YDEA 2OIIA 3GGLA 4BYYA 4NOVA 2DCJA 3GJBA 3L2HA 4NJ4A 4TLFA 3BB6A 1LGNA 1WGPA 3LE0A 3CZUA 3JB4C 3ZLIA 1YI9A 5BNOA 1KQRA 3CU7A 3K4DA 4FPEA 1V6LA 1OBNA 1ZYBA 2NQYA 1BEV2 1JYIA 2BGCA 1NE6A 2XLFA 5JZGA 4GULA 1ASJ3 3N4MA 1OYGA 1IPKA 3CLPA 3J4UH 5IAXA 1DGRN 3KLSA 1YFYA 1OA3A 2XBO3 2QQPA 1GNZA 2A1XA 4DUWA 1DGRA 4MXWA 2X10A 3FN9A 4LKEA 3UYJA 4M01A 3IDEA 5GLNA 2VZTA 1WCUA 4BK4A 4IV3C 4L9BA 2VBPA 5CKMA 2IXCA 2YG0A 3KHBA 2P6CA 3OGSA 4GWJA 2X53S 4TYSA 2X8SA 4Y5Z0 3TB0A 2E32A 2E51A 3ACLA 4YG3A 2HLEA 3PNAA 2BW8A 2AEZA 3O1PA 1V0AA 2HBTA 2VVFA 4XJWA 1TG7A 4AEDA 1C8M3 3EMRA 1N47A 4BQ2A 4XDPA 1ULCA 3ITQA 3MFCA 2ZA9A 3LEGA 3OEAA 1JXNA 1NXD1 4JHTA 3FL7A 5CU1A 1JODA 1JI6A 3LEIA 4LUMA 3VZOA 5A3PA 4IESA 2QQUA 2C24A 5F3GA 2W47A 4Z2WA 2PLV1 1GZ9A 3OM5A 3VBFB 5JDBA 2CDPA 3VT0A 5F9TA 5EWSA 3Q9OA 1DGWX 1PO11 1OVPA 1MACA 3M7AA 3MICA 3NSTA 2PHFA 1IKQA 2W46A 1RUG3 4FVVA 4UFKA 4XTMA 5LBCA 2Q8EA 4AHXA 1SPPA 2A7AA 1HJFA 1AR93 2P3JA 1AL0G 2WN2A 1ZM1A 3WT3A 5GLQA 1RUNA 1N3OA 4I02A 1ULDA 4ZS3A 1UU6A 5A1FA 2WFF3 4LHKA 5FTTC 5JMCA 2A5ZA 1QJZA 3B00A 3M3QA 3BPZA 3ZFEB 1RTVA 4LA2A 3VBRC 3KS7A 3OUHA 1IQDC 3KGLA 5JIUA 2ZGOA 2JD9A 1IHMA 5APAA 1I3HA 5FWEA 4CPBD 3FC0A 2DYCA 4ITCA 5C4WC 2JDHA 5FV3A 3MF9A 2BVVA 1WLDA 1WBFA 1NCRA 2ZS6B 2W08A 2X8KA 5I0RA 4YYOA 3DPRC 4FAGA 3WNNA 4D94A 5KHKA 4GKYA 2RR12 4Y1XA 4LJHA 3ZN4A 1AX1A 5FOBB 1R1A3 3SMHA 1QNWA 2LS6A 5GLVA 1VKDA 1OVSA 2A6YA 3FX3A 4DB5A 4MLOA 2O8QA 2IZWA 3CDZB 4WM7B 4Y20B 4A6OA 2ARBA 4FOQA 3BYLA 4URTA 1URXA 4XOGA 2G19A 1YFXA 3JD71 4UFHA 5DAPA 5FZ0A 1RUJ2 3LDRA 4I0BA 5FREA 5JR7B 4DXSA 1AL22 1HXS1 4G3YC 1I5PA 2R072 3F2ZA 2XJQA 4LNVA 5JOWA 5KBFA 4BDVB 4GH4A 1O7FA 1LHWA 4X6QB 3D4KA 3EO6A 5F5IA 1F15A 4UF0B 4W6YA 1Q8QA 3SH3A 2CL2A 4HANA 1UX7A 1YYNA 4FXGB 4XUQA 5GLZA 5A6QA 4NRMA 1TZOA 2W0XA 5FY7A 1EPZA 5HCFA 4ARXA 3U07A 3VDDB 4YW7A 4BE3A 4COYA 5E16A 2OQ7A 2FQPA 4QX1A 3INAA 3PVNA 4LOTA 5GLMA 1O8SA 1B35C 4L2NA 1KJRA 3N9OA 5A3UA 4MHRA 5FZFA 3ZYBA 4YVWA 4Y3OA 5FP7A 4L92A 5JOXA 1V00A 4DO0A 4AHZA 2XJSA 3JBG1 1RUI1 3W59A 4BQXA 1MS4A 4IGOA 5C3OA 2YFUA 5C8WA 1J83A 4Z8BA 5JPMB 4KC8A 1W03A 3O5SA 1CVNA 1AXKA 2RM23 5LK7B 1I6XA 2VUCA 1QJEA 1RUE3 3JB8A 5FUPA 4CDQA 4E2SA 1XQNA 4FFHA 4MV2A 4EZ4A 2GC1A 2ZGLA 3HWJA 2Y6JA 1GBGA 1DP0A 3MDPA 2CGOA 4Q0QA 1QHDA 5GLUA 3B7MA 5LRRA 1POV1 4YGEA 2WWSA 2HWF1 4HVRA 4HXCA 4CYDA 2Y0IA 2R1BA 1MZ5A 2BJSA 4UBGA 3TNQA 1UY2A 4Y1UA 3WMYA 3ZKYA 2LALA 4AI8A 5IYYA 1WLCA 4IL7A 4XEZA 1A3KA 3LIHA 3IPVA 3TN93 4YVSA 5LBBA 5A1AA 5DAWA 4YLZA 2ZKLA 1JTZX 2D6PA 3PURA 4D8MA 1D4M2 1F31A 4Q0SA 1CX4A 5A3OA 4BU2A 1X9PA 2RS53 3MPBA 5J48A 3HT1A 4CUBA 3ZVXA 3RPQA 3BGAA 2J42A 2QKDA 4Q5OA 5FZDA 3SEPA 4XETA 1W9FA 1LCLA 1W90A 5LA2A 1SACA 2WO1A 1XU1A 2AH2A 2TUNA 3AYCA 3DCQA 4NMIA 4AI3A 5A3LA 4U6BA 4PJYA 2B5HA 2D6LX 3POGA 5FQ0A 4YW1A 2VCBA 5ACA3 3BTAA 4R9AA 2YGMA 5FP8A 2RDRA 3NV3A 1DQ1A 4LBQB 4A7YA 2PELA 5HCBA 3I3EA 1AXZA 4QWNA 2VQ0A 3RMXA 1OFNA 5A1LA 1SDDB 4K6BA 2SBAA 4MGSA 3TWIA 2CY6A 4XDOA 1GICA 5FZOB 3P3PA 1Y9GA 4Q4W1 3VL9A 2IUWA 4UW4A 3K46A 4EN8B 1XYNA 3ZYJB 1VAKA 1K5MC 2C4XA 3AYEA 3IKWA 4I2OA 1BBT3 4FOVA 5F6LB 3SH5A 1KRIA 4QGLA 5LY1A 1SEFA 4YNIA 4RQPB 1H4GA 4FPOB 4M3CB 4AW7A 1CAXA 2E63A 1JH5A 2HWD2 3DV8A 1H8TA 1SMVA 3W21A 4DPNA 3QEEA 1VB2A 4ES8A 4AHWA 5KXEA 5A33B 2WZEA 1BK1A 1K5JA 2PAKA 5FAXA 2YB7A 1C57A 1YO8A 3D60A 5EFUA 1HRI2 4OI0A 5DG2A 2LW8A 2OPKA 5I8SA 4R52A 3WSOA 5BY5A 3J8F3 4OYUA 5FP4A 3VLBB 3T30A 3LPFA 1RINA 2GNBA 1W0PA 4ZS2A 3FFZA 5FZKA 2X5IA 4XAAA 3LDKA 5A7VB 1W8TA 1WD4A 1BQPA 5JZGC 4NPRA 3JQWA 2RS11 4GJZA 3LQCA 3NNFA 3KQ4B 4PIYA 4XFBA 3S7IA 3SKVA 3AVSA 4GB33 1OLQA 2LRPA 3ZYIB 4Q4X3 5BNOB 5CFDB 1QKQA 4RYDA 3T0AA 3FJSA 4O7XA 1AYN2 3AB0A 3RG0A 3T08A 3VBSA 4C0BA 4KMIA 2D6KA 3WNPA 3E6CC 2LTNA 2YUEA 3KT1A 4L97A 5GLKA 2BRTA 4QKNA 1ZRCA 3VBHA 2Y60A 1Y9MA 3MIEA 4CU6A 1WL7A 4QX3A 5JXIA 4HZFA 5F37A 3EJKA 4MXWB 1E57A 3ZXGA 3MPPG 4S2HA 2N7GA 3OD0A 1PK6A 4PQQA 1XU2A 3I3QA 3ECQA 4CP1A 2BV4A 4XUTA 1W2UA 4K8FA 2H0VA 1VBE1 3ZPYA 3UGFA 3TEWA 3I3DA 5C6CA 1O4TA 4IERA 4I0AA 4AYUA 2B4WA 5F2SA 1RUD3 1RHI2 2PTMA 4DXRA 5FZEA 2KXLA 5FZHA 3KVBA 2IFWA 3WR0A 1X7NA 4JQRA 1PMHX 5BUVA 4ONZA 4ZZ8A 2W94A 1ASJ1 3D0JA 1X50A 2FZ1A 5J3UA 3I4IA 3VHPA 1QMJA 1O3RA 2OQ6A 1UO9A 1XJAA 4H7LA 4RSUA 2ENRA 1OHFA 2VZPA 3UKNA 3BCWA 4AEDB 1V6MA 2XBO1 3HIFA 1Q8PA 4AVTA 4QM9A 4NVPA 3H7JA 3H50A 1VBB2 4GWIA 1LOBA 5JI7A 5M0TA 5T52A 2YC0A 3FBYA 4Q8LA 4AF9A 5IVBA 3Q8EA 2VMCA 3GZAA 5FK8A 4EROA 3M4FA 3WW3A 2PHXA 2VCAA 4JRAA 4XJ8A 4JHZA 2P3YA 2HEVF 2Y6FA 3DECA 3IBMA 2QFEA 3MEPA 3VD3A 5KXCA 4AWDA 5LW9A 2ZX3A 3HN1A 4LO8A 2QDNA 2DVGA 1SPPB 3NJXA 3PJYA 4LLFA 1AR83 1BJQA 1ZZBA 1F5JA 5FZ3A 2ATFA 2H6CA 2OW4A 5A32A 1PGL2 1OLRA 2H6BA 4PVAA 2LUWA 5ISLA 5BYNA 1C8M1 2VNOA 1PX4A 4CUAA 3AK0A 1VBC2 2BFUS 4P9WA 2UY8A 3LDBA 4KI5M 1GNHA 3WNOA 1C5HA 1ENRA 1LKNA 3FZ3A 2V5YA 3NAPA 1HKDA 3NKTA 4MOAA 5DAXA 3IAQA 4CDWA 4INDA 5CG9A 1AR73 1NLQA 4M00A 5SV8A 1DIWA 2R062 4IE0A 1NCRB 1V70A 4J1XA 4AG4A 1CD3G 1L7LA 4OLLA 3R4UA 5EZWA 1RIRA 1RUG1 3WPUA 3V65A 5FMCA 1RYYA 1KS5A 2WZR1 1LGCA 3J7HA 5GZFA 1AR91 4MGYE 1QY4A 3HNMA 4PT6A 1FV3A 4V1PA 3SH4A 2DCKA 3WNKA 3POSA 3WNXA 4XFFA 3WP4A 2RS32 1N1SA 3OBAA 5L19A 3KV5A 4PIXA 1UWWA 2FMDA 1DLLA 2YZ4A 4KU7A 4E9KA 3IM0A 2ID4A 1PHMA 4S2DA 2WNVB 3KT7A 4AHYA 3WUCA 2HWE3 2XVGA 2CU5A 2QTWB 5EPAA 4E8CA 1LOGA 2FBEA 2PHLA 4YZ5A 3AKFA 1WUVA 3WF0A 2WFF2 3I2DA 2ADEA 4GH4B 4MGKE 5C33A 4C1WA 4AGRA 1QOOA 1J1LA 1JN2P 3C3VA 1OUXA 3J7MA 3VHNA 1S0GA 3AM2A 5E89A 4AQSA 4JQTA 2D40A 1R1A1 2WR9A 4NRPA 1LJ7A 4YW6A 1O3QA 4BLIA 1LEDA 3PMEA 3FFQA 3OF1A 4NHKA 4B4PA 4EJRA 4Q4V1 2Y38A 4PQ9A 3PL0A 4U2AA 3LEKA 1GSLA 4XF0A 5K4LA 2VMDA 4DNYA 3PVOA 1TQ5A 2WSUA 4YVWB 1RJ8A 4WZFA 4FPHA 2GZWA 3WOGA 2DFBA 4AK3A 1CN1A 5HV0A 4XBNA 5HXVA 4OHZA 2AZ5A 1LU2A 1DCSA 3QCWA 2HYKA 3T2QA 3F95A 4AFAA 1OSGA 1JMUB 1FPN3 4CDQC 2FDHA 2PFWA 4LO4B 5HXMA 1DFQA 1XE8A 2GP5A 1Z7S3 3LFMA 1GOHA 1CWPA 1OA2A 1RMU3 4RN5A 4XE9A 3AKRA 2EAKA 3GYDA 4CDQB 4HBNA 3RZHA 1TE1B 3BALA 2VOXA 1EPWA 2XG3A 2ZABA 4XURA 1O91A 4LKSA 2W2IA 2P2KA 1CONA 4RGKA 5FPXA 5LZ6A 4AAXA 3KZ4C 5ABJC 2A75A 1COV2 3KB5A 4LT5A 2GC0A 3ABZA 1PNGA 2ZBJA 1MS1A 3HQUA 5KWRA 3T1LA 1ODMA 1HB3A 1OFSA 1W2NA 1BMV2 4Q4Y1 2GNTA 4O9GA 2WS92 4CCLA 4IV1C 1TMF3 3ZSLA 4DINB 2C5DA 2O14A 4YVSC 5I0DA 1WW4A 1GR3A 2Q5TA 4RFT0 2ZAAA 1LR5A 4NAMA 2VBDA 4H14A 4R9BA 4QQPA 1DDLA 1UCXA 4YGCA 5IFTA 2XHNA 2RM21 4FFGA 3IPVB 1QH6A 2A6WA 4YM0A 4YVSB 1OLME 5K8SA 1RUE1 2OZ6A 4JCKA 3RDIA 4CXXA 4IQPA 4UBHA 1W2AX 5FP9A 3T2TA 5GLPA 5FZ4A 5GM0A 4K7JA 5EIYB 3QC2A 2VVEA 2SLIA 2V72A 3KT4A 4Y1ZA 1LODA 1I9RA 1APNA 3VHRA 4MHUA 2P34A 3ST7A 3CL1A 5FBJA 3OM6A 1RUE2 4M3CF 5FZMA 5FQ0B 4NOTA 3BI3A 4YWAA 1RC6A 4BQ3A 3H42B 2GMEA 3MO4A 1OC1A 4N7UA 3AKHA 5T50A 4BQWA 1L7QA 4PI2A 1IPSA 2G9GA 5GALA 2AEYA 3OOXA 4CPBA 1F5FA 2D6NA 3USUA 2CV6A 3WG4A 2DBNA 2VUAA 1LTEA 5KC5A 1G9AA 3TN91 4B7KA 3HD8B 3N7KA 1LOEA 1R091 4URAA 4J6GA 5J37A 4RS5C 1J1TA 2BGOA 1HXS3 2O8OA 1PVC2 1J3QA 2WNUC 2RS51 3DXTA 4PI0A 2F17A 4CCMA 4CU8A 1C8NA 1XXNA 5IVCA 3H8UA 1DU3D 1UYYA 4EYUA 1QQP3 1R082 2MEV3 2OA2A 5LB6A 3T2OA 1H8TC 3H7YA 3TN92 4QD2A
chains in the Genus database with same CATH topology
3C7OA 3R67A 4U6DA 5JOWA 3D60A 4KC7A 4NOVA 3ZR5A 3LV4A 4KCBA 3VSFA 4UDGA 3AKFA 3WPVA 1UV4A 3U75A 3RWKX 4CCEA 2ADEA 3KSTA 2ADDA 3LDKA 5A7VB 3CU9A 1OYGA 4CCCA 3ZR6A 3AKGA 1YIFA 4UFLA 5FKBA 3BYJA 5AYCA 4N2RA 5GLMA 3VSRA 3LIGA 4JQTA 5B6SA 3LFIA 4N2ZA 4B1LA 3C7FA 4PVIA 4FFIA 3QEFA 4KMIA 3WPYA 4EQVA 3WN2A 5JOXA 1GYDB 5GLOA 5GLKA 3KF3A 1WL7A 1Y9MA 5GLNA 1YRZA 3VSZA 2QQWA 4KC8A 2YFRA 5A8CA 3IMMA 5A7VA 4AK7A 5FLWA 3VSSA 3WMZA 1Y4WA 1YI7A 4FFHA 2X8SA 3D61A 5FK7A 3OM7A 3C7HA 4UDJA 4O8NA 1W18A 3HBKA 3PIJA 3UGFA 3NMBA 3BYKA 5B6TA 2AEZA 3LEMA 2B4WA 5FMDA 4UFMA 5FMBA 4HXCA 4ONZA 1UYPA 3KF5A 3QEDA 5GLRA 3H3LA 5JOYA 2YFSA 2EXHA 3OSDA 3WN1A 4N1IA 2X8FA 4QQSA 3WMYA 3BYNA 2QQUA 4MLGA 4UFJA 3U14A 2VDTA 1GYEB 1Y7BA 3OM2A 3R4ZA 3OM5A 1PT2A 3VT0A 3LIHA 3WATA 3ZXJA 4UFKA 4UDIA 4B1MA 5FK8A 5GLLA 3NQHA 5ANNA 5GLQA 4KCAA 4UFIA 3P2NA 5JOZA 3LF7A 3PIGA 4FFGA 2EXJA 3WPZA 3ZXKA 3C2UA 5AY9A 3VT2A 3AKIA 3ZXLA 3S5QA 4U6BA 5GLPA 3C7GA 3QC2A 1GYHA 5FKCA 3WAUA 4PVAA 5FIXA 2AC1A 5AYDA 5A8DA 3UGHA 4UDKE 2X8TA 3C7EA 3OM6A 3D5YA 2EXKA 2YFTA 3QZ4A 3K1UA 3OM4A 3WASA 4D47A 4AZZA 1W2TA 3AKHA 3UGGA 1Y9GA 4AK5A 4QHZA 2AEYA 3U1XA 4UDKA 5C0PA 4COTA 3D5ZA 1VKDA 3SC7X 3VT1A 2EXIA 3WPUA 5AYEA 2OXBA 5FMCA 2QQVA 4N4BA 4AK6A 3BYLA 3WN0A 4O8OA 1ST8A 2XQRA 4FFFA 4UFHA 4O8PA 3LDRA 3QEEA 3TAWA 4CCDA 3R4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7O A;  3R67 A;  4U6D A;  5JOW A;  3D60 A;  4KC7 A;  4NOV A;  3ZR5 A;  3LV4 A;  4KCB A;  3VSF A;  4UDG A;  3AKF A;  3WPV A;  1UV4 A;  3U75 A;  3RWK X;  4CCE A;  2ADE A;  3KST A;  2ADD A;  3LDK A;  5A7V B;  3CU9 A;  1OYG A;  4CCC A;  3ZR6 A;  3AKG A;  1YIF A;  4UFL A;  5FKB A;  3BYJ A;  5AYC A;  4N2R A;  5GLM A;  3VSR A;  3LIG A;  4JQT A;  5B6S A;  3LFI A;  4N2Z A;  4B1L A;  3C7F A;  4PVI A;  4FFI A;  3QEF A;  4KMI A;  3WPY A;  4EQV A;  3WN2 A;  5JOX A;  1GYD B;  5GLO A;  5GLK A;  3KF3 A;  1WL7 A;  1Y9M A;  5GLN A;  1YRZ A;  3VSZ A;  2QQW A;  4KC8 A;  2YFR A;  5A8C A;  3IMM A;  5A7V A;  4AK7 A;  5FLW A;  3VSS A;  3WMZ A;  1Y4W A;  1YI7 A;  4FFH A;  2X8S A;  3D61 A;  5FK7 A;  3OM7 A;  3C7H A;  4UDJ A;  4O8N A;  1W18 A;  3HBK A;  3PIJ A;  3UGF A;  3NMB A;  3BYK A;  5B6T A;  2AEZ A;  3LEM A;  2B4W A;  5FMD A;  4UFM A;  5FMB A;  4HXC A;  4ONZ A;  1UYP A;  3KF5 A;  3QED A;  5GLR A;  3H3L A;  5JOY A;  2YFS A;  2EXH A;  3OSD A;  3WN1 A;  4N1I A;  2X8F A;  4QQS A;  3WMY A;  3BYN A;  2QQU A;  4MLG A;  4UFJ A;  3U14 A;  2VDT A;  1GYE B;  1Y7B A;  3OM2 A;  3R4Z A;  3OM5 A;  1PT2 A;  3VT0 A;  3LIH A;  3WAT A;  3ZXJ A;  4UFK A;  4UDI A;  4B1M A;  5FK8 A;  5GLL A;  3NQH A;  5ANN A;  5GLQ A;  4KCA A;  4UFI A;  3P2N A;  5JOZ A;  3LF7 A;  3PIG A;  4FFG A;  2EXJ A;  3WPZ A;  3ZXK A;  3C2U A;  5AY9 A;  3VT2 A;  3AKI A;  3ZXL A;  3S5Q A;  4U6B A;  5GLP A;  3C7G A;  3QC2 A;  1GYH A;  5FKC A;  3WAU A;  4PVA A;  5FIX A;  2AC1 A;  5AYD A;  5A8D A;  3UGH A;  4UDK E;  2X8T A;  3C7E A;  3OM6 A;  3D5Y A;  2EXK A;  2YFT A;  3QZ4 A;  3K1U A;  3OM4 A;  3WAS A;  4D47 A;  4AZZ A;  1W2T A;  3AKH A;  3UGG A;  1Y9G A;  4AK5 A;  4QHZ A;  2AEY A;  3U1X A;  4UDK A;  5C0P A;  4COT A;  3D5Z A;  1VKD A;  3SC7 X;  3VT1 A;  2EXI A;  3WPU A;  5AYE A;  2OXB A;  5FMC A;  2QQV A;  4N4B A;  4AK6 A;  3BYL A;  3WN0 A;  4O8O A;  1ST8 A;  2XQR A;  4FFF A;  4UFH A;  4O8P A;  3LDR A;  3QEE A;  3TAW A;  4CCD A;  3R4Y A; 
#chains in the Genus database with same CATH topology
 1WKY A;  2CHH A;  1CAX B;  1UAI A;  2NZ9 A;  3SLI A;  1AR6 2;  5ACA 1;  1ND2 C;  4KCB A;  1H8T B;  1HX6 A;  3NV2 A;  3FE5 A;  5AVA A;  4D6Q A;  4DEQ A;  1ZZ6 A;  2VQA A;  4WM7 A;  5FPA A;  3ROU A;  1ODN A;  1YCI A;  3KCC A;  4DOU A;  5GZE A;  1D0G A;  4K1Y A;  1ULF A;  4XJA A;  3ZR6 A;  2ZMN A;  2VH9 A;  3AMH A;  1TEI A;  2PHT A;  1EP0 A;  3PUH A;  3O0X A;  2JDK A;  1BBT 1;  1W06 A;  2ZEY A;  2X5I B;  4Q1P A;  3VKM A;  3BIW E;  4XF1 A;  1GYK A;  4QPI A;  5JSO A;  4LBJ A;  3H3Z A;  4BZ4 A;  1XNT A;  1JZ5 A;  4HKO A;  3ACI A;  2QQN A;  2VBB A;  4P9X A;  4DQA A;  2PHD A;  5CFC A;  2R6Q A;  2VAU A;  4OI2 A;  1UKG A;  3VBS B;  1ZRE A;  3EXU A;  3IIA A;  3DN7 A;  1NZC A;  2R04 3;  2W1Q A;  4TZD A;  2XHK A;  2WIN B;  2VL4 A;  4IEZ A;  2IVJ A;  2NPI A;  1E5S A;  3N9M A;  3GZE A;  3K77 A;  3VBH B;  4AI2 A;  4COV A;  4HVQ A;  4JAA A;  3O1U A;  3BYK A;  4WM8 C;  3J8F 1;  2BP6 A;  1RUH 2;  1PZ7 A;  2A73 B;  4JGY B;  3V64 A;  1PK6 B;  4Y5S A;  2VCM A;  2WLP A;  5FXX A;  1BVV A;  2QZ2 A;  1DYK A;  3HQX A;  5A6Z A;  2GNM A;  1ONA A;  3OGJ A;  5GJ6 A;  1JBC A;  4QX8 A;  3RZJ A;  2QJV A;  2JDU A;  3OSD A;  2DU0 A;  2OZJ A;  3V0A B;  4GB3 1;  1UU5 A;  4R9C A;  4Q4X 1;  4XQW A;  4NUB A;  4NPM A;  4EN6 B;  4O61 A;  1PT2 A;  4B4R A;  5F6K A;  4H3W A;  2CYF A;  3MIF A;  4OMD A;  4Z07 A;  2A3W A;  3RS6 A;  3UJQ A;  1PZ8 A;  3AX4 A;  4YG0 A;  1R1Z A;  3JCI A;  3PTR B;  3WG3 A;  5FO8 B;  3MLL A;  1O59 A;  5AC9 3;  3B01 A;  3QZ4 A;  2D97 A;  1RJ7 A;  1JYC A;  3AJZ A;  1GZT A;  1VRB A;  2BU9 A;  2P3K A;  2WII B;  4LUL A;  2EXJ A;  2WO2 A;  3ZXK A;  5JCT A;  5FPU A;  1YJK A;  3I8T A;  2DUQ A;  5CKN A;  4ZU4 A;  2C6S A;  3WQ1 A;  3NNG A;  2I2S A;  2W95 A;  1JYX A;  3QAC A;  2HYX A;  2QNK A;  4UAP A;  4Q0V A;  1JZ4 A;  1ZZ9 A;  1RUD 1;  2ZKN A;  1OH3 A;  3POF A;  5FYM A;  1CJP A;  4B29 A;  1PO2 3;  3PVB B;  5C5T A;  2IXH A;  4W65 A;  3AKS A;  3WUD A;  2ES3 A;  2Z79 A;  2IXK A;  1F8V A;  4K9S A;  4N8M A;  2ZGP A;  3K1U A;  5DUU A;  5A80 A;  1OQ1 A;  1W2O A;  3O12 A;  4FT8 A;  1KDM A;  5FPV A;  4AE2 A;  5KHJ A;  1MEC 1;  1RB8 G;  3ZN5 A;  5L73 A;  5I91 A;  1YNA A;  4CDW C;  1PGW 2;  4CDX A;  5C9A C;  3VDB A;  5H9P A;  1U5Y A;  5LA1 A;  4MG2 A;  3NAP B;  4CDW B;  2XJU A;  3VBO A;  4TN7 A;  3MFA A;  3SCH A;  3ZN6 B;  1UOG A;  5FZ9 A;  4BQY A;  2Y64 A;  3MI8 A;  1W9T A;  2UYA A;  3IN9 A;  3CHX A;  1Q8O A;  2JDZ A;  4AVB A;  5FYZ A;  5A6Y A;  5J09 A;  4PDW A;  1LRH A;  2V4A A;  2NLR A;  3D3A A;  1W3X A;  5FYU A;  3WEZ A;  2JDY A;  1BLZ A;  2GND A;  1AR8 1;  1RUC 3;  3N7L A;  4L0P A;  1LUL A;  4NPL A;  1JZ3 A;  3KD4 A;  1HN1 A;  1WW6 A;  1SBD A;  1SQ4 A;  3I2J A;  3KVA A;  1QJF A;  2VE1 A;  4DY5 A;  5HCA A;  4Q29 A;  3D5O A;  1QJX 3;  1RUF 3;  2OUJ A;  2Y6H A;  3D8C A;  3OBT A;  4GZ9 A;  4LE4 A;  4RQP A;  4KG0 A;  3WXP A;  1JU4 A;  4IEU A;  4IW3 A;  3CU9 A;  4JTN A;  3DL3 A;  3WW4 A;  1TNR A;  1GLH A;  2DVD A;  2HEY F;  5EQU A;  5FR3 A;  3AMN A;  4L99 A;  1W99 A;  1MQT A;  3LD8 A;  1AR7 1;  3ZYH A;  3VSR A;  1ZZC A;  4GKX A;  2DFC A;  2YU1 A;  2BNO A;  1HDK A;  1OOP A;  1K3I A;  3GBW A;  4NWV A;  3RMY A;  2W91 A;  3KCY A;  3UET A;  4LIT A;  1JYT A;  2P4E A;  4R8H A;  4OZX A;  1ZBA 3;  4XIK A;  4N43 A;  3FHA A;  2OYZ A;  1OD3 A;  3VKL A;  4MYE A;  5A7V A;  3CJX A;  1VBE 3;  3ZXA C;  1D2Q A;  2PMW B;  2YPD A;  1JUI A;  1V6J A;  2YHJ A;  1W39 A;  3HQR A;  2XPJ A;  3WMZ A;  1ENX A;  4QKB A;  4BQ4 A;  3C7H A;  1RGS A;  3AL5 A;  4OUM A;  5CFD A;  1WLT A;  1RIT A;  3I97 A;  1GQG A;  3J7L A;  1QJU 3;  4FQ4 A;  4FTS A;  1NE4 A;  5EJ1 B;  1EV1 3;  2HWE 1;  4LTA A;  3KQR A;  4FPL A;  4Z1V A;  1GKB A;  5DQ0 A;  1E5H A;  3GHM A;  1JZ6 A;  3T0D A;  2YBS A;  4KH9 A;  1UYP A;  3APB A;  3QED A;  3WQ0 A;  2Z4F A;  2R7E B;  2J22 A;  3PVE A;  2FHR A;  2UWB A;  3ES4 A;  4QQL A;  2RDS A;  3B9C A;  2WNO A;  4OI4 A;  4RA0 A;  4UFJ A;  3VV1 A;  2RMU 3;  2CGN A;  4LBO A;  3HT2 A;  2ZGN A;  3WAT A;  3RWN A;  3ZXJ A;  2OKX A;  3AZW A;  4HON A;  3I2G A;  1IS4 A;  3QD6 A;  1XNK A;  2WUH A;  5BPX A;  3FMG A;  3KWV A;  2YFZ A;  3WDU A;  4QXC A;  4I09 A;  1ACC A;  1OI6 A;  3AKP A;  4GWN A;  5LY2 A;  4LKF A;  1DYO A;  3P2N A;  1WA6 X;  2ZGU A;  1R64 A;  4YM1 A;  2KA3 A;  3DYM A;  4OHX A;  2PQQ A;  4CP9 A;  1UPS A;  2Y0O A;  2ZEX A;  1RVF 3;  3N35 A;  5DUX A;  3RYK A;  5F32 A;  2ILM A;  1FPN 1;  2GN7 A;  2D3R A;  3I3M A;  3KSC A;  4XJZ A;  5IUQ A;  1Z7S 1;  1IQA A;  1RMU 1;  3VBF C;  5AYD A;  4FXK B;  1ULE A;  3OJB A;  3UGH A;  1GNY A;  2CAU A;  2BNN A;  4XAE A;  2HEW F;  2WJS A;  5FYT A;  4QQ2 A;  3RJ2 X;  2BPA 2;  2X05 A;  3QH6 A;  4FPC A;  2XVL A;  5IJR A;  5T54 A;  2VVD A;  1AJK A;  3AZX A;  4AK5 A;  3UGG A;  4MET A;  3ZXE A;  2PAE A;  2K2S A;  2J1E A;  2YC4 A;  4AI1 A;  1W8U A;  2AEN A;  4YZ1 A;  3AKQ A;  1W6N A;  2RJK A;  2WRA A;  5FZ7 A;  4OHY A;  2WZR 3;  1S0E A;  1X8M A;  3OGV A;  2JIG A;  1A78 A;  5CAD A;  2DBI A;  5GZC A;  1TME 3;  2VNR A;  1TMF 1;  3ZFE C;  2EXI A;  1UZW A;  2PLV 2;  2RJ2 A;  2WYF A;  1X36 A;  1BVP 1;  2VMI A;  4FPF A;  4MVT A;  1XRU A;  1PO1 2;  3USU B;  4KQ7 A;  1H2M A;  5DZF A;  3T0B A;  3MZH A;  1UXX X;  1MVQ A;  1HRV 3;  3C7O A;  3K3O A;  4EWE A;  1JHJ A;  4K40 A;  3TOJ A;  3WVJ A;  1HV1 A;  1UZ0 A;  3OGG A;  5LBF A;  2VM9 A;  3SEE A;  1E5I A;  3WV6 A;  4EE2 A;  5KXD A;  5A7N A;  1CZS A;  1D7P M;  1WD3 A;  1YQ2 A;  1K12 A;  4ZXE A;  2ZGT A;  3J9S A;  4EWD A;  4WM7 C;  3VBU A;  3CKH A;  3RFR A;  4DIQ A;  1SLA A;  2VO5 A;  4M4P A;  2VMG A;  2G4I A;  3KV6 A;  4HK8 A;  1VBA 1;  2WA3 A;  4Q4V 3;  3M3E A;  4IE4 A;  4FOY A;  4QU2 A;  1LB2 A;  3EHK A;  2C26 A;  1IS3 A;  1AUY A;  4DXT A;  1PMJ X;  1H6Y A;  2BDR A;  3CF6 E;  3PUS A;  4MGI E;  1W9S A;  4FOW A;  4A3Z A;  3W9A A;  5C8C A;  1GYD B;  4A3X A;  4NRQ A;  2WNV A;  5FYS A;  2BWA A;  4MH0 E;  3GZU C;  3NJY A;  5GZD A;  1KD7 A;  4FPG A;  4UI9 L;  5I8T A;  1FAT A;  3K75 B;  3NVC A;  4GIQ A;  5CFC C;  3VDD C;  1QQP 1;  5A8C A;  2MEV 1;  4QPI B;  2VNG A;  5FO7 B;  1QJY 3;  1H1M A;  5FLW A;  5FZG A;  3GM8 A;  3JD7 2;  5E88 A;  1Y4W A;  1NA1 B;  1YC6 1;  2YYO A;  4COZ A;  1FOD 3;  3MLJ A;  3D61 A;  2HJI A;  1HXS 2;  5F3E A;  4CCO A;  5CFC B;  1RED A;  4P00 B;  4XFH A;  2B42 B;  2VZO A;  4Y1Y A;  2Y34 A;  1OKO A;  2FDG A;  2MNG A;  2VGD A;  3HVD A;  4AI0 A;  2RG4 A;  3IZO A;  3WP5 A;  5BNN A;  4B7E A;  5FMB A;  2W92 A;  3HNY M;  3NNM A;  4KWJ A;  3BOD A;  2O1Q A;  4CDU A;  2BTV C;  4CUG A;  1UOF A;  1A34 A;  5GLR A;  5JOY A;  1PIV 1;  1OPO A;  4Q4Y 3;  3CO2 A;  2JG8 A;  4GMP 0;  5JLV A;  1ZRF A;  4QQS A;  3OCP A;  4B4Q A;  1ZVF A;  3ZSM A;  2ZX2 A;  3UT0 A;  1S0B A;  3MIG A;  1OH4 A;  1XOY A;  1VE0 A;  1O5U A;  4W6X A;  4ATE A;  2FDK A;  2ZAC A;  1Q8V A;  5DZG A;  1Q3E A;  3LCP A;  2XKO A;  3ZMO A;  5ANN A;  2YY1 A;  1SBF A;  4BOW A;  1C28 A;  1LEM A;  2RE9 A;  1K45 A;  3JBG 2;  4ZU7 A;  1RUI 2;  5F3C A;  1PVX A;  2P1B A;  3LF7 A;  4ATF A;  4WVZ A;  5IT6 A;  2R04 1;  4LHL A;  5A7Q A;  3AYD A;  2QQJ A;  4LBN A;  3S5Q A;  3ZMN A;  3L9J T;  1LHN A;  3PUQ A;  5K0U B;  3AVR A;  3OUJ A;  5DN2 A;  2WQ4 A;  2AC1 A;  3VZL A;  1G9C A;  3UK9 A;  1NT0 A;  5FXZ A;  5IVJ A;  5IK5 A;  3DXU A;  3C7E A;  3HNB M;  4JKM A;  4YW4 A;  5FYV A;  1WLW A;  4XHB A;  3WAS A;  3ACG A;  2F4P A;  4RHV 3;  1AYM 1;  2WWJ A;  2HWF 2;  3WQB A;  1R09 3;  4NHX A;  4JGZ A;  1UYX A;  5DDJ 3;  3E5X A;  4A6S A;  1JOJ A;  2JEN A;  3O0V A;  2A6V A;  2HWB 3;  3M2M A;  4IEY A;  4OCT A;  5HI0 A;  4ISR A;  1XSR A;  1HN0 A;  2RHP A;  4XW3 A;  5IAV A;  4QPG A;  3USS A;  3WY6 A;  5AC9 1;  4BHP A;  1H0B A;  3VBO C;  1JHN A;  4LBL A;  4CDX B;  2X09 A;  3H1M A;  1H9P A;  2X29 A;  4H55 A;  3ASI A;  1GU3 A;  2QQI A;  1EUU A;  4QHO A;  3VBO B;  2EAA A;  1PX3 A;  4PDW C;  1DG6 A;  3K48 A;  1EAH 3;  2VMF A;  4KC7 A;  1Y9Q A;  3U11 A;  2JDN A;  2XDV A;  4QX7 A;  5BNP A;  3ZOI A;  4PDW B;  1WMD A;  3OGR A;  1PO2 1;  2XJV A;  2CWM A;  4YZ3 A;  1IOA A;  4RQP C;  3RWK X;  1GAN A;  1BK0 A;  5IK4 A;  1GV9 A;  3VN4 A;  4QKF A;  1KXG A;  1ZA7 A;  3BTY A;  5FKB A;  3HOB A;  1JUH A;  2LRO A;  3OB8 A;  3GF6 A;  3VD4 A;  1MQT C;  2A70 A;  2D3P A;  1YLL A;  1WCD J;  4CEW A;  3C7F A;  5DUV A;  4FFI A;  4Q4W 2;  3QEF A;  1DGW A;  5FUN A;  3M70 A;  4EQV A;  4EN7 B;  2XOM A;  2W9X A;  1MQT B;  1NYW A;  4YM3 A;  2E26 A;  2BVB A;  2WT0 A;  2CWS A;  4E2G A;  3VSZ A;  1YRZ A;  2WDB A;  1OOP B;  4BJ0 A;  2NMO A;  1UW8 A;  3L2Y A;  5T3N A;  4CCK A;  1X9T A;  4AEK A;  1CR7 A;  5CAZ A;  2P37 A;  1RUC 1;  4N43 B;  1ULO A;  1A8M A;  1LES A;  1SHW B;  5DAB A;  3KV9 A;  5BNO C;  3NMB A;  4KL1 A;  5CFD C;  2CGP A;  3DUI A;  1UL9 A;  1QJX 1;  1RUF 1;  1CZT A;  4QX5 A;  3ZFG A;  3WP6 A;  5KXB A;  5A3M A;  4Y33 A;  3BTZ A;  3D0S A;  2WSV A;  3P3N A;  2A6Z A;  1CIY A;  4CUC A;  4Q27 A;  1UZV A;  3HMY A;  1VJ2 A;  1W8W A;  1UOJ A;  4AVC A;  2W52 A;  1W9Y A;  2Q4S A;  2RS1 2;  1CES A;  1FT9 A;  4XCA A;  4XF3 A;  2QQM A;  4AGG A;  1SLI A;  4RL7 A;  3SIS A;  3WHT A;  4LK6 A;  2ARE A;  1SFY A;  2FCU A;  4YW2 A;  3K4Z A;  4YGB A;  5CBL A;  2OVU A;  3E97 A;  1ZBA 1;  2D98 A;  2ZGK A;  4JGY A;  4XFI A;  1F35 A;  3OEB A;  1FNZ A;  1NLR A;  2I07 B;  4QHB A;  5IWF A;  3RQ0 A;  4CTE A;  4YZ2 A;  1ZBE 3;  1JYN A;  2Z42 A;  3WD5 A;  1U5X A;  3V0A A;  4IGP A;  3ETP A;  1LHV A;  1ZBA 2;  2L9L A;  3JUU A;  4PF5 A;  5JXG A;  4AED C;  5C7G A;  1FYU A;  1QJU 1;  3FUQ A;  4ZU5 A;  4A44 A;  3PTY A;  1EV1 1;  2RDN A;  1ZRR A;  3U4S A;  3O1O A;  4CP9 B;  4LO6 B;  3DF0 A;  1FX5 A;  1LGB A;  1VBE 2;  2K9Z A;  1MEC 3;  3K4A A;  5EV7 A;  4P5H A;  1VB4 A;  2JE8 A;  4D7S A;  1IG3 A;  2Z5W A;  2XUM A;  1OD5 A;  4AAP A;  1EV1 2;  1ASJ 2;  5FY9 A;  5A70 A;  1LEN A;  2RMU 1;  1UYZ A;  1DQ5 A;  3NV1 A;  4N53 A;  3ZFF A;  1DF0 A;  4QX2 A;  3SHR A;  4Z2A A;  2XBO 2;  1UY0 A;  2QQK A;  5IK7 A;  1HQL A;  4Q0P A;  1IG0 A;  3BYW A;  4A42 A;  1W6N B;  1NKG A;  1J3R A;  4QPW A;  4AVS A;  2R30 A;  4IUG A;  3QH7 A;  4LIU A;  1QXR A;  4CCD A;  3WNL A;  3BN6 A;  1RVF 1;  4XUN A;  3R67 A;  1W6M A;  1UY3 A;  3J26 N;  1DZQ A;  2IWG B;  4Y5T A;  1JZ8 A;  3HEI A;  3ZR5 A;  3V0B A;  3ES1 A;  3SQO A;  3LAG A;  4CCN A;  1NCR C;  4XIO A;  4O65 A;  2HBU A;  1HB1 A;  5FY8 A;  3I2H A;  4D7T A;  3RGB A;  1RVF 2;  4LO5 B;  3ZN6 A;  1MS3 A;  3S30 A;  1C8M 2;  3T3Y A;  2DUR A;  4Z92 B;  1VBD 3;  2IXJ A;  1ENQ A;  1HLC A;  2VXR A;  2VD7 A;  5FZ6 A;  2XON A;  1O5L A;  2ZCW A;  3ZIX A;  5AFE A;  3KCX A;  1X8E A;  2R1D A;  3VBU B;  4LR4 A;  3A0K A;  4ORF A;  4AL9 A;  1YQC A;  1TME 1;  1K42 A;  3GJA A;  3GAL A;  1HB4 A;  2A3X A;  2VZS A;  1J84 A;  2JDM A;  2KD7 A;  5ABJ A;  4F3J A;  3ZX7 A;  2WNV C;  5JUV A;  2VME A;  1AX2 A;  3I2O A;  5KHH A;  1FMD 1;  1RUG 2;  2QCS B;  2VY0 A;  3CBN A;  5LBE A;  2WZR 2;  2B8M A;  1AR9 2;  3HAG A;  1HRV 1;  4GH4 C;  2O0O A;  5C8C B;  5FXW A;  3X29 B;  4FAH A;  1J3P A;  4LMF A;  1VMH A;  4FTB A;  1LOA A;  4JKL A;  1RXF A;  4O8N A;  1FI2 A;  3HBK A;  5FMO L;  1V6N A;  3OUI A;  4ZXK A;  5F7U A;  1NAE A;  3S7E A;  1F4H A;  2R0H A;  2HKX A;  3LEM A;  4GA9 A;  1BEV 3;  4MGZ E;  4COW A;  3IB3 A;  3WLU A;  1HRV 2;  4BK5 A;  5BV6 A;  1OKQ A;  2Y6G A;  5CVR A;  2XUE A;  3T09 A;  3WF4 A;  5C3P A;  2WT2 A;  4E4H A;  3WW2 A;  5I0S A;  1SLB A;  3H0O A;  5C71 A;  1NCQ A;  4CDU C;  3RRD A;  1KEX A;  1OUS A;  4YVW C;  5JMO A;  2ARA A;  4MAD A;  4RGG A;  4Y22 A;  3BU7 A;  5BNN B;  1W28 A;  2DCY A;  1GYE B;  3CMG A;  5LK5 A;  2J1A A;  4CDU B;  5J7M A;  1OF4 A;  3M8L A;  3JXS A;  2WFP A;  5HCH A;  1R1A 2;  2JG8 B;  2Z2S B;  5EYX A;  4P08 A;  1BKZ A;  2VOK A;  2Y26 A;  1NLS A;  3SCG A;  4YPJ A;  4Q4V 2;  3WCS A;  4Q8K A;  4XBQ A;  2F4L A;  1PNF A;  1QJY 1;  3MF6 A;  5EXO A;  1GWM A;  3VT2 A;  3AKI A;  3OPZ A;  4Y4R A;  4LHS A;  1UMH A;  1W6Q A;  1FOD 1;  2HWC 3;  4IEV A;  4IXL A;  4NIH A;  2GDF A;  2VOW A;  4CU9 A;  3QOP A;  4ONU A;  4XYX A;  1BCX A;  5FYB A;  1GYH A;  3WAU A;  2QQO A;  3GCX A;  1GUI A;  1OLM A;  1LOF A;  2J1V A;  4C91 A;  1QJY 2;  4QU1 A;  4DEV A;  1ULG A;  4NHM A;  3D5Y A;  1VP6 A;  2IXI A;  5T5P A;  1UNB A;  2XWB B;  3VDA A;  5B4X A;  4M0H A;  4QX0 A;  1LNS A;  3DYP A;  3BTX A;  2VW0 A;  1OXC A;  4KBB A;  2DUO A;  4JGZ C;  2C9K A;  5FUI A;  3D5Z A;  2RVA A;  4FPK A;  5K9Y A;  2ORZ A;  3NJV A;  1ENS A;  2FCT A;  5CA6 A;  2D5H A;  1V6O A;  2JEC A;  1UIK A;  3SKJ E;  3E6D A;  4Y4Y A;  4Q4Y 2;  4JGZ B;  3S6P A;  3WDW A;  5FOJ B;  4AK6 A;  5DG1 A;  3HPN A;  1ST8 A;  4Y24 A;  2ZHM A;  4UWD A;  2WO7 A;  5F5C A;  4JRL A;  1W04 A;  3R0R A;  1O8P A;  1T2X A;  2ORX A;  4QPG B;  4RGA A;  3N3H A;  5FYI A;  4WVW A;  1MZE A;  2RM2 2;  4U6D A;  1W8H A;  1US2 A;  3LSE A;  2B7Y A;  5J36 A;  5FY0 A;  4E2Q A;  2K0G A;  3I59 A;  1NY7 1;  3NNJ A;  2GSY A;  4NII A;  1SFP A;  3O0W A;  1VBA 3;  1AHS A;  5CZK A;  2XJT A;  3LA3 A;  2ADD A;  3PJQ A;  4U36 A;  4AGV A;  4AOC A;  4CZS A;  4RHV 1;  4CCC A;  2RR1 3;  5BNP B;  3OG2 A;  3U37 A;  2JIC A;  4OUS A;  3JZV A;  1S4C A;  3LIG A;  5DDJ 1;  1F9K A;  3FHQ A;  2V4V A;  2VTX A;  2BOI A;  2XGX A;  2R0F A;  5F5A A;  3UV9 A;  4BMB A;  3O1V A;  4HLT A;  2HWB 1;  4AXO A;  3LSD A;  4AFM A;  4ASM B;  2JEM A;  4N9H A;  2E33 A;  1VAL A;  4R4X A;  4W8J A;  2V73 A;  1RUJ 3;  5IW0 A;  3VB9 A;  2BNM A;  4A7Z A;  1R09 2;  1OMI A;  3BOP A;  1AL2 3;  3IDA A;  4CEW B;  3DKQ A;  2QQW A;  2R07 3;  4FP3 A;  5CYY A;  5DDJ 2;  1F2N A;  4RR3 A;  3WG1 A;  4P5Y A;  2RS5 2;  4WVM B;  3W5N A;  4S2G A;  2WBK A;  2HWB 2;  4PBO A;  2FD8 A;  1VLN A;  1EAH 1;  1VAM A;  4HT1 T;  1OPM A;  2RJL A;  4QKD A;  4UDJ A;  2XLA A;  3JQX A;  2WC2 A;  3AXE A;  2EF6 A;  1WZX A;  2X5I C;  1S1A A;  2ZHL A;  3RYR A;  1YQ8 A;  1PIV 3;  5ACA 2;  1V6I A;  5F39 A;  3VBR A;  2NP0 A;  4Q26 A;  3KF5 A;  4YZ4 A;  3N7J A;  2W39 A;  2ZHK A;  1XNC A;  1YEW A;  5C4W A;  3MID A;  4AFB A;  4BXF A;  3THD A;  3VUO A;  3G6J B;  2VG9 A;  3VBS C;  3BYN A;  3A23 A;  3BUC A;  3N9L A;  5F3I A;  3ZFG B;  2VDT A;  1NA1 A;  1Y7B A;  4XTP A;  5T5L A;  3OM2 A;  5FLJ A;  1HIX A;  3VZN A;  3ZIW A;  3DPR A;  4DUX A;  3O1S A;  3NW4 A;  2XR4 A;  3VBH C;  1BBT 2;  4IE5 A;  2B46 X;  1DQ6 A;  5D8A B;  1H2K A;  2IXL A;  2ET1 A;  4JGY C;  3B3Q E;  1PK6 C;  1Y3T A;  3AMM A;  1NQD A;  1I1E A;  4KG8 A;  3WDY A;  4HN0 A;  2A6X A;  3ALQ A;  5AY9 A;  4W6W A;  2I74 A;  2E7A A;  1U0A A;  5FRA A;  5H9S A;  4RFR B;  1YQ6 A;  2CTV A;  3OD4 A;  3ATG A;  4IEW A;  3AZV A;  3T2P A;  5JSR A;  2ZPX A;  1IS6 A;  5E1R A;  2ZML A;  3K3N A;  3ENR A;  3RZK A;  4JDM A;  4UDK E;  1AYM 3;  1AX0 A;  3AKT A;  3J8F 2;  4P9L A;  1G86 A;  3S57 A;  1IGO A;  4DXZ A;  1H30 A;  2YRO A;  5JPN B;  3BPS A;  4NR1 A;  1SZB A;  4TWT A;  1QXJ A;  5T5O A;  5JI9 A;  2NM1 A;  2GN3 A;  4QHZ A;  3ZO0 B;  3VD5 A;  4K1Z A;  4HKW A;  2VXJ A;  5IVF A;  1LHU A;  1ZRI A;  5FBZ A;  5K0U A;  1S0F A;  4K8R B;  1Q5O A;  4GB3 2;  4XJU A;  1B35 A;  1D4M 3;  4Q4X 2;  4N53 C;  5JAX A;  2XL7 A;  5AYE A;  2W87 A;  4CEY B;  1O3S A;  4N4B A;  3AMP A;  2E31 A;  5E8A A;  4IE7 A;  2IFR A;  5SV5 A;  1U5Z A;  1ZBE 1;  4OMC A;  2XB6 C;  4N53 B;  3ZFF B;  4ISQ A;  1YQ5 A;  5FJK A;  3TAW A;  3LWC A;  3B5L B;  3III A;  1YFU A;  1S0C A;  3WNM A;  1LAJ A;  3R4Y A;  3WIN E;  5FZC A;  4IDZ A;  2EA7 A;  2B9U A;  4HK9 A;  4JDN A;  1JOB A;  4AFC A;  2KM2 A;  1QOT A;  5DPN A;  5KHI A;  1H8V A;  1UOB A;  5A7P A;  1KFU L;  3B9I A;  3H8R A;  1W6M B;  5LA0 A;  1ULP A;  3HN3 A;  3NAP C;  3Q8C A;  4MXV A;  2W5F A;  3RZG A;  1RUD 2;  1STM A;  2D3S A;  3V0B B;  1ND3 B;  1W0N A;  4UFL A;  4KMQ A;  1G9B A;  3MGU A;  4XQD A;  3FLR A;  5ERL A;  1J58 A;  1GFF 2;  3I2K A;  4HET A;  1MEC 2;  4HKL A;  3VHO A;  4QQH A;  2Q1M A;  2BBA A;  2WN3 A;  5FZI A;  3WPY A;  3BOW A;  1GQH A;  4QDR A;  3MW4 A;  4FBF A;  2OS2 A;  2GU9 A;  5D1I A;  4LIV A;  2D44 A;  2CNA A;  1YWK A;  2HWD 3;  3AMQ A;  5A3W A;  1A6C A;  3WF1 A;  1XE0 A;  2MPF A;  3MYX A;  3LOB A;  1UPI A;  3B93 A;  1QXP A;  4B3N A;  1NUK A;  4I30 A;  4AK7 A;  5ABJ B;  2DVB A;  2BEO A;  1HRI 3;  2ARC A;  2VQT A;  1EY2 A;  3PUI A;  4FP2 A;  5J1X A;  1S0I A;  5IK8 A;  2YBP A;  3RNS A;  1H1A A;  3WW1 A;  2YGL A;  1AR8 2;  3WDV A;  4YFW A;  3CJI B;  4LOR A;  4I3G A;  4BXS V;  1CX1 A;  1REF A;  4UFM A;  5BXX A;  2DWR A;  1OQE A;  1XBF A;  1VBD 1;  3ORJ A;  4S2F A;  5DXD A;  3J7N A;  4N1I A;  3VZJ A;  4J1W A;  4YW5 A;  4E4D X;  2GH8 A;  3HJR A;  5ANQ A;  5CB7 A;  2D93 A;  1AR7 2;  1DZT A;  1N1V A;  3RYP A;  1NCQ B;  2F6B A;  3AZZ A;  3M3I A;  4HPK B;  5IAT A;  4IEX A;  1DBN A;  2CSG A;  2E7Q A;  2BOJ A;  4Y22 B;  3AXD A;  5D21 A;  5FPB A;  2H0B A;  1QNY A;  3BKZ A;  5TSW A;  1I5Z A;  4EN0 A;  4XC9 A;  2FCV A;  4COU A;  1ZRD A;  2VZ1 A;  4IET A;  4LK7 A;  3GXU A;  2Z69 A;  1B09 A;  3NJZ A;  5AFB A;  2FDI A;  1RHI 3;  2ZMK A;  3GZT B;  3ZYR A;  1OF3 A;  1SLL A;  1BEV 1;  1NQJ A;  2WNE A;  2J1U A;  4YSF A;  1W6Q B;  4M3C E;  1LOF C;  4XAC A;  1US3 A;  2JKX A;  3QBQ A;  1SLC A;  2PHW A;  1YFW A;  2HWE 2;  2XQX A;  1ZA4 A;  2D7F A;  2YXS A;  3POY A;  4Q1R A;  4XXA A;  2PAM A;  2Y8K A;  5DAQ A;  4JVA A;  3VKO A;  5A3N A;  5A7W A;  1DHK B;  2YU2 A;  3LA2 A;  5KHG A;  3H8X A;  3OTF A;  5C3R A;  1VBB 3;  4NRO A;  4JZR A;  5EP9 A;  1W9W A;  3ILR A;  4FQZ A;  1RUO A;  3N9Q A;  2OUH A;  2ET7 A;  4ZPI A;  1JW6 A;  2B4K A;  5JSP A;  4HG6 B;  2VC9 A;  4BME A;  3AL6 A;  4O8O A;  2DVA A;  2EID A;  4P14 A;  4D0Q A;  2W1W A;  2WZP P;  4CU7 A;  4QXK A;  2HWC 1;  4AEM A;  4NIG A;  4XBL A;  1JOP A;  1Y43 B;  1ZZ7 A;  4ES9 A;  3AP4 A;  4DFS A;  2Q30 A;  1FPN 2;  1KGY A;  2EIG A;  5K7P A;  1VBC 3;  4HSJ A;  2B39 A;  1Z7S 2;  2VOV A;  3WZ1 A;  1MVE A;  2EIB A;  4IV3 B;  1RMU 2;  2ETE A;  2HWC 2;  5A7O A;  3U75 A;  4FO9 A;  5JXJ A;  1N1T A;  3H8O A;  1CJD A;  4SBV A;  4M0N A;  3AKG A;  3TAY A;  1YIF A;  2R06 3;  4YRD A;  3BYJ A;  3I59 B;  4UT5 A;  1O6U A;  4PF1 A;  4F7Z A;  1UKR A;  2XVK A;  3ON7 A;  5FYC A;  3THT A;  4JX0 A;  1FMD 3;  3PUA A;  3O7O A;  1DLC A;  5LEJ A;  4XFG A;  5DUW A;  2DUP A;  4OFG A;  3N36 A;  5F8P A;  1WWY A;  1CZV A;  2G9F A;  1TMF 2;  2ZOE B;  3KF3 A;  4ASL A;  4OI1 A;  1V9U 3;  4PHZ A;  2RS3 3;  3DKW A;  4CA9 A;  4GXL A;  1M06 G;  4MX3 A;  3RJR A;  4N9I A;  4RR3 C;  3OBR A;  1YI7 A;  2XKP A;  3H3U A;  2Y6L A;  3T4H B;  3AP7 A;  5FPZ A;  1OQD A;  5L7O A;  1XSQ A;  4RR3 B;  5KR7 A;  4LO7 A;  1UZZ A;  1TVG A;  4WBB A;  2E6V A;  5B2G B;  1W05 A;  4GMP 3;  3BVC A;  3M3O A;  2VZU A;  1XNA A;  4EWA A;  3IDB B;  3PMS A;  2Y33 A;  1WME A;  1YUD A;  2RR1 1;  5FYY A;  2YFS A;  1RXG A;  1S2K A;  2Q8D A;  2JD4 A;  3ACH A;  2X8F A;  3K51 A;  4CCJ A;  2ZX1 A;  4QPI C;  2J1S A;  4I0W B;  1WMF A;  2WAO A;  3VBR B;  3WDX A;  2WT1 A;  3ZYP A;  1NA1 C;  1VBA 2;  3TRS B;  3H9A A;  3O14 A;  5C4W B;  2JWP A;  4PLO A;  4UW3 A;  5FDB A;  3U4X A;  3E5U A;  1V6K A;  1OA4 A;  3N9P A;  4DUV A;  1RUJ 1;  5G04 L;  2E9Q A;  5GLL A;  1AL2 1;  4B8E A;  5F1R A;  3NO8 A;  5IVE A;  1QH7 A;  2R07 1;  2VUJ A;  1XNB A;  3DPR B;  3MW2 A;  2VTF A;  3ZSE A;  3PIG A;  4YGD A;  1VMF A;  3TYJ A;  4BQ5 A;  4UW5 A;  5J96 B;  3WPZ A;  3C2U A;  4XIL A;  3ZDV A;  5LRS A;  3LOI A;  4C1X A;  1EYB A;  1QQP 2;  5JWP A;  2MEV 2;  4LPL A;  1SBE A;  1S0D A;  2VU9 A;  5DMY A;  3CZJ A;  4Z82 A;  3C7G A;  2FMY A;  1W8Z A;  2FZ2 A;  3U78 A;  3LKJ A;  5FKC A;  5LCW L;  2VR4 A;  4C0H A;  1MPX A;  4KU8 A;  3AZY A;  2X8T A;  3W5M A;  5CIS A;  3KV4 A;  5GLT A;  1J59 A;  2I45 A;  5A7S A;  1COV 3;  4XPV A;  3OM4 A;  1UY4 A;  4AZZ A;  2R16 A;  1W2T A;  4UXA A;  1DGL A;  3VKN A;  3Q8A A;  5C3Q A;  1LOC A;  2WS9 3;  1PIV 2;  3GDB A;  4P9G A;  3POI A;  1ZX5 A;  5A6X A;  3JU9 A;  4HFS A;  4C8D A;  5K0U C;  1QIQ A;  4BIF A;  4V2V A;  5FPL A;  4LEJ A;  1GP5 A;  3FBM A;  4O8P A;  1CPM A;  2VUD A;  2WO3 A;  1B35 B;  5FXV A;  1AXY A;  1C4R A;  1L7R A;  4H2A A;  1UD1 A;  2QDR A;  4HN1 A;  3VZM A;  3N9N A;  2AR6 A;  1CAW A;  2R04 2;  3R6S A;  1F4A A;  3FUO A;  1UQX A;  1WW7 A;  3VSF A;  5JIA A;  1WCS A;  4OUE A;  1E5R A;  1QEX A;  4E8D A;  4UDG A;  1WCK A;  4IEQ A;  4CE8 A;  2ZGR A;  4CCE A;  3KST A;  4DMI A;  1C5I A;  3RZZ A;  3ZPO A;  4CDX C;  2GC2 A;  5FLI A;  2E7T A;  1MS9 A;  1WBL A;  1ALY A;  3IDC B;  1NOV A;  1BHG A;  1W8N A;  1CAU A;  4N2Z A;  1AYM 2;  2ZGS A;  2GH2 A;  1W3V A;  1D4M 1;  2WLQ A;  1PVC 3;  2OT7 A;  2Q1Z B;  3OYW A;  4JV4 A;  3C8X A;  3R4D B;  1XC6 A;  5H9Q A;  1R08 3;  4X8P A;  4IV1 A;  5AC9 2;  1GZW A;  1WA4 A;  1LU1 A;  1N3P A;  4NAO A;  1AR6 3;  1VAV A;  4RD7 A;  3KM5 A;  5FLH A;  5KC6 A;  3SNM A;  5FK7 A;  4FSJ A;  3OM7 A;  3I54 A;  1W18 A;  4NWW A;  3PIJ A;  4OZO A;  3WHU A;  3MUZ 1;  2RDQ A;  1HB2 A;  3BU0 A;  5B6T A;  4D7Y A;  3B02 A;  3TEY A;  2PXJ A;  2W3J A;  4DRV A;  1G8W A;  1G6N A;  2PHU A;  2ZX0 A;  1U12 A;  4J25 A;  1PO2 2;  1JZ7 A;  2JIJ A;  3RI9 A;  4YFZ A;  4QXB A;  4NN0 A;  4PLN A;  4WVM A;  1OOP C;  5EHD A;  3P5B A;  3GCW A;  2XLG A;  3M3C A;  3I7D A;  5FZL A;  4IGQ A;  2UWA A;  4N43 C;  4LBQ D;  3SIT A;  2D6M A;  1P8J A;  2VTX J;  3POE A;  5T5J A;  4LUK A;  2HWD 1;  2TBV A;  4B1M A;  1DZR A;  3IMN A;  4NHL A;  5L9R A;  4AEJ A;  3OBZ A;  3R05 A;  4ZKT B;  4F83 A;  1YXW A;  1CAV A;  4KCA A;  1PMI A;  2P6H A;  4RS5 A;  4AR2 A;  1G9D A;  3VD9 A;  4D3W A;  3ME2 A;  2WNU A;  3ZXL A;  1VR3 A;  4GQ7 A;  4L11 A;  1HRI 1;  2BFU L;  1K5M B;  2WZ8 A;  4QDS A;  5FZ8 A;  2C1F A;  3VDC A;  5LWB A;  2YMZ A;  3NV4 A;  5F5Q A;  4A2U A;  4TTG A;  1RUH 3;  2WL1 A;  5H9R A;  4XHX A;  1N1Y A;  1T6B X;  1RUC 2;  1UMI A;  2NN8 A;  3MV1 1;  5C3S A;  5GZG A;  2OPW A;  2E53 A;  1X82 A;  1JZ2 A;  1JYV A;  5D8A A;  1ND2 A;  2JJ6 A;  4KWL A;  2YFT A;  1QJX 2;  1RUF 2;  5FWJ A;  4BQ1 A;  4MUV A;  1POQ A;  3KGZ A;  1GQP A;  1Z78 A;  1AYN 1;  1KDK A;  1W8F A;  3U1X A;  2EAL A;  2B45 X;  1SLT A;  2JB8 A;  4IEP A;  4COT A;  3M1H A;  1KIT A;  5A7W B;  3VT1 A;  2DCT A;  3FHI B;  2WAB A;  4WZC A;  5CEH A;  3NNL A;  3WCR A;  4AQ2 A;  1NXM A;  2DV9 A;  4MZU A;  4XFA A;  5JZG B;  3VZK A;  4GAZ A;  4MO3 M;  4NE9 A;  3MIH A;  2Q8O A;  3AFG A;  3WF2 A;  2OX0 A;  5FP3 A;  4EZH A;  3EYP A;  1GWK A;  3G7D A;  1T6G C;  2YBK A;  1TL2 A;  5JXH A;  1XB9 A;  3A22 A;  2VJX A;  1G7Y A;  2QE3 A;  4JKK A;  1RHI 1;  3E1F 1;  4Q2F A;  1W6P A;  4OVE A;  2DU1 A;  4XMA A;  5CKQ A;  5FZ1 A;  2JDA A;  3ACF A;  4P9Y A;  1DQ4 A;  1QJU 2;  4C90 A;  3AYA A;  1FV2 A;  1W0O A;  4GJY A;  3UJO A;  4CEY A;  4TSV A;  1MS5 A;  1VIW B;  2YPJ A;  2ZZJ A;  4WM8 A;  4ARY A;  3WPV A;  3OPT A;  2BBV A;  4CP2 A;  4GAL A;  3NWK A;  2JX9 A;  5FY5 A;  4XZU G;  3VGI A;  1UF2 C;  1D0H A;  2WYS A;  1VBB 1;  2ZZQ A;  4XAB A;  5J98 B;  3W58 A;  1S2B A;  1W6O A;  3LFI A;  4B1L A;  3U10 A;  2XL9 A;  3S5A A;  2RMU 2;  2ZTN A;  4DZG A;  1AF9 A;  5GLO A;  2LM3 A;  3MV0 1;  3FLT A;  5LAS A;  3POW A;  4YG6 A;  1QOS A;  2MHF A;  1VRH 3;  1S55 A;  1AZD A;  3O1R A;  4OUL A;  1NG0 A;  2YFR A;  1XYO A;  2Y6K A;  3IAP A;  1ND3 A;  1SG3 A;  3QLQ A;  2C9A A;  5CG8 A;  4JDO A;  1PGL 1;  3MIB A;  2P3I A;  3GBG A;  3URF A;  4BWO A;  4QT6 A;  4YW3 A;  2WQZ C;  1HQW A;  4XDQ A;  4QDQ A;  3VBU C;  5L7O C;  1VBC 1;  3LGR A;  4GD4 A;  3PU8 A;  1A8D A;  1GZC A;  2J1T A;  3V56 A;  2VZ3 A;  4TXW A;  2QUO A;  3RZM A;  2ZEZ A;  5L7O B;  2JKB A;  5E6H A;  4E4Z A;  2R06 1;  2EXH A;  3WN1 A;  5LA9 A;  5FYH A;  2ZGQ A;  2V09 A;  2JG9 A;  1NZI A;  4NO4 A;  4XF9 A;  4R9D A;  5C8C C;  4PBP A;  4NIA A;  2UY9 A;  2VCC A;  2XWJ B;  4JTO A;  4XZP A;  1WCQ A;  3CJI A;  5C9A A;  2XJP A;  1TME 2;  3PHM A;  4QAW A;  4A7K A;  1CGP A;  4N7I A;  3TNP B;  3WG2 A;  1V9U 1;  1YJL A;  2RS3 1;  3ELN A;  4IE6 A;  4EN9 B;  5JOZ A;  4MGT A;  3ZXD A;  3MW3 A;  2CAV A;  3VKF C;  4WV8 A;  1FMD 2;  2VMH A;  2ZXQ A;  3B94 A;  3RI8 A;  4PCR A;  1GOG A;  3DYO A;  4Y1V A;  3T4V A;  1C3H A;  5BNN C;  3ZXF A;  2AUY A;  4XCB A;  1V9U 2;  2ZX4 A;  5FIX A;  3LPG A;  2VUL A;  2WFF 1;  4HPK A;  4EV0 A;  4FPJ A;  2W1S A;  3WDT A;  4GMP 1;  4LBM A;  1H2N A;  1XPW A;  2GAL A;  2JG8 C;  1WW5 A;  1MS8 A;  3NKG A;  4OHW A;  1UMZ A;  2J1R A;  3OY8 A;  4KNC A;  4PLM A;  4UYB A;  2JDP A;  1EUT A;  3TEZ A;  3Q8F A;  3MUY 1;  3WF3 A;  1L3J A;  3KMH A;  4BA6 A;  4LE3 A;  1MZF A;  2DTY A;  2QVS B;  1IPJ A;  2Q8C A;  4OHV A;  5C0P A;  4QXH A;  3SC7 X;  2BUK A;  4IEO A;  4BCU A;  2OXB A;  4E27 A;  2XH6 A;  1UY1 A;  3AC0 A;  3ZYF A;  4CSW A;  5FZB A;  3S0M A;  2VZQ A;  3GHN A;  2XQR A;  4KGQ A;  4LHN A;  3B69 A;  2A71 A;  2Q1F A;  4D6R A;  3N7M A;  1QF3 A;  3D82 A;  3VD7 A;  4K20 A;  4H7M A;  1D2S A;  4P02 B;  4X8N A;  4FTE A;  4TLG A;  4O9E A;  5IVY A;  1H9W A;  3CIH A;  4QB1 A;  4MSV A;  1FOD 2;  5IHR A;  2YC2 A;  3LV4 A;  4XXP A;  5CNA A;  3VL8 A;  4X6R B;  1CPN A;  2PHR A;  2WA4 A;  4I01 A;  3ZKU A;  4I3P A;  1CAW B;  5A3T A;  1UV4 A;  1COV 1;  4CRQ A;  2G9Z A;  1XND A;  3UES A;  1H2L A;  1LEC A;  3I2F A;  3MBW A;  4LOS A;  1BMV 1;  2NMN A;  2DVF A;  1CQ9 A;  1VMJ A;  5B6S A;  2WS9 1;  1SCR A;  2QZ3 A;  2GMP A;  4AVV A;  4QPG C;  3ZM8 A;  1O4Z A;  5FCC A;  1GP6 A;  1AJO A;  1S2E A;  2PLV 3;  2YV8 A;  2A3Y A;  5EJZ B;  2PN5 A;  3H1W A;  1XE7 A;  3A0N A;  3THP A;  4A45 A;  3K2O A;  2VEC A;  3WN2 A;  2Q0A A;  1PO1 3;  2VQU A;  2DDU A;  4XQ4 A;  4K21 A;  1CAU B;  4M4R A;  4IV3 A;  3UKT A;  2RV9 A;  2AGS A;  3OYW B;  5AVP A;  4BM8 A;  1JU3 A;  3VSS A;  2P5B A;  4SLI A;  1JYW A;  5BNP C;  3PU3 A;  2PQS A;  4HMZ A;  3WX5 A;  4IV1 B;  1GZW B;  1U5I A;  2VOT A;  2ZGM A;  5EJ3 A;  5FFO C;  3D6E A;  5T55 A;  4QPY A;  1DYP A;  4W50 A;  4QMA A;  5FMD A;  5JVV A;  4DRR A;  5IVV A;  2GP3 A;  3RZL A;  4AQT A;  3VBF A;  4CXY A;  1NY7 2;  4ET7 A;  3H3L A;  2J7M A;  4KGG A;  4CEW C;  1BZW A;  1O3T A;  2AAC A;  1ZZ8 A;  1N3Q A;  1WMX A;  4MLG A;  5FMO S;  1PM4 A;  4ZHN A;  4RHV 2;  2XJR A;  3U14 A;  4XMI A;  2PA7 A;  2DF7 A;  3FLP A;  1HJG A;  1PVC 1;  2C0Z A;  3UL2 A;  2VNV A;  4NID A;  4YM2 A;  4QM8 A;  4MGQ A;  4QGM A;  2D43 A;  2XXZ A;  4UDI A;  5I8Y A;  2P17 A;  5I93 A;  3UNP A;  4FI9 A;  5FY1 A;  1R08 1;  3NQH A;  4N90 A;  4UW6 A;  3ZFE A;  3JD7 3;  4UFI A;  4A4A A;  3Q8B A;  2GMM A;  2GAU A;  3AP9 A;  4ZY9 A;  1AR6 1;  3PDQ A;  2XML A;  3EB7 A;  1HW5 A;  3LA7 A;  3ZSJ A;  4BH9 A;  4OQ9 A;  2VZR A;  2UWC A;  1CAV B;  3AP6 A;  3ETQ A;  3I2I A;  4RS5 B;  5I0T A;  2IVI B;  1OUR A;  4QQO A;  1EAH 2;  2WKK A;  3ZFG C;  4BLJ A;  4LA3 A;  2WNU B;  2D6O X;  3KHC A;  2W1U A;  5DZE A;  4LBK A;  2JXA A;  5BNQ A;  4A41 A;  3NRU A;  1Q43 A;  2IC1 A;  1IKP A;  1DQ0 A;  2G1M A;  2EXK A;  1QGL A;  2KR2 A;  1UX6 A;  5D8A C;  1NX9 A;  2WAA A;  4D47 A;  1UN1 A;  2DCZ A;  2UYB A;  2VW2 A;  4W4Z A;  1FNY A;  3TBD A;  3RVH A;  1UU4 A;  2R32 A;  4Y20 A;  4D69 A;  3IWZ A;  1H1I A;  1OT5 A;  2AYH A;  3SCF A;  3DEM A;  5F2W A;  1ND2 B;  3ZDS A;  4ZZ5 A;  4UDK A;  5FO9 B;  1H6X A;  2K46 A;  2W68 A;  3HBZ A;  5D2A A;  4NHY A;  2UUR A;  5FZA A;  4BPZ A;  2DTW A;  2QQV A;  3JBG 3;  1RUI 3;  1Z0H A;  2EVX A;  3WN0 A;  3POJ A;  1UXZ A;  1DQ2 A;  3OPW A;  3E6B A;  4Y26 A;  4UF0 A;  3MHZ A;  3UKV A;  1C1L A;  3A21 A;  5LEK A;  2BZD A;  2BWC A;  2PYT A;  4XF4 A;  3VDD A;  1PZ9 A;  5L9B A;  4CP0 A;  1RUH 1;  3WQ7 A;  4BIO A;  1BXH A;  1SCS A;  2ZJC A;  3THC A;  3AJY A;  1IS5 A;  2VPV A;  2ZEW A;  4BB3 A;  4LXL A;  4BIS A;  3WP3 A;  1SDW A;  4CVU A;  4P9I A;  1Q56 A;  4AFD A;  5B4N A;  4WVV A;  1YIP A;  3I3B A;  2HH9 A;  4K3U A;  1POV 3;  3SXW A;  2HWF 3;  2EIC A;  4CEY C;  5GLW A;  2FDF A;  1W6P B;  2EIE A;  1QU0 A;  2ZHN A;  5AYC A;  1HV0 A;  3EBR A;  4KWU A;  3ZFF C;  1AVB A;  3T1M A;  5L36 A;  1MZ6 A;  1S0J A;  5G05 L;  4FPY A;  3O1T A;  4WM8 B;  4PVI A;  5C5U A;  4E4S A;  1SFN A;  1PGS A;  2UU8 A;  1BYH A;  3ILN A;  5LAT A;  5C70 A;  1W6O B;  4G9S B;  2VW1 A;  4JC1 A;  4QB2 A;  1KFX L;  4HL0 A;  4L8Q A;  3AFK A;  1JS9 A;  2BGP A;  2VZV A;  1LHO A;  1QDO A;  3IMM A;  4R4Z A;  4ZON A;  2JE9 A;  4UOJ A;  2R49 A;  1GWL A;  1ND3 C;  1CIW A;  1ZBE 2;  4HOO A;  1FXZ A;  4QB6 A;  4Q0U A;  3LB9 A;  1M4W A;  1VPH A;  4DY3 A;  3P1I A;  1KS4 A;  4D6S A;  2ZAH A;  3CNA A;  4XUO A;  1POV 0;  5HPO A;  4P9J A;  2B9V A;  3FWE A;  3HR9 A;  3P6B A;  3TEX A;  5JR2 A;  4LQR A;  5GKA C;  3IT8 A;  5IFP A;  3MLK A;  1PGW 1;  4HVO A;  4QGN A;  1C1F A;  4KWK A;  3BIE A;  4Q4W 3;  1H4H A;  1GP4 A;  2JG9 C;  1GOF A;  4F8A A;  3R4Z A;  4LKD A;  2GC3 A;  2D5F A;  3E5Q A;  2JB4 A;  1MR5 A;  5A32 B;  3W20 A;  4AI9 A;  1Q8S A;  4KBZ A;  3A4U A;  5L9V A;  4YAR A;  3U0Z A;  2JG9 B;  3R4S A;  2BER A;  2BYV E;  4N2R A;  3CJI C;  4XUP A;  1QDC A;  4PIZ A;  1VRH 1;  4FCA A;  5DAV A;  2QQL A;  1G9F A;  4G4F A;  1GMM A;  4LBQ A;  5FY4 A;  1PM7 A;  4GWM A;  5C9A B;  1XYP A;  4XJ9 A;  3PLQ A;  4CXW A;  3RSJ A;  3GNE A;  1REE A;  1RL3 A;  4OQ8 A;  2JE7 A;  3ZSK A;  1VRH 2;  4LLO A;  1ZNP A;  5A8D A;  3I49 A;  1HQN A;  5FZO A;  5I0U A;  2WQ8 A;  1TNF A;  1NCQ C;  2ERF A;  3ILF A;  4AVA A;  3AP5 A;  1AYN 3;  4ASK A;  1KJL A;  2QBX A;  2BQP A;  3ZYG A;  1IZ3 A;  4HSL A;  5CIR A;  2FDJ A;  3CEW A;  1X33 A;  1W8O A;  2ARX A;  2TEP A;  2RS1 3;  2TNF A;  4AQ6 A;  1K5M A;  3A7Q A;  3POB A;  1MS0 A;  1VBD 2;  4M3C A;  5HV4 A;  3H1Y A;  1UZY A;  5C2M A;  1YHF A;  5FJH A;  3OY8 B;  4XFC A;  4V2W A;  1QWR A;  3O1M A;  4XVH A;  5EYY A;  2CDO A;  3CQO A;  3DGT A;  4DS0 A;  5A33 A;  1UIJ A;  3GBF A;  3LZZ A;  1FAY A;  4FFF A;  2NYY A;  3NL1 A;  3EQE A;  1D4V B;  2V5D A;  1O4Y A;  2WWU A;  5HBA A;  2YDE A;  2OII A;  3GGL A;  4BYY A;  4NOV A;  2DCJ A;  3GJB A;  3L2H A;  4NJ4 A;  4TLF A;  3BB6 A;  1LGN A;  1WGP A;  3LE0 A;  3CZU A;  3JB4 C;  3ZLI A;  1YI9 A;  5BNO A;  1KQR A;  3CU7 A;  3K4D A;  4FPE A;  1V6L A;  1OBN A;  1ZYB A;  2NQY A;  1BEV 2;  1JYI A;  2BGC A;  1NE6 A;  2XLF A;  5JZG A;  4GUL A;  1ASJ 3;  3N4M A;  1OYG A;  1IPK A;  3CLP A;  3J4U H;  5IAX A;  1DGR N;  3KLS A;  1YFY A;  1OA3 A;  2XBO 3;  2QQP A;  1GNZ A;  2A1X A;  4DUW A;  1DGR A;  4MXW A;  2X10 A;  3FN9 A;  4LKE A;  3UYJ A;  4M01 A;  3IDE A;  5GLN A;  2VZT A;  1WCU A;  4BK4 A;  4IV3 C;  4L9B A;  2VBP A;  5CKM A;  2IXC A;  2YG0 A;  3KHB A;  2P6C A;  3OGS A;  4GWJ A;  2X53 S;  4TYS A;  2X8S A;  4Y5Z 0;  3TB0 A;  2E32 A;  2E51 A;  3ACL A;  4YG3 A;  2HLE A;  3PNA A;  2BW8 A;  2AEZ A;  3O1P A;  1V0A A;  2HBT A;  2VVF A;  4XJW A;  1TG7 A;  4AED A;  1C8M 3;  3EMR A;  1N47 A;  4BQ2 A;  4XDP A;  1ULC A;  3ITQ A;  3MFC A;  2ZA9 A;  3LEG A;  3OEA A;  1JXN A;  1NXD 1;  4JHT A;  3FL7 A;  5CU1 A;  1JOD A;  1JI6 A;  3LEI A;  4LUM A;  3VZO A;  5A3P A;  4IES A;  2QQU A;  2C24 A;  5F3G A;  2W47 A;  4Z2W A;  2PLV 1;  1GZ9 A;  3OM5 A;  3VBF B;  5JDB A;  2CDP A;  3VT0 A;  5F9T A;  5EWS A;  3Q9O A;  1DGW X;  1PO1 1;  1OVP A;  1MAC A;  3M7A A;  3MIC A;  3NST A;  2PHF A;  1IKQ A;  2W46 A;  1RUG 3;  4FVV A;  4UFK A;  4XTM A;  5LBC A;  2Q8E A;  4AHX A;  1SPP A;  2A7A A;  1HJF A;  1AR9 3;  2P3J A;  1AL0 G;  2WN2 A;  1ZM1 A;  3WT3 A;  5GLQ A;  1RUN A;  1N3O A;  4I02 A;  1ULD A;  4ZS3 A;  1UU6 A;  5A1F A;  2WFF 3;  4LHK A;  5FTT C;  5JMC A;  2A5Z A;  1QJZ A;  3B00 A;  3M3Q A;  3BPZ A;  3ZFE B;  1RTV A;  4LA2 A;  3VBR C;  3KS7 A;  3OUH A;  1IQD C;  3KGL A;  5JIU A;  2ZGO A;  2JD9 A;  1IHM A;  5APA A;  1I3H A;  5FWE A;  4CPB D;  3FC0 A;  2DYC A;  4ITC A;  5C4W C;  2JDH A;  5FV3 A;  3MF9 A;  2BVV A;  1WLD A;  1WBF A;  1NCR A;  2ZS6 B;  2W08 A;  2X8K A;  5I0R A;  4YYO A;  3DPR C;  4FAG A;  3WNN A;  4D94 A;  5KHK A;  4GKY A;  2RR1 2;  4Y1X A;  4LJH A;  3ZN4 A;  1AX1 A;  5FOB B;  1R1A 3;  3SMH A;  1QNW A;  2LS6 A;  5GLV A;  1VKD A;  1OVS A;  2A6Y A;  3FX3 A;  4DB5 A;  4MLO A;  2O8Q A;  2IZW A;  3CDZ B;  4WM7 B;  4Y20 B;  4A6O A;  2ARB A;  4FOQ A;  3BYL A;  4URT A;  1URX A;  4XOG A;  2G19 A;  1YFX A;  3JD7 1;  4UFH A;  5DAP A;  5FZ0 A;  1RUJ 2;  3LDR A;  4I0B A;  5FRE A;  5JR7 B;  4DXS A;  1AL2 2;  1HXS 1;  4G3Y C;  1I5P A;  2R07 2;  3F2Z A;  2XJQ A;  4LNV A;  5JOW A;  5KBF A;  4BDV B;  4GH4 A;  1O7F A;  1LHW A;  4X6Q B;  3D4K A;  3EO6 A;  5F5I A;  1F15 A;  4UF0 B;  4W6Y A;  1Q8Q A;  3SH3 A;  2CL2 A;  4HAN A;  1UX7 A;  1YYN A;  4FXG B;  4XUQ A;  5GLZ A;  5A6Q A;  4NRM A;  1TZO A;  2W0X A;  5FY7 A;  1EPZ A;  5HCF A;  4ARX A;  3U07 A;  3VDD B;  4YW7 A;  4BE3 A;  4COY A;  5E16 A;  2OQ7 A;  2FQP A;  4QX1 A;  3INA A;  3PVN A;  4LOT A;  5GLM A;  1O8S A;  1B35 C;  4L2N A;  1KJR A;  3N9O A;  5A3U A;  4MHR A;  5FZF A;  3ZYB A;  4YVW A;  4Y3O A;  5FP7 A;  4L92 A;  5JOX A;  1V00 A;  4DO0 A;  4AHZ A;  2XJS A;  3JBG 1;  1RUI 1;  3W59 A;  4BQX A;  1MS4 A;  4IGO A;  5C3O A;  2YFU A;  5C8W A;  1J83 A;  4Z8B A;  5JPM B;  4KC8 A;  1W03 A;  3O5S A;  1CVN A;  1AXK A;  2RM2 3;  5LK7 B;  1I6X A;  2VUC A;  1QJE A;  1RUE 3;  3JB8 A;  5FUP A;  4CDQ A;  4E2S A;  1XQN A;  4FFH A;  4MV2 A;  4EZ4 A;  2GC1 A;  2ZGL A;  3HWJ A;  2Y6J A;  1GBG A;  1DP0 A;  3MDP A;  2CGO A;  4Q0Q A;  1QHD A;  5GLU A;  3B7M A;  5LRR A;  1POV 1;  4YGE A;  2WWS A;  2HWF 1;  4HVR A;  4HXC A;  4CYD A;  2Y0I A;  2R1B A;  1MZ5 A;  2BJS A;  4UBG A;  3TNQ A;  1UY2 A;  4Y1U A;  3WMY A;  3ZKY A;  2LAL A;  4AI8 A;  5IYY A;  1WLC A;  4IL7 A;  4XEZ A;  1A3K A;  3LIH A;  3IPV A;  3TN9 3;  4YVS A;  5LBB A;  5A1A A;  5DAW A;  4YLZ A;  2ZKL A;  1JTZ X;  2D6P A;  3PUR A;  4D8M A;  1D4M 2;  1F31 A;  4Q0S A;  1CX4 A;  5A3O A;  4BU2 A;  1X9P A;  2RS5 3;  3MPB A;  5J48 A;  3HT1 A;  4CUB A;  3ZVX A;  3RPQ A;  3BGA A;  2J42 A;  2QKD A;  4Q5O A;  5FZD A;  3SEP A;  4XET A;  1W9F A;  1LCL A;  1W90 A;  5LA2 A;  1SAC A;  2WO1 A;  1XU1 A;  2AH2 A;  2TUN A;  3AYC A;  3DCQ A;  4NMI A;  4AI3 A;  5A3L A;  4U6B A;  4PJY A;  2B5H A;  2D6L X;  3POG A;  5FQ0 A;  4YW1 A;  2VCB A;  5ACA 3;  3BTA A;  4R9A A;  2YGM A;  5FP8 A;  2RDR A;  3NV3 A;  1DQ1 A;  4LBQ B;  4A7Y A;  2PEL A;  5HCB A;  3I3E A;  1AXZ A;  4QWN A;  2VQ0 A;  3RMX A;  1OFN A;  5A1L A;  1SDD B;  4K6B A;  2SBA A;  4MGS A;  3TWI A;  2CY6 A;  4XDO A;  1GIC A;  5FZO B;  3P3P A;  1Y9G A;  4Q4W 1;  3VL9 A;  2IUW A;  4UW4 A;  3K46 A;  4EN8 B;  1XYN A;  3ZYJ B;  1VAK A;  1K5M C;  2C4X A;  3AYE A;  3IKW A;  4I2O A;  1BBT 3;  4FOV A;  5F6L B;  3SH5 A;  1KRI A;  4QGL A;  5LY1 A;  1SEF A;  4YNI A;  4RQP B;  1H4G A;  4FPO B;  4M3C B;  4AW7 A;  1CAX A;  2E63 A;  1JH5 A;  2HWD 2;  3DV8 A;  1H8T A;  1SMV A;  3W21 A;  4DPN A;  3QEE A;  1VB2 A;  4ES8 A;  4AHW A;  5KXE A;  5A33 B;  2WZE A;  1BK1 A;  1K5J A;  2PAK A;  5FAX A;  2YB7 A;  1C57 A;  1YO8 A;  3D60 A;  5EFU A;  1HRI 2;  4OI0 A;  5DG2 A;  2LW8 A;  2OPK A;  5I8S A;  4R52 A;  3WSO A;  5BY5 A;  3J8F 3;  4OYU A;  5FP4 A;  3VLB B;  3T30 A;  3LPF A;  1RIN A;  2GNB A;  1W0P A;  4ZS2 A;  3FFZ A;  5FZK A;  2X5I A;  4XAA A;  3LDK A;  5A7V B;  1W8T A;  1WD4 A;  1BQP A;  5JZG C;  4NPR A;  3JQW A;  2RS1 1;  4GJZ A;  3LQC A;  3NNF A;  3KQ4 B;  4PIY A;  4XFB A;  3S7I A;  3SKV A;  3AVS A;  4GB3 3;  1OLQ A;  2LRP A;  3ZYI B;  4Q4X 3;  5BNO B;  5CFD B;  1QKQ A;  4RYD A;  3T0A A;  3FJS A;  4O7X A;  1AYN 2;  3AB0 A;  3RG0 A;  3T08 A;  3VBS A;  4C0B A;  4KMI A;  2D6K A;  3WNP A;  3E6C C;  2LTN A;  2YUE A;  3KT1 A;  4L97 A;  5GLK A;  2BRT A;  4QKN A;  1ZRC A;  3VBH A;  2Y60 A;  1Y9M A;  3MIE A;  4CU6 A;  1WL7 A;  4QX3 A;  5JXI A;  4HZF A;  5F37 A;  3EJK A;  4MXW B;  1E57 A;  3ZXG A;  3MPP G;  4S2H A;  2N7G A;  3OD0 A;  1PK6 A;  4PQQ A;  1XU2 A;  3I3Q A;  3ECQ A;  4CP1 A;  2BV4 A;  4XUT A;  1W2U A;  4K8F A;  2H0V A;  1VBE 1;  3ZPY A;  3UGF A;  3TEW A;  3I3D A;  5C6C A;  1O4T A;  4IER A;  4I0A A;  4AYU A;  2B4W A;  5F2S A;  1RUD 3;  1RHI 2;  2PTM A;  4DXR A;  5FZE A;  2KXL A;  5FZH A;  3KVB A;  2IFW A;  3WR0 A;  1X7N A;  4JQR A;  1PMH X;  5BUV A;  4ONZ A;  4ZZ8 A;  2W94 A;  1ASJ 1;  3D0J A;  1X50 A;  2FZ1 A;  5J3U A;  3I4I A;  3VHP A;  1QMJ A;  1O3R A;  2OQ6 A;  1UO9 A;  1XJA A;  4H7L A;  4RSU A;  2ENR A;  1OHF A;  2VZP A;  3UKN A;  3BCW A;  4AED B;  1V6M A;  2XBO 1;  3HIF A;  1Q8P A;  4AVT A;  4QM9 A;  4NVP A;  3H7J A;  3H50 A;  1VBB 2;  4GWI A;  1LOB A;  5JI7 A;  5M0T A;  5T52 A;  2YC0 A;  3FBY A;  4Q8L A;  4AF9 A;  5IVB A;  3Q8E A;  2VMC A;  3GZA A;  5FK8 A;  4ERO A;  3M4F A;  3WW3 A;  2PHX A;  2VCA A;  4JRA A;  4XJ8 A;  4JHZ A;  2P3Y A;  2HEV F;  2Y6F A;  3DEC A;  3IBM A;  2QFE A;  3MEP A;  3VD3 A;  5KXC A;  4AWD A;  5LW9 A;  2ZX3 A;  3HN1 A;  4LO8 A;  2QDN A;  2DVG A;  1SPP B;  3NJX A;  3PJY A;  4LLF A;  1AR8 3;  1BJQ A;  1ZZB A;  1F5J A;  5FZ3 A;  2ATF A;  2H6C A;  2OW4 A;  5A32 A;  1PGL 2;  1OLR A;  2H6B A;  4PVA A;  2LUW A;  5ISL A;  5BYN A;  1C8M 1;  2VNO A;  1PX4 A;  4CUA A;  3AK0 A;  1VBC 2;  2BFU S;  4P9W A;  2UY8 A;  3LDB A;  4KI5 M;  1GNH A;  3WNO A;  1C5H A;  1ENR A;  1LKN A;  3FZ3 A;  2V5Y A;  3NAP A;  1HKD A;  3NKT A;  4MOA A;  5DAX A;  3IAQ A;  4CDW A;  4IND A;  5CG9 A;  1AR7 3;  1NLQ A;  4M00 A;  5SV8 A;  1DIW A;  2R06 2;  4IE0 A;  1NCR B;  1V70 A;  4J1X A;  4AG4 A;  1CD3 G;  1L7L A;  4OLL A;  3R4U A;  5EZW A;  1RIR A;  1RUG 1;  3WPU A;  3V65 A;  5FMC A;  1RYY A;  1KS5 A;  2WZR 1;  1LGC A;  3J7H A;  5GZF A;  1AR9 1;  4MGY E;  1QY4 A;  3HNM A;  4PT6 A;  1FV3 A;  4V1P A;  3SH4 A;  2DCK A;  3WNK A;  3POS A;  3WNX A;  4XFF A;  3WP4 A;  2RS3 2;  1N1S A;  3OBA A;  5L19 A;  3KV5 A;  4PIX A;  1UWW A;  2FMD A;  1DLL A;  2YZ4 A;  4KU7 A;  4E9K A;  3IM0 A;  2ID4 A;  1PHM A;  4S2D A;  2WNV B;  3KT7 A;  4AHY A;  3WUC A;  2HWE 3;  2XVG A;  2CU5 A;  2QTW B;  5EPA A;  4E8C A;  1LOG A;  2FBE A;  2PHL A;  4YZ5 A;  3AKF A;  1WUV A;  3WF0 A;  2WFF 2;  3I2D A;  2ADE A;  4GH4 B;  4MGK E;  5C33 A;  4C1W A;  4AGR A;  1QOO A;  1J1L A;  1JN2 P;  3C3V A;  1OUX A;  3J7M A;  3VHN A;  1S0G A;  3AM2 A;  5E89 A;  4AQS A;  4JQT A;  2D40 A;  1R1A 1;  2WR9 A;  4NRP A;  1LJ7 A;  4YW6 A;  1O3Q A;  4BLI A;  1LED A;  3PME A;  3FFQ A;  3OF1 A;  4NHK A;  4B4P A;  4EJR A;  4Q4V 1;  2Y38 A;  4PQ9 A;  3PL0 A;  4U2A A;  3LEK A;  1GSL A;  4XF0 A;  5K4L A;  2VMD A;  4DNY A;  3PVO A;  1TQ5 A;  2WSU A;  4YVW B;  1RJ8 A;  4WZF A;  4FPH A;  2GZW A;  3WOG A;  2DFB A;  4AK3 A;  1CN1 A;  5HV0 A;  4XBN A;  5HXV A;  4OHZ A;  2AZ5 A;  1LU2 A;  1DCS A;  3QCW A;  2HYK A;  3T2Q A;  3F95 A;  4AFA A;  1OSG A;  1JMU B;  1FPN 3;  4CDQ C;  2FDH A;  2PFW A;  4LO4 B;  5HXM A;  1DFQ A;  1XE8 A;  2GP5 A;  1Z7S 3;  3LFM A;  1GOH A;  1CWP A;  1OA2 A;  1RMU 3;  4RN5 A;  4XE9 A;  3AKR A;  2EAK A;  3GYD A;  4CDQ B;  4HBN A;  3RZH A;  1TE1 B;  3BAL A;  2VOX A;  1EPW A;  2XG3 A;  2ZAB A;  4XUR A;  1O91 A;  4LKS A;  2W2I A;  2P2K A;  1CON A;  4RGK A;  5FPX A;  5LZ6 A;  4AAX A;  3KZ4 C;  5ABJ C;  2A75 A;  1COV 2;  3KB5 A;  4LT5 A;  2GC0 A;  3ABZ A;  1PNG A;  2ZBJ A;  1MS1 A;  3HQU A;  5KWR A;  3T1L A;  1ODM A;  1HB3 A;  1OFS A;  1W2N A;  1BMV 2;  4Q4Y 1;  2GNT A;  4O9G A;  2WS9 2;  4CCL A;  4IV1 C;  1TMF 3;  3ZSL A;  4DIN B;  2C5D A;  2O14 A;  4YVS C;  5I0D A;  1WW4 A;  1GR3 A;  2Q5T A;  4RFT 0;  2ZAA A;  1LR5 A;  4NAM A;  2VBD A;  4H14 A;  4R9B A;  4QQP A;  1DDL A;  1UCX A;  4YGC A;  5IFT A;  2XHN A;  2RM2 1;  4FFG A;  3IPV B;  1QH6 A;  2A6W A;  4YM0 A;  4YVS B;  1OLM E;  5K8S A;  1RUE 1;  2OZ6 A;  4JCK A;  3RDI A;  4CXX A;  4IQP A;  4UBH A;  1W2A X;  5FP9 A;  3T2T A;  5GLP A;  5FZ4 A;  5GM0 A;  4K7J A;  5EIY B;  3QC2 A;  2VVE A;  2SLI A;  2V72 A;  3KT4 A;  4Y1Z A;  1LOD A;  1I9R A;  1APN A;  3VHR A;  4MHU A;  2P34 A;  3ST7 A;  3CL1 A;  5FBJ A;  3OM6 A;  1RUE 2;  4M3C F;  5FZM A;  5FQ0 B;  4NOT A;  3BI3 A;  4YWA A;  1RC6 A;  4BQ3 A;  3H42 B;  2GME A;  3MO4 A;  1OC1 A;  4N7U A;  3AKH A;  5T50 A;  4BQW A;  1L7Q A;  4PI2 A;  1IPS A;  2G9G A;  5GAL A;  2AEY A;  3OOX A;  4CPB A;  1F5F A;  2D6N A;  3USU A;  2CV6 A;  3WG4 A;  2DBN A;  2VUA A;  1LTE A;  5KC5 A;  1G9A A;  3TN9 1;  4B7K A;  3HD8 B;  3N7K A;  1LOE A;  1R09 1;  4URA A;  4J6G A;  5J37 A;  4RS5 C;  1J1T A;  2BGO A;  1HXS 3;  2O8O A;  1PVC 2;  1J3Q A;  2WNU C;  2RS5 1;  3DXT A;  4PI0 A;  2F17 A;  4CCM A;  4CU8 A;  1C8N A;  1XXN A;  5IVC A;  3H8U A;  1DU3 D;  1UYY A;  4EYU A;  1QQP 3;  1R08 2;  2MEV 3;  2OA2 A;  5LB6 A;  3T2O A;  1H8T C;  3H7Y A;  3TN9 2;  4QD2 A; 
#chains in the Genus database with same CATH homology
 3C7O A;  3R67 A;  4U6D A;  5JOW A;  3D60 A;  4KC7 A;  4NOV A;  3ZR5 A;  3LV4 A;  4KCB A;  3VSF A;  4UDG A;  3AKF A;  3WPV A;  1UV4 A;  3U75 A;  3RWK X;  4CCE A;  2ADE A;  3KST A;  2ADD A;  3LDK A;  5A7V B;  3CU9 A;  1OYG A;  4CCC A;  3ZR6 A;  3AKG A;  1YIF A;  4UFL A;  5FKB A;  3BYJ A;  5AYC A;  4N2R A;  5GLM A;  3VSR A;  3LIG A;  4JQT A;  5B6S A;  3LFI A;  4N2Z A;  4B1L A;  3C7F A;  4PVI A;  4FFI A;  3QEF A;  4KMI A;  3WPY A;  4EQV A;  3WN2 A;  5JOX A;  1GYD B;  5GLO A;  5GLK A;  3KF3 A;  1WL7 A;  1Y9M A;  5GLN A;  1YRZ A;  3VSZ A;  2QQW A;  4KC8 A;  2YFR A;  5A8C A;  3IMM A;  5A7V A;  4AK7 A;  5FLW A;  3VSS A;  3WMZ A;  1Y4W A;  1YI7 A;  4FFH A;  2X8S A;  3D61 A;  5FK7 A;  3OM7 A;  3C7H A;  4UDJ A;  4O8N A;  1W18 A;  3HBK A;  3PIJ A;  3UGF A;  3NMB A;  3BYK A;  5B6T A;  2AEZ A;  3LEM A;  2B4W A;  5FMD A;  4UFM A;  5FMB A;  4HXC A;  4ONZ A;  1UYP A;  3KF5 A;  3QED A;  5GLR A;  3H3L A;  5JOY A;  2YFS A;  2EXH A;  3OSD A;  3WN1 A;  4N1I A;  2X8F A;  4QQS A;  3WMY A;  3BYN A;  2QQU A;  4MLG A;  4UFJ A;  3U14 A;  2VDT A;  1GYE B;  1Y7B A;  3OM2 A;  3R4Z A;  3OM5 A;  1PT2 A;  3VT0 A;  3LIH A;  3WAT A;  3ZXJ A;  4UFK A;  4UDI A;  4B1M A;  5FK8 A;  5GLL A;  3NQH A;  5ANN A;  5GLQ A;  4KCA A;  4UFI A;  3P2N A;  5JOZ A;  3LF7 A;  3PIG A;  4FFG A;  2EXJ A;  3WPZ A;  3ZXK A;  3C2U A;  5AY9 A;  3VT2 A;  3AKI A;  3ZXL A;  3S5Q A;  4U6B A;  5GLP A;  3C7G A;  3QC2 A;  1GYH A;  5FKC A;  3WAU A;  4PVA A;  5FIX A;  2AC1 A;  5AYD A;  5A8D A;  3UGH A;  4UDK E;  2X8T A;  3C7E A;  3OM6 A;  3D5Y A;  2EXK A;  2YFT A;  3QZ4 A;  3K1U A;  3OM4 A;  3WAS A;  4D47 A;  4AZZ A;  1W2T A;  3AKH A;  3UGG A;  1Y9G A;  4AK5 A;  4QHZ A;  2AEY A;  3U1X A;  4UDK A;  5C0P A;  4COT A;  3D5Z A;  1VKD A;  3SC7 X;  3VT1 A;  2EXI A;  3WPU A;  5AYE A;  2OXB A;  5FMC A;  2QQV A;  4N4B A;  4AK6 A;  3BYL A;  3WN0 A;  4O8O A;  1ST8 A;  2XQR A;  4FFF A;  4UFH A;  4O8P A;  3LDR A;  3QEE A;  3TAW A;  4CCD A;  3R4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...