4FFFA

Crystal structure of levan fructotransferase from arthrobacter ureafaciens
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
479
structure length
479
Chain Sequence
AVYHMTPPSGWLCDPQRPVTTHGAYQLYYLHSDQNNGPGGWDHASTTDGVAFTHHGTVMPLRPDFPVWSGSAVVDTANTAGFGAGAVVALATQPTDGVRKYQEQYLYWSTDGGFTFTALPDPVIVNTDGRAATTPAEIENAEWFRDPKIHWDTARGEWVCVIGRLRYAAFYTSPNLRDWTLRRNFDYPNHALGGIECPDLFEITADDGTRHWVLAASMDAYGIGLPMTYAYWTGTWDGEQFHADDLTPQWLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKYAARDVPTDASDGYNGQNSIVRELRLARQPGGWYTLLSTPVAALTNYVTATTTLPDRTVDGSAVLPWNGRAYEIELDIAWDTATNVGISVGRSPDGTRHTNIGKYGADLYVDRGPSDLAGYSLAPYSRAAAPIDPGARSVHLRILVDTQSVEVFVNAGHTVLSQQVHFAEGDTGISLYTDGGPAHFTGIVVREIGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional basis for substrate specificity and catalysis of levan fructotransferase.
pubmed doi rcsb
source organism Arthrobacter ureafaciens
molecule tags Hydrolase
molecule keywords Levan fructotransferase
total genus 121
structure length 479
sequence length 479
chains with identical sequence B, C, D
ec nomenclature ec 4.2.2.16: Levan fructotransferase (DFA-IV-forming).
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4fffA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 4fffA01
3H3LA 3HBKA 3C2UA 4AK6A 5GLOA 3U75A 5JOYA 3OM5A 2YFSA 2B4WA 4CCDA 5FIXA 1PT2A 2EXJA 5JOZA 4AK7A 4PVIA 5AYDA 3LDKA 2AEYA 3OSDA 3KF3A 4O8NA 3VSRA 4UDKA 3AKIA 3BYJA 3ZXLA 3OM6A 3U14A 3WN2A 3SC7X 3C7OA 3LIHA 3R67A 5FMCA 3C7GA 4N1IA 4QQSA 3WATA 4AK5A 4KMIA 1UV4A 3D5YA 3S5QA 3D60A 4UFKA 3RWKX 5GLPA 3LIGA 1GYEB 1Y7BA 1YIFA 1YI7A 5GLKA 5FMDA 3QC2A 4O8PA 1GYHA 1W18A 3WMZA 5FKBA 4NOVA 3VSFA 4ONZA 4UDKE 4CCCA 5A7VB 2AC1A 4D47A 3LF7A 3WAUA 5A7VA 3LFIA 3KF5A 3BYLA 2QQWA 3LV4A 5FK8A 5GLMA 3WPYA 5C0PA 1Y9MA 5FLWA 1VKDA 2X8TA 3NMBA 3WPUA 3VT1A 3QEEA 4QHZA 4MLGA 5B6SA 3PIJA 4FFIA 4KC8A 3AKHA 2VDTA 5FMBA 2X8FA 3C7HA 4UFJA 5GLQA 2QQVA 4U6DA 2EXIA 2XQRA 4COTA 4FFFA 4AZZA 3VT0A 5GLNA 4UFLA 1Y9GA 4UDIA 3WMYA 3AKGA 1W2TA 1ST8A 2YFRA 4UDJA 3QEFA 3NQHA 3ZXKA 5A8DA 3IMMA 2YFTA 5JOWA 2ADEA 3C7FA 4CCEA 1WL7A 3WPVA 3PIGA 5AYCA 3UGHA 2OXBA 5AY9A 3BYNA 4JQTA 3ZR6A 3TAWA 3U1XA 4FFHA 4UFIA 3WASA 5AYEA 3ZR5A 4N2RA 3QEDA 4FFGA 2ADDA 2QQUA 3OM4A 3P2NA 1Y4WA 4N2ZA 2AEZA 5FK7A 4KCAA 4O8OA 3WN0A 5GLLA 3QZ4A 1OYGA 4B1MA 3VSZA 3K1UA 3VT2A 3D61A 3WPZA 3AKFA 3LEMA 3OM7A 5JOXA 3R4ZA 4PVAA 4HXCA 4U6BA 3C7EA 3WN1A 4UFHA 5ANNA 5FKCA 1GYDB 3BYKA 4KCBA 3VSSA 2EXHA 4UDGA 1UYPA 3CU9A 3KSTA 4UFMA 4N4BA 5A8CA 2X8SA 2EXKA 3OM2A 5B6TA 3UGGA 5GLRA 4KC7A 1YRZA 4EQVA 3LDRA 3UGFA 3ZXJA 3D5ZA 4B1LA 3R4YA
chains in the Genus database with same CATH superfamily
2FCUA 2WA3A 2WSVA 4NJ4A 5DAPA 1ALYA 4R9AA 2EICA 5E8AA 5EIYB 2V73A 3I2OA 3KCCA 1WCDJ 4MGTA 4XCAA 3MZHA 1AYN2 1PK6C 4DY5A 1UY4A 2YV8A 5C3PA 4BZ4A 5DAWA 3SHRA 1CVNA 3N7JA 4JGZC 3BTYA 4XAEA 2V4AA 2HH9A 2HWF3 4L99A 4HG6B 1JHJA 1RUG1 4A7KA 4FVVA 2IXIA 2ZEWA 1XSRA 1JYCA 1VBB2 2XG3A 1W8OA 3GBWA 3MIGA 4KWJA 3G7DA 1NZCA 2VNVA 5FBJA 4AGGA 4BISA 5E89A 4Z8BA 5F9TA 3OPWA 3VKOA 1GUIA 1NCQC 1EYBA 1RJ8A 1RUG2 4PIYA 5JWPA 3H7YA 3BYWA 2VVEA 3WD5A 4LXLA 2KXLA 3TWIA 3S5AA 2A6YA 1ZZ9A 3N9QA 1YNAA 2HWD3 4Y5TA 3PUQA 2AZ5A 1XNAA 1ODMA 4K40A 4UBGA 1VMJA 4RQPA 3DYPA 5B2GB 2DVDA 1IKQA 3WQ1A 4O8PA 1AJKA 1O3QA 1G7YA 1YFYA 1OA3A 4DZGA 5K9YA 5LZ6A 4YW3A 3AZXA 1SCRA 2JG9C 3EO6A 5EWSA 3BYLA 4OMDA 3GHMA 3UKTA 4QQOA 3LV4A 1BQPA 3UNPA 5C0PA 1WLWA 3WSOA 1NAEA 4ZONA 4CA9A 2YMZA 4COZA 2Q1MA 5C9AA 1OVSA 4NPMA 1QIQA 3P3NA 3ZMNA 1A8MA 2K9ZA 4YVWA 3ST7A 5ANQA 2J1RA 4P9GA 2BFUL 1JYNA 1POV1 1QJY1 1K42A 2LTNA 2JD9A 3H50A 2ILMA 3KMHA 1UQXA 5KXDA 1O3SA 3GNEA 5FPLA 4TSVA 5BYNA 1CGPA 4XJZA 2EXIA 3FUQA 1QJEA 4EN6B 4AE2A 2IVJA 3UJOA 3ZXKA 4JRAA 1XNBA 1AR71 4MGQA 1XNCA 1RUF3 1W6QB 4XVHA 1UZWA 4LO5B 3PIGA 3NL1A 4YNIA 2GDFA 2YPJA 5HXMA 2ZTNA 1E5SA 3VLBB 1IPSA 3VBUB 4Q0VA 3PVEA 1US2A 3NAPA 1EUUA 4YW2A 3VBRC 1H2KA 4BU2A 2JG9B 3E6CC 1UKGA 2RS53 4ET7A 2QBXA 1MS5A 4CEYB 1A34A 4P9WA 2P3JA 1VAMA 2AYHA 4YW7A 4BQXA 5T55A 4QX1A 3O1VA 5A1FA 2VOVA 3AYDA 2JJ6A 1S2EA 4XDQA 3AKFA 4FSJA 2Y6HA 4DXSA 1GANA 1CIYA 3AXEA 4RA0A 1PVC1 4ZPIA 5GLTA 1GYDB 2XXZA 3MV11 5D21A 3ZKUA 5CAZA 5I8SA 3VKFC 1HN1A 1N1YA 4M4RA 5FZ0A 1S55A 4GMP1 5CYYA 1NLRA 5B6TA 2J1VA 1GNZA 4XFHA 1R083 5AC92 5ABJA 4JGYA 1QQP1 1OOPA 2ATFA 2Q8DA 5LY1A 2R041 2JICA 1DLCA 5FZLA 2OW4A 4QGNA 2ZZQA 1H8VA 1J1TA 1PO11 2DVAA 4PT6A 4DUVA 1OUXA 3SEPA 2YU2A 4DOUA 1SDWA 4TN7A 5EJ3A 3CBNA 1OKOA 4Q4X2 3UKVA 1LGBA 1OVPA 2HEYF 1WW7A 4M3CF 1OA2A 5FY8A 2WNVB 3OY8A 3ZN5A 3B69A 4ATFA 4NRQA 4JHZA 3MF6A 1VE0A 4NO4A 5E1RA 5FMCA 1S0FA 3WNOA 4RS5A 5GALA 3PL0A 4I3GA 4QXHA 4N1IA 5DXDA 1ZX5A 4E9KA 4I30A 4CDQA 4P9JA 2DUOA 3TOJA 4KMIA 2ZHMA 3RGBA 1M4WA 1Q8PA 4NHMA 1D2QA 3LPFA 4X8NA 4XF4A 3LD8A 4Y4YA 1RGSA 1US3A 1JZ4A 4UFKA 1HQLA 4LJHA 5GZCA 4U36A 2P2KA 4Q4W3 4Y26A 2A3WA 1PIV2 4RQPB 5F2SA 4AFDA 3AKRA 2VZUA 1QXRA 5FYTA 2LS6A 5FMDA 4JVAA 1W18A 1RUC1 1XXNA 3POFA 4YW5A 4QMAA 5A3WA 4ONZA 1F5JA 4UDKE 3BIEA 4M3CA 2Q8EA 4YZ1A 4XZPA 2WR9A 4D6SA 4OFGA 3TRSB 2ORZA 3RYPA 2JG8A 3DXTA 3I2FA 3WPYA 1PIV1 2D6MA 3O1TA 4XF3A 1RUNA 2VZOA 4AHZA 1MS8A 2HWC1 2PTMA 4N7IA 1RL3A 1YJKA 3BODA 5FUIA 2W2IA 1QMJA 2QE3A 3POGA 2F4LA 4AF9A 4BK4A 4CVUA 3VBOB 3USUA 2E7QA 2FQPA 1W8WA 2ZJCA 1VRH3 2EIBA 3DPRB 5F6LB 5BNNC 4CP0A 1WBFA 2HBTA 3WV6A 5A7OA 3V0BA 1VBD2 2DCYA 3K4DA 4QHOA 5FLHA 4B4RA 1BMV2 4LORA 3ZSMA 4LT5A 2VCBA 4GJZA 4JDMA 2GSYA 5A8DA 3TEZA 1UW8A 1HXS2 3Q8EA 4XC9A 4YGCA 4CEWA 4WM7C 3DXUA 1VB4A 2NQYA 4CEYA 5E88A 2HWC3 1POV3 1F8VA 3O1OA 3UGHA 1W8ZA 2K0GA 4BB3A 1RUI1 2ZGTA 3NJVA 4HKLA 1SPPA 3WASA 3URFA 4KI5M 1X50A 2VZPA 5F39A 2FHRA 3CU7A 3T2PA 3K46A 3QEEA 1LGNA 1G9AA 4OI0A 3N9PA 1HKDA 4O7XA 3RDIA 3CEWA 1ZBA1 2VAUA 2ZX2A 4XAAA 5KWRA 4YLZA 1W05A 1W8FA 5K8SA 3BCWA 1E57A 4UF0A 2FDFA 1MEC3 3NWKA 4MHRA 4N53A 2TNFA 3JQWA 5J37A 1LAJA 1XE7A 4QQ2A 3NNLA 4GB31 4DUXA 1NA1C 5L7OA 3KHCA 1MQTA 3JBG3 2MEV1 2Z69A 3BOWA 4JX0A 3AVRA 5GLRA 4Q1RA 2OQ6A 5EYXA 3NV4A 3UGFA 1UOJA 3PUSA 1CIWA 5C4WC 3I2HA 1MS3A 4DPNA 4K7JA 4Y22B 2IXCA 3AMNA 2JEMA 3B9CA 4MXWA 3L2YA 5FJKA 3RI8A 4OUSA 5KHGA 5GLOA 1QH6A 5JZGC 2VW2A 1DHKB 3NVCA 2B4WA 3A4UA 3H42B 4FP3A 3MFCA 1G9DA 2W92A 1SFNA 3J9SA 4FPGA 5AYDA 1R082 2CU5A 3FE5A 3LDKA 4BIFA 2R043 3FL7A 3N4MA 2O1QA 4O8NA 4B7EA 2DVBA 1CX1A 2Z4FA 5FPVA 3SXWA 1LOFC 2VO5A 3MUZ1 5DZFA 3FLRA 3I2KA 5DUWA 5T5LA 3WN2A 3MPBA 1CJDA 3D4KA 4IERA 1NUKA 4ARYA 4HSLA 4CCNA 3R67A 3M7AA 2VL4A 5A3MA 2Q4SA 2R16A 4A6OA 4E27A 4QQSA 2XLFA 1QNYA 5CB7A 1NA1B 2YPDA 2D3RA 2BGPA 4S2FA 3B01A 3FHAA 4AVVA 1W0OA 4ATEA 1Y7BA 3LIGA 3NRUA 4JV4A 3RPQA 2JDAA 3T1LA 5LRSA 1MZ5A 4HFSA 1RUJ2 3H8OA 1B09A 3LPGA 4QQPA 2B42B 5EV7A 3NNMA 5A7QA 4IEWA 4B3NA 1PHMA 1R64A 1ULDA 2OUJA 1UYZA 2ZCWA 2XJUA 3KVBA 3MDPA 1RC6A 3ZPYA 1VALA 2P17A 2E26A 1UY3A 4CUGA 5CKMA 4CYDA 5ACA1 5C8CB 5CIRA 4BK5A 2EAAA 3RNSA 5FYZA 5HV4A 2QZ2A 5FK8A 4XBQA 4BQ1A 4JGYC 4CDXA 5GLUA 1ACCA 4PBPA 4K6BA 1IS6A 4LO8A 3ZXFA 4ZY9A 1XYNA 5LBEA 2XDVA 1HB3A 2LRPA 4WV8A 1UX6A 3ZYFA 3WNXA 1DGWA 1XC6A 5L73A 3POSA 2FMDA 4LE4A 4COUA 5F1RA 3WMYA 1NA1A 1DZQA 3WQBA 2CYFA 5I0TA 1UZYA 1FPN1 1JOPA 5A7WB 3I59B 4RGKA 4QD2A 4Q5OA 4XUQA 4XMAA 2PHUA 1W9TA 3VBSA 1AYN1 1GZWA 1WKYA 5HXVA 4I0AA 1W6NA 1WMDA 2MPFA 1BVVA 1BK1A 2D6KA 2RM23 1NXMA 4IV3C 3L9JT 1RITA 3MIFA 4IW3A 1R091 1I5ZA 5A80A 1SFPA 2KA3A 4XILA 4KCAA 3H8UA 5IFPA 5GLLA 4P9YA 2C4XA 2A7AA 3ZFGC 4PQQA 5AVAA 5FZGA 3MEPA 2OUHA 4B8EA 5EQUA 4QHBA 4FT8A 3S7EA 2CV6A 2YGMA 1W8TA 1A3KA 1SFYA 3POYA 4XHBA 4KG8A 4Z92B 1W9WA 4TLFA 3VZOA 3VBFB 3WCSA 3F2ZA 2RR12 3OM2A 2W1SA 4QPWA 1J58A 1Q43A 3S57A 3AZZA 1J3RA 1RUJ1 4JHTA 5L7OC 3GHNA 2P4EA 3MGUA 4P14A 5KHIA 2AACA 2PFWA 5BV6A 3GJAA 3LKJA 4A3XA 4PF1A 1S0IA 2C0ZA 3KV9A 4JGZA 4LBLA 1OA4A 3LA3A 1LECA 1FXZA 3RJRA 4FI9A 4KH9A 3CZJA 3LSDA 4ZU4A 2VUJA 1L7RA 3CJIB 2PLV2 4AVBA 1H1IA 1QU0A 1PT2A 3OEBA 1CAUA 3R05A 1D4VB 5FZ8A 1WD4A 2V72A 4YG6A 1W2NA 1A6CA 4QKBA 3WNKA 1R092 2GC1A 2C24A 1K45A 3BUCA 3K4AA 3WF2A 1FV3A 3D3AA 2Y38A 4YVSA 1TE1B 3VD3A 4D94A 1AR83 1IGOA 3ZOIA 4BCUA 4PF5A 2Y6LA 5IW0A 4CUCA 1K5JA 2VMEA 5C9AB 1HX6A 2WLPA 4PHZA 5FPXA 5J48A 1F4AA 4UW3A 1UV4A 1MS1A 2MEV3 1RUC2 2OPWA 2FDGA 1QGLA 1NOVA 1I6XA 2HWB2 5FZHA 4AVSA 5GLPA 2ZX1A 4Q4W2 4GB33 4QX7A 1XQNA 3V0BB 3Q8FA 1MS0A 2Q30A 1T6GC 4GWIA 2VMFA 1JTZX 2ZMKA 5FO8B 1MEC1 2OPKA 4AFMA 2VMHA 2R063 3KV6A 2P5BA 3PVBB 2XWJB 5FYBA 2W39A 5KXBA 3NJYA 2Y0IA 1UO9A 4Q26A 2W1UA 1WGPA 3LFIA 2W08A 4JKKA 5GKAC 3PTYA 5GLZA 1OLRA 1UMHA 2Y6GA 2ZEYA 1PVC2 2D7FA 3OUIA 1CONA 2E9QA 5BNPB 1ULOA 3MO4A 1XBFA 4AG4A 4CSWA 2A6ZA 3KB5A 4E4DX 4PDWB 3ZYJB 4IETA 4CDXC 5BPXA 4CU8A 3KS7A 1WLDA 2JE7A 4D7YA 1XPWA 4OZOA 3S30A 3OGVA 1EAH1 4M4PA 4Q0PA 5FMOS 1ENSA 5JOWA 3SH4A 3V0AA 3VHNA 2ADEA 5LY2A 4AI2A 1ASJ2 2QQJA 1WW5A 1XNKA 3AP4A 2JIGA 1QY4A 1RYYA 2YC4A 4IE6A 4HANA 5C8CC 4YFZA 1PO13 2QNKA 1XSQA 3CZUA 1OPMA 3NV2A 2DCTA 3T4HB 4NVPA 1V9U1 3MLJA 4D3WA 3KQRA 1E5RA 3MLKA 2XBO3 1UL9A 2OIIA 1PO22 1W03A 2JDMA 3HN3A 4W50A 1REEA 3JQXA 4QPIA 3UJQA 2PXJA 4Q8KA 2IC1A 2B7YA 4FQZA 4KWLA 3WNMA 5K0UA 3ZFFC 4AFBA 1WD3A 3JUUA 5A32A 1CJPA 3FX3A 3JB4C 3IWZA 5JOXA 2DCKA 4U6BA 4PVAA 1ND3C 2H0BA 3MICA 3PJYA 5FPAA 1TME1 1FNYA 1S0CA 4OYUA 4Q4W1 5ABJC 1LKNA 3AM2A 4IEYA 1UU4A 4MSVA 2JG8B 2R7EB 1F4HA 2YBKA 3MHZA 2DBNA 3WQ7A 2W95A 2ZHNA 3AKPA 4EQVA 2E53A 1F31A 3KGZA 3NJXA 4XURA 3ACGA 3BVCA 4FOQA 5ERLA 5FZOA 3WP4A 4BYYA 1YCIA 2RE9A 5AFBA 3ZXGA 3D5OA 1AR72 5FLJA 3VBRA 5JZGB 4MGKE 2Y60A 2X10A 1CZSA 3AP7A 1D4M2 2CHHA 2YFZA 3WW3A 1AL21 3ZYGA 2WWSA 3M3EA 3O14A 2A1XA 1RINA 2HWC2 2AR6A 4D6RA 1W6PA 3TEYA 1QHDA 1GP5A 1UD1A 1JMUB 5FP8A 4N43C 4W4ZA 1C8NA 2BTVC 4S2HA 3U14A 1QJX1 4EN0A 5L9VA 4FPHA 1RVF1 1UY2A 3JU9A 4Q4X1 5FYMA 3UK9A 4CDUC 1V0AA 4Q4Y1 4YZ3A 1HRV2 2YUEA 2VQUA 1N3PA 1SDDB 1K5MA 5DAQA 1KS4A 4TXWA 5DAVA 1W6QA 4R9CA 4R4ZA 5L7OB 4YGBA 2G9ZA 4PDWA 3VZLA 1RMU2 2ZS6B 4MV2A 3VD7A 1Q5OA 3DL3A 5B4XA 1V6LA 5CU1A 3J7NA 2ZAAA 4C90A 4MH0E 5FZIA 3RYRA 2FDHA 1YI7A 3N9NA 5DUUA 3IN9A 4HLTA 2AENA 1G6NA 2ZKNA 3R6SA 4BDVB 4NOVA 1Q8OA 4CP2A 5A3OA 3SQOA 1QJY2 2VZQA 1ENXA 2FDJA 2ZMNA 3ATGA 3N9MA 1GP6A 3LF7A 2JKXA 3HIFA 1K3IA 4I01A 4AOCA 4BA6A 5LEJA 5DMYA 1JZ6A 1GKBA 2OT7A 2TUNA 1VKDA 2HWD1 2W47A 1O8SA 2YHJA 1GZTA 1EPWA 1K5MB 2OZ6A 1D2SA 3AYEA 2WO7A 5H9SA 3WPUA 2P3YA 3OEAA 2BNMA 5EJ1B 2VDTA 3DPRC 1KDMA 2CNAA 1ZREA 1IQDC 2LUWA 1FMD1 3O1SA 3I97A 3KLSA 5FZ3A 3C3VA 3PU3A 2R042 2VCAA 5FZKA 4EE2A 1AYM3 1AJOA 1GSLA 1RUD2 2RJ2A 5J1XA 1VAKA 4XPVA 4XJAA 4XZUG 3L2HA 4ZXKA 3VD5A 1GP4A 4CUBA 4JGZB 2DWRA 1GZCA 4PCRA 4BWOA 4AW7A 3CKHA 5KC6A 4FPCA 4IEVA 4ARXA 4XIKA 1CESA 1ZZ7A 1MVEA 2BOIA 1O4YA 3CJIA 1NG0A 3BTAA 3FJSA 4UW4A 5FZOB 1FPN3 1JBCA 4LITA 3RMYA 2A3YA 4NIAA 2GH8A 3WXPA 1YIPA 2D5FA 1UOBA 4AAPA 1WCKA 3MIBA 3HNMA 4PIZA 4DXZA 4HN0A 4QB2A 4ISQA 1V6KA 1LHNA 1SLAA 1U12A 1WLTA 4CPBA 4F3JA 1EY2A 2RS13 3VZJA 2FBEA 2ZMLA 3EXUA 1LODA 2X5IB 2IZWA 3KSTA 3NKGA 4Y5Z0 2BRTA 4N4BA 3IAPA 4BLIA 4WVWA 2VR4A 2G9GA 2J7MA 5T5JA 3WF3A 1YRZA 1FOD1 5FZBA 3LDBA 4FAHA 2P6HA 5FZCA 1HV0A 3A0KA 3GGLA 3ASIA 2R1BA 3RWNA 3ZYIB 5JOYA 2VMIA 1U5IA 3D0SA 4XEZA 3T09A 3ZIWA 4ZZ5A 5A3TA 4O9EA 3IDEA 1TVGA 3VHOA 2WFPA 5C71A 4YFWA 4IUGA 4Z2AA 2HWD2 3UL2A 3I49A 1VMHA 3BU0A 4INDA 5FWEA 2W1WA 4L2NA 1QOTA 2I45A 2P1BA 1GQPA 2EXJA 2WN3A 5C3SA 3A22A 4RYDA 2J1AA 3ILRA 1O7FA 4AHWA 3K48A 2RDNA 3OY8B 1GBGA 1V6MA 2AEYA 2DVFA 2YB7A 1WA6X 3Q8CA 4L92A 2WZEA 1AXKA 4R9BA 4UDKA 3VSRA 3FFZA 2VOXA 1DGWX 1F5FA 2XVGA 3PJQA 1ZRDA 3OOXA 1LULA 2WS92 3HN1A 5FYSA 4DB5A 2WNUA 4Y5SA 2NN8A 4UT5A 5JCTA 4CDWA 1AR82 5T5PA 1LOAA 1MZFA 1I1EA 4KL1A 2WZR3 4V1PA 3ZM8A 3JCIA 4F83A 2SLIA 1X82A 4FXGB 3SCGA 3D5YA 2VBBA 4KGQA 1BZWA 3I3MA 2GMEA 2Y6FA 1GZ9A 1MS4A 1ASJ1 3OG2A 1YIFA 3GCWA 4GB32 4AWDA 1KJRA 2UU8A 2QDNA 4KMQA 1VBD3 2WKKA 1GYHA 3M4FA 3WMZA 1GOHA 4A4AA 2QKDA 1L7QA 2R062 2BU9A 3PLQA 1GFF2 4N8MA 3FLTA 4CCCA 5LB6A 1UZ0A 3RZLA 4GIQA 4XJ8A 5DPNA 1O91A 4ZZ8A 2KR2A 1ULGA 1PVC3 1D4M1 3V65A 2UYAA 3WT3A 4AEMA 2VUDA 3OUJA 2Y34A 1JW6A 1QJU1 2XVLA 2DDUA 1ZRIA 2XGXA 4TLGA 4E2QA 2A5ZA 3WNNA 5B4NA 4AEKA 5JSOA 1PZ8A 4NAOA 1FOD2 4CU6A 2ZEZA 4D6QA 1YQ6A 2FCVA 4FXKB 2DU0A 1AR92 3X29B 5LWBA 3O1RA 2HEVF 5GLNA 1ZZBA 2XBO2 3WNPA 3WDVA 3AKGA 4UDJA 1AR63 2B39A 1JZ8A 1RUF2 3PUIA 4TTGA 3DGTA 4NPRA 2WZPP 2HBUA 4PLMA 5DZGA 4EZ4A 4AGVA 3WHTA 1DBNA 1DFQA 4LA2A 4WVZA 4Y1XA 3U0ZA 2VNOA 4JQTA 5BNNB 5F3CA 2IFWA 3ZR6A 3JD72 4CU9A 2JX9A 2R0FA 1ULEA 3B93A 4UFIA 2WN2A 4TZDA 2PELA 5BXXA 1OMIA 1EV11 5KR7A 1AR62 2D40A 5FP7A 2GN7A 5GZGA 4QAWA 5JXHA 4HL0A 1G9CA 2VZ1A 3WN0A 2JG8C 2RDRA 3V56A 4OHZA 3WDTA 3K1UA 3KVAA 2B9VA 3RFRA 5FZEA 5FO7B 1COV1 5J7MA 3INAA 4YM1A 2XUMA 4N53B 3WN1A 4LKSA 4TWTA 2QDRA 4UFHA 1GLHA 3AVSA 3D6EA 1H9PA 3CDZB 4CXYA 1V70A 5L9RA 3DYOA 4HKOA 4CDWC 5A8CA 5FPBA 1IG3A 4IESA 2OS2A 3VZKA 2V5YA 5IT6A 5ISLA 1W3XA 3LDRA 3I54A 2Y6KA 2ET1A 3WCRA 1ONAA 2D3SA 4CCOA 3W5MA 1U5YA 4YZ2A 5I0SA 4ES9A 2R1DA 5JSRA 4ONUA 2E6VA 1W9FA 1YUDA 4XETA 5FXWA 5FP3A 3IPVB 4DXRA 4FBFA 1LEMA 3MIEA 4FQ4A 4A6SA 2EIDA 5CG8A 4GWNA 5A33B 4LEJA 1KGYA 3OPZA 5A7PA 1VAVA 5FZ9A 1XJAA 2GH2A 2XHKA 1UZZA 1UX7A 2HKXA 2WO2A 3FBYA 3USUB 3O5SA 1ODNA 5FYCA 4RD7A 1YI9A 4H2AA 3ZDVA 5BNOC 4CP9A 1H4GA 3C7GA 4BHPA 5FXZA 2K2SA 4BLJA 3AMMA 3PHMA 5A7NA 5JMCA 2YG0A 1TNFA 4G3YC 3U4XA 4A7ZA 1GYEB 1D0GA 3I4IA 4JCKA 2EF6A 1PGL1 3WP5A 3NSTA 3HQUA 2XVKA 2WQ8A 3ABZA 5FXXA 1CAXA 3H3ZA 1XRUA 4ZXEA 4YW4A 2XL7A 4AEDB 1POV0 3ZFGB 2VPVA 4NIHA 4PJYA 3T30A 1GQHA 2IXHA 4JKLA 4PI0A 4DINB 5A7VB 1U0AA 3GCXA 1AYM2 4RR3A 3KF5A 1BBT3 4J1XA 1S0GA 4GH4A 4K21A 1GWLA 5A32B 4NHLA 4I02A 5FLWA 1H2NA 3AFGA 4DO0A 1WW6A 2GZWA 3TNQA 2WC2A 3EJKA 2XL9A 3QCWA 3CJXA 4FP2A 5GZDA 1RXGA 4AQ2A 2FDIA 1QJU3 3VDBA 2JXAA 1Z7S2 2BEOA 3J8F2 4QX8A 5FV3A 3VKMA 2R49A 3I3EA 1OQ1A 3VBHC 2QQVA 4XHXA 4RFT0 1A78A 1CX4A 3OD4A 4NUBA 1KRIA 5FYUA 2RM21 3NO8A 5GJ6A 5F2WA 3VDCA 5CG9A 3P5BA 4LPLA 5G05L 1ZA7A 2B8MA 2OYZA 1O8PA 2JD4A 2RS51 1NQJA 4R9DA 2YFTA 2DF7A 1KFXL 1HB1A 4GQ7A 3S7IA 1N1VA 3UESA 2D6LX 4CCEA 3SEEA 3WPVA 1BEV2 3LCPA 3CIHA 5FZ6A 3W9AA 5JI7A 1HRV3 1DGLA 2PHWA 5DABA 1TZOA 2W0XA 3LEIA 2VC9A 1OC1A 4Q4V1 4IE7A 5DZEA 2VCMA 3AC0A 1RMU3 1W0PA 2CDPA 5IVCA 1H8TB 1RUF1 4WM8A 3H8RA 2W94A 3KWVA 3LSEA 2YU1A 3LB9A 4DQAA 3D0JA 4L97A 4LMFA 3VBFC 3HOBA 4B1MA 4OQ8A 1YHFA 4META 3IKWA 2B5HA 3QACA 4LHKA 4LIUA 3U78A 4MXWB 1I9RA 5CFDB 1HRV1 3IB3A 5KC5A 3VBHA 3LGRA 2VQ0A 2WT2A 5HBAA 1JZ3A 4J25A 3CHXA 2V09A 3JBG2 1AF9A 4AGRA 2PHLA 5JPNB 1W9SA 5AVPA 1PNFA 4FPYA 4AHXA 2QFEA 3NJZA 4CEWB 1UZVA 4N7UA 3RZKA 5A1LA 1V6OA 2FDKA 3C2UA 3H3LA 4NR1A 3H9AA 2R061 3K51A 1MQTC 3E6DA 3HPNA 4OI2A 3USSA 3H0OA 3W58A 5LCWL 4Y3OA 2BJSA 3WEZA 1ZM1A 1SBDA 1IHMA 1QF3A 4LBQB 4CEWC 1AZDA 2VMDA 3SCFA 1AXZA 2GC0A 2E7TA 4XFFA 3BN6A 3FHIB 1UMIA 3DCQA 4RR3C 4OUMA 5FOJB 4RHV2 4QPGB 2XJPA 3FZ3A 4CU7A 3WF4A 1IOAA 1LESA 1WZXA 2Q1FA 3D8CA 5EHDA 3OB8A 5F6KA 1HXS3 1IPKA 1FAYA 2W3JA 2HLEA 1RUOA 1LOGA 1DQ2A 4HVQA 1VMFA 2XHNA 3QBQA 1DGRA 4QX0A 1H8TC 4CXWA 1VBE2 4XUNA 2C26A 5I8TA 3VKNA 1DGRN 1B35A 1UPIA 4EN9B 2H6BA 3UT0A 1KXGA 1JI6A 4Q0UA 2CL2A 4D7TA 4Q8LA 4XJUA 1LOEA 4QX3A 2CGNA 4B29A 3WAUA 1YEWA 2Z79A 1JZ7A 2VG9A 4L11A 1L3JA 1RUH3 1W2OA 3THCA 1JXNA 1PMJX 4GKYA 4BMBA 5GLMA 3VD4A 3GZTB 2WNEA 4N43B 2HWE3 1GV9A 4EYUA 5C70A 1N1SA 4MGSA 4QHZA 3AKSA 5J3UA 5A7WA 5GM0A 2RS52 4KU7A 2G19A 3GZUC 3AL5A 3WG3A 2AREA 1PX4A 1LOBA 4U6DA 3WOGA 1OFNA 2DFCA 4Q4Y2 3ZX7A 5HV0A 3AJZA 1TMF3 1RVF2 2GP5A 4IGQA 4JTNA 1JYIA 3KCXA 4AXOA 2W46A 1Z7S1 3J8F1 2DCJA 1QOSA 3IAQA 4AFCA 2D97A 3P1IA 1DQ4A 3HT2A 1NLSA 4YYOA 4A42A 2WABA 3E1F1 3B3QE 5FO9B 4XIOA 2VW1A 2WT0A 3GJBA 2EIGA 1W6MA 1UKRA 3DN7A 5GZEA 1V6JA 1X7NA 2WNUC 2RMU3 5ABJB 1LHOA 4RS5C 3W59A 4NIGA 1ULCA 5FPZA 2F6BA 1RUD3 3VBSC 5IVBA 1VRH1 1Y9QA 4K8RB 3IM0A 1MS9A 2A70A 3C8XA 1ZZ8A 2QUOA 3NW4A 4NIDA 2BDRA 1FX5A 1C8M1 1W90A 2VH9A 3WDXA 1YJLA 5JUVA 4KG0A 1Q8SA 2XWBB 4HSJA 3OM7A 3R4ZA 1BK0A 3ACIA 3AYAA 4R52A 2WRAA 1DF0A 3WW2A 5IK5A 3BI3A 5CVRA 1LHUA 4AHYA 1W2UA 1W04A 3VSSA 2QQPA 4Y1YA 5LA1A 1DIWA 5LA9A 3OF1A 4UAPA 3WUCA 1AL23 3IT8A 4E4HA 3I3QA 3K4ZA 4KC7A 1VJ2A 2J42A 4Y4RA 3BTXA 3D5ZA 3NAPB 1X8EA 2JECA 1YQCA 1STMA 3FLPA 1ZBE1 1AX1A 1W06A 3PDQA 4XTMA 2LROA 4DXTA 4QT6A 1TNRA 5A6XA 2W68A 4XF1A 4DEVA 1W99A 1B35C 2DUPA 2ZGRA 4H7MA 4LBQA 4LK6A 2P37A 1H2LA 4ORFA 2CY6A 4URAA 1UPSA 3O1PA 3RZMA 2O14A 2QVSB 1NCRB 4FOVA 4Y20B 3WINE 2FCTA 2VVFA 3CLPA 3KF3A 3ZFFA 3OPTA 2Y6JA 5CZKA 2PHRA 4CE8A 5FOBB 1EP0A 1GQGA 3TN92 2BP6A 4E8CA 3ETQA 3HT1A 4YWAA 1JUHA 2WYFA 1F9KA 3SLIA 1NE4A 3PURA 5JMOA 1T6BX 1GNYA 4P9XA 2XOMA 2F17A 2I74A 2XBO1 3VBFA 1HJFA 4WZCA 3U4SA 4DEQA 1G9FA 3AJYA 4Y24A 3MI8A 3H8XA 1C8M3 1QNWA 2ENRA 1C5IA 5GLKA 4BQ5A 5FBZA 3N3HA 1W6NB 2DVGA 1QJU2 1CR7A 3LZZA 2ET7A 5A70A 1ZRCA 1H2MA 1V9U2 4EN7B 4QB6A 1MACA 2CTVA 1TL2A 1X8MA 3ZPOA 4AK3A 2A73B 1ZBE2 1H8TA 2RMU1 3DYMA 4YG3A 5K4LA 4EROA 2V4VA 1BBT2 1LENA 2XJRA 3GZEA 4XQWA 1CAVA 3K3OA 5JAXA 3IIAA 2WAAA 2A6VA 2ZGQA 4J1WA 3KT1A 3MLLA 3MV01 1EAH2 4ITCA 4EWAA 5JR2A 3AXDA 3NMBA 4QX2A 1JZ5A 3M3OA 2GAUA 2IXKA 2NMOA 1QKQA 2ZGOA 2J22A 4IGOA 3I59A 5K0UC 5JLVA 3AKHA 3B00A 1V6IA 1POQA 4UFJA 4TYSA 4K20A 3AL6A 3D82A 4K1YA 1BBT1 4DMIA 4YGEA 4COTA 2D6NA 1GWMA 3ON7A 2CAVA 4CDXB 1ST8A 2KM2A 1EUTA 4HKWA 2D43A 1NYWA 4PDWC 2PHXA 4QXKA 2BWCA 1MVQA 1DYKA 1XU2A 4HT1T 5DDJ2 1DYPA 4W8JA 5EP9A 4C8DA 5BNPC 3OYWA 5K0UB 1KD7A 2E63A 3GZAA 4KGGA 2JB4A 1CZTA 2XUEA 1C57A 4EZHA 1RB8G 4ZU5A 1KS5A 5JR7B 3QEDA 1SLIA 1MEC2 4MG2A 2QQUA 3K3NA 2HWF2 2CWSA 4M3CB 5GZFA 3U07A 2AEZA 1DQ5A 4RSUA 3ZFEB 5JI9A 3E97A 5KHKA 4M3CE 4XQ4A 3I2JA 2XH6A 3VDAA 3ME2A 5LASA 4JDNA 3D61A 3VT2A 4K3UA 4QKDA 5C5UA 1S1AA 3ZSJA 3ZYHA 3GALA 5A3LA 4OCTA 1UMZA 5A1AA 2Z2SB 4XXPA 2XLAA 3RYKA 5FJHA 3PMSA 4XJ9A 5C5TA 4UDGA 2O0OA 1H6YA 5LRRA 1VRH2 3VGIA 1AL0G 1PX3A 2VZRA 2EALA 4CP9B 5A33A 2MNGA 1UCXA 1D7PM 2QJVA 2ZHKA 3VBUC 2R072 3WVJA 2Y26A 5FXVA 3T4VA 3TAYA 5FLIA 3POWA 5H9PA 3ITQA 4XFAA 4OI1A 2UWAA 2JDHA 2NM1A 4NPLA 3T1MA 3MBWA 3OTFA 2A71A 5CEHA 2JDYA 3E5UA 2GC3A 1CAVB 2XR4A 1HW5A 3OBTA 2YGLA 3H7JA 3AZVA 1MZEA 1B35B 3OCPA 4B4QA 5KXEA 4AK7A 4GZ9A 5SV8A 5M0TA 1OQDA 4E8DA 1ZBA3 5IATA 1RXFA 4P5HA 1ZRRA 3AP9A 2PQQA 2VE1A 1PO12 2XJSA 3GYDA 4LULA 2PMWB 3LOIA 1W9YA 4LTAA 4Q27A 5J98B 3MF9A 2JDKA 1H1AA 1JU3A 2Y8KA 3N7LA 4S2DA 2TBVA 1R093 1VLNA 2B9UA 2VMCA 2FMYA 4X6RB 1XOYA 1NX9A 1KEXA 3LWCA 2YY1A 1ULFA 4YZ5A 2JDPA 1AYM1 4KWUA 1PZ7A 5JVVA 2EVXA 1AR93 3P6BA 3TN93 4Q4Y3 3A21A 4QPGC 1AXYA 4DIQA 3DV8A 1VPHA 1AR61 4E2GA 4Z2WA 3VHRA 1C28A 4JC1A 4GJYA 5A7SA 1SACA 2ARAA 2E31A 3WP6A 2YBSA 2QQWA 5FP9A 4ASKA 4CZSA 2XPJA 2DTYA 3ZIXA 1TMF2 4BJ0A 2X09A 3POJA 3N7MA 1SPPB 4QB1A 5DN2A 1C8M2 2D6OX 3G6JB 3ZYBA 2DCZA 1PMIA 1HLCA 2IWGB 3VT1A 4O61A 2XONA 3Q8BA 1HB4A 4A41A 1OD3A 3PIJA 4FFIA 4H3WA 3VV1A 4D8MA 2JG9A 4MXVA 3W20A 4ZS3A 4E2SA 3OGRA 4XXAA 4GD4A 4BQYA 3HEIA 2WDBA 1YQ8A 2BBVA 4HVOA 4RHV1 4Y1ZA 3VD9A 5C9AC 4CDQC 4FFFA 2LALA 2X05A 2J1SA 2QTWB 4WVMB 1SEFA 2WYSA 1JYXA 1AHSA 5T3NA 5A3UA 3IZOA 2WAOA 2C9KA 1IS4A 1PK6B 3H1YA 3ZXDA 5FY5A 4IV3A 1NY71 1UXZA 4AEJA 1JHNA 3NV3A 5FREA 1EPZA 4DFSA 2OXBA 2DFBA 4LBOA 1IS5A 5JXJA 1MZ6A 1DZRA 5D8AA 5GLVA 3AFKA 4HK8A 5IHRA 2R30A 2ZGNA 3LFMA 1PGL2 4AYUA 4GH4C 1S0EA 3EHKA 3ZR5A 5BY5A 3U10A 5FR3A 1O5UA 5LA2A 1JOBA 4A3ZA 2W9XA 4XUTA 4YVWB 4AAXA 1REDA 3JZVA 5HPOA 5IVFA 1ZZ6A 2WZR1 3A0NA 4JRLA 1CWPA 3KM5A 4IV1C 4QU2A 1BEV3 3LEGA 2GU9A 3ACHA 4NRMA 4OQ9A 2PAKA 5FDBA 1ENRA 4RGGA 4QKFA 1PGSA 1FNZA 1N47A 2K46A 3BALA 1CAWA 4AQ6A 2PLV3 3H1MA 1LHWA 1QJY3 5FZ4A 2DUQA 3O0XA 4XUPA 1BKZA 5C7GA 3DUIA 2Y64A 4UI9L 4W65A 4CP1A 3VBSB 2WFF2 1X33A 1QQP3 3O0VA 2GC2A 3AKQA 1DQ0A 3QLQA 4BQ2A 2ZGKA 2YYOA 4RS5B 1VBE1 1R081 1XYOA 4LKEA 5D1IA 4EWDA 3IDCB 1QEXA 1SHWB 3WG2A 3ZDSA 4UWDA 4AK6A 5FZDA 2SBAA 2XMLA 4LHLA 3P3PA 1VBB1 2RDQA 3KSCA 3OGGA 2PAEA 3I2GA 4WM8C 3T2QA 2WZ8A 3ZLIA 1TME3 4LO6B 2X29A 1ND2B 5FUNA 5AC93 1CPNA 3JBG1 1WMXA 3K2OA 4CCDA 1W6OA 3FFQA 5FIXA 1WCUA 4AEDA 4WVMA 2W91A 2ZOEB 1LTEA 3HBZA 1YFXA 3BB6A 4XF9A 4XJWA 1OBNA 3OM6A 5IWFA 4K1ZA 4KWKA 1JH5A 2BBAA 2NZ9A 1ZBE3 3SKVA 1XB9A 3ZYPA 4CUAA 4DRRA 4IEQA 3W5NA 1V9U3 2BV4A 4C91A 3POBA 1QDOA 2ZGMA 4H7LA 1WCQA 2P6CA 2ZBJA 4ES8A 3ZFFB 3WY6A 4FPEA 2BWAA 4FPJA 2CAUA 3O1UA 1DQ6A 2ZGUA 1R1A3 4CCKA 3VDDA 1JYWA 1IG0A 3UV9A 2VCCA 2W87A 2A75A 2UWBA 1YLLA 2AH2A 2C9AA 5C8WA 3AP5A 2JWPA 3VSFA 5FFOC 5FZMA 1UAIA 3F95A 1EV13 3IPVA 3RVHA 4M01A 4XE9A 5EZWA 5L36A 1FMD3 2DBIA 1S0JA 4YVSB 1XNDA 1VBA2 4QDRA 2O8OA 1JS9A 2VTXA 4QXBA 1N3QA 4XQDA 5LK5A 3THTA 3VBUA 3ZN4A 4ASLA 5IK7A 4MGZE 4QGMA 1KDKA 2J1UA 3PMEA 1RIRA 2RV9A 2VU9A 3M3CA 3C7HA 4IGPA 3VDDB 1HQWA 2QQLA 1WWYA 3N36A 4Z82A 3WUDA 5APAA 4COYA 5BUVA 3VT0A 1TMF1 1H30A 1Y9GA 4UFLA 4LLOA 5FZ1A 3NQHA 2WINB 4QM9A 4YM0A 5L9BA 3VBOC 1WCSA 5FTTC 3TYJA 3GBGA 3IBMA 4PQ9A 1PVXA 2DU1A 5IAVA 1PO23 2NPIA 4K9SA 1DU3D 1MQTB 4GA9A 2ZAHA 3JD73 3MIHA 3U1XA 2EA7A 4XFIA 5CNAA 4LBKA 5F32A 1UXXX 1VBB3 3HAGA 3HVDA 3SKJE 5AYEA 1UU6A 1W28A 1ND2C 1H9WA 4Z07A 1G86A 3QD6A 4WM8B 3AKTA 4QDQA 2ADDA 4PBOA 3SCHA 5LW9A 2R073 1RUG3 5A6YA 1NQDA 4IQPA 2WS93 1OYGA 1OD5A 4XYXA 5T5OA 1HIXA 3KV5A 1J1LA 2ZABA 3LEMA 2GNBA 3AX4A 4NMIA 1YQ2A 4HXCA 4RQPC 1KJLA 2WBKA 4MGYE 3KQ4B 2N7GA 3VBRB 3GXUA 4P9LA 4OHWA 3VZMA 2VZ3A 1QOOA 2NYYA 2A6XA 1PNGA 1H0BA 3RG0A 4Y1UA 2D93A 3OJBA 2YC2A 2VECA 4D7SA 4JAAA 1GNHA 2IVIB 4NHKA 4FPFA 2CDOA 3HBKA 3ECQA 3M2MA 4MHUA 2WNVC 4J6GA 4QKNA 3U75A 4XTPA 1RJ7A 3CQOA 4YVWC 3WR0A 3OM5A 4CDUB 1UYXA 1Q8VA 3HWJA 5KXCA 1Y3TA 4QPIC 2XJVA 1G9BA 5C4WA 1JOJA 4GH4B 5FMOL 4E4ZA 1QQP2 2VTXJ 2ZX4A 2NP0A 4Q29A 1TQ5A 5AC91 1YXWA 3AK0A 1J3QA 1VP6A 1L7LA 3DKQA 3NKTA 4IE5A 5FY1A 4CXXA 2VZTA 2P3IA 1ULPA 1W39A 1W8HA 3GM8A 2OQ7A 3VHPA 4EV0A 4X6QB 3SC7X 1FOD3 3LIHA 2CSGA 2H0VA 5FQ0B 5J96B 3APBA 1DDLA 2ES3A 5BNQA 4CDQB 1DYOA 3LA2A 1HRI1 1URXA 3R4SA 2Z5WA 4Y1VA 1S2BA 5K7PA 3BTZA 2X53S 4NWWA 1JUIA 1J3PA 4A44A 4C0HA 5IVYA 4IV1A 3J7LA 3SMHA 1UYYA 4WVVA 2BOJA 3OYWB 4KBBA 4NROA 4N53C 4BQ4A 1AX0A 4QU1A 4D69A 3QC2A 1UU5A 2PHTA 3BKZA 4CCJA 4DY3A 1REFA 3ZO0B 1ZZCA 2VMGA 3WX5A 2CGOA 3ZFEC 1BCXA 5FYYA 5IAXA 2AGSA 1ZVFA 1IKPA 1RMU1 3KT4A 3NNFA 4QWNA 1QDCA 4N43A 1COV2 3ENRA 3LOBA 5JDBA 2RJKA 3SITA 2E51A 3MW3A 3O0WA 5G04L 1FPN2 1MR5A 1DCSA 1N3OA 2HYXA 2WLQA 5DAXA 1YFWA 2WWUA 2WS91 1NLQA 3ETPA 4D0QA 3ROUA 2RR13 1IZ3A 3EMRA 4YPJA 3ZYRA 1M06G 5GLQA 2FD8A 4XACA 2VVDA 4OULA 5FZAA 4UDIA 1LCLA 1W0NA 5JPMB 1DQ1A 1HJGA 2Q0AA 4IEPA 3IMMA 2ZHLA 2XKOA 4JGYB 4MLOA 4OMCA 4Y22A 4DNYA 1JZ2A 1LOFA 3N35A 3NAPC 4G4FA 2P3KA 1PO21 2P34A 4YW1A 5FP4A 5AY9A 3WG1A 3BYNA 4Y33A 4UF0B 1O6UA 1C5HA 3TEWA 1RUH1 2C6SA 2UWCA 4FFHA 5HCBA 5IYYA 3AP6A 4LO7A 2J1TA 1WLCA 4LQRA 4IE0A 5IJRA 4N2ZA 5FAXA 2BUKA 5FK7A 4O8OA 5DDJ3 4COVA 1ZNPA 3OGJA 5JSPA 3QZ4A 5B6SA 4JTOA 1AR81 4F8AA 4MUVA 2ARXA 1X9PA 2WUHA 4JDOA 1DLLA 1QJX2 1VB2A 3Q8AA 3TN91 4I2OA 4H55A 4BQWA 1NCRA 1O3TA 2XJQA 2HWF1 4CRQA 4H14A 1QXJA 3I3BA 4BM8A 1N1TA 3BYKA 3PUAA 2OVUA 1RUI3 3WDYA 1OOPC 1OHFA 2VOTA 1OLME 4ISRA 1PZ9A 2ZPXA 2BNNA 2B46X 4HBNA 4LBNA 4Q0QA 1QJX3 1SLCA 3VZNA 2WQZC 1S0BA 2Q8OA 1DZTA 4NRPA 4QM8A 4RGAA 3E5XA 4GKXA 1X9TA 2PN5A 1VBC1 3UKNA 5F5IA 3ACLA 2IFRA 4M0NA 4S2GA 3ES4A 2BERA 5HCFA 3RJ2X 2XKPA 3VN4A 2BVVA 4AQTA 2V5DA 3B5LB 1S2KA 1LRHA 1OXCA 4MZUA 4Q2FA 1OT5A 2VUCA 1H1MA 1R1A2 3A23A 4I0BA 3CO2A 3FUOA 4YG0A 4PVIA 3EB7A 3ZFEA 1E5IA 1IPJA 5SV5A 2GNMA 1GICA 2WZR2 1LHVA 5F7UA 5TSWA 3M1HA 2QQMA 4YZ4A 1QJZA 2Q5TA 1C3HA 5IVVA 2D6PA 4HK9A 4P02B 2JIJA 5FYHA 1ND2A 5EYYA 2BYVE 3TEXA 2VZVA 4BPZA 4XUOA 4P08A 3POEA 2VOWA 5HCAA 5LBCA 1JODA 5IK4A 4DRVA 5CBLA 5HCHA 4CCMA 5A3PA 2VD7A 1RUE2 1AYN3 1SMVA 5IUQA 3ZSLA 1W6OB 4PIXA 2G1MA 4XMIA 1QJFA 4NE9A 2FZ2A 1LU2A 1O3RA 1PM4A 3OD0A 2JDNA 2ORXA 5LK7B 1RVF3 1GYKA 4QX5A 2GNTA 3AMQA 4LKDA 3T0BA 2AC1A 1U5XA 4D47A 3PTRB 4BIOA 1FMD2 1OH3A 3PUHA 3ZKYA 4A45A 4AFAA 2RS31 2WNUB 2GMMA 2Q1ZB 2RG4A 5DG2A 1Y9MA 1Y43B 5IFTA 1LU1A 3WDWA 3WQ0A 5DQ0A 4YM3A 1PMHX 1QXPA 1YQ5A 2WNVA 4LBQD 1OKQA 1R1ZA 4ZHNA 2RMU2 4IV3B 3T08A 1W3VA 2CWMA 3GF6A 3HD8B 1TME2 1H6XA 2QQNA 3R0RA 2X8FA 2ERFA 4JZRA 1NY72 5KHJA 2JE9A 3E5QA 4LKFA 1RHI1 5I8YA 2W52A 3DKWA 4KQ7A 2XQRA 2YZ4A 4AQSA 5A6QA 1CAWB 3J7HA 4YM2A 1APNA 4AI3A 2WNOA 2R071 2YFRA 5T52A 5ACA3 3IIIA 3SISA 1OOPB 1OSGA 5LBFA 1SCSA 4MADA 4MGIE 4QPGA 4GXLA 3ZXEA 4KBZA 3RRDA 1UF2C 2JDUA 2H6CA 3MW4A 5IVEA 3I8TA 4WBBA 5I0RA 4KU8A 1JU4A 2A3XA 2A6WA 4GWJA 5C3RA 4FTBA 4LA3A 4YSFA 1LEDA 2PA7A 2ZX3A 4N2RA 5F8PA 5ACA2 1T2XA 4BOWA 4FFGA 2Z42A 3OM4A 4ASMB 1Y4WA 5C8CA 4QPYA 5CADA 4AI0A 4BMEA 5I0UA 3I2IA 2X5IC 2QQIA 3KZ4C 1YC61 2QQKA 3POIA 4FPKA 3U11A 4W6YA 1OURA 5C3OA 3AYCA 5FKCA 5FZFA 1AX2A 2W5FA 3JB8A 1K12A 3BPSA 3N7KA 2EXHA 4LBJA 5T50A 3CU9A 2D5HA 4WM7A 1VBA3 1RUE1 4AI1A 1AL22 3GDBA 2EXKA 4E4SA 2HWE2 5CFCC 5L19A 1HQNA 1ND3A 4HN1A 5CKQA 1RHI2 2VXRA 4AR2A 2VBDA 5D8AC 3KD4A 5LATA 1AR91 4HPKB 1UY0A 1J59A 3M3QA 3O12A 1BVP1 4FOWA 4GMP3 3SH5A 5A6ZA 5FCCA 1XNTA 2R6QA 4MO3M 1GR3A 1BXHA 2GN3A 2VZSA 5F5AA 5FRAA 3JD71 4OHVA 3RI9A 3RMXA 3WW4A 1MPXA 3KCYA 3FHQA 1LNSA 1H4HA 1YO8A 1C4RA 3ZMOA 1OI6A 4YGDA 3E6BA 1A8DA 2HWB1 1OH4A 3OSDA 4IEOA 3GBFA 5EXOA 2YXSA 4O9GA 5C33A 3RZGA 3T0AA 1XU1A 3HQRA 4R8HA 1ZYBA 4IE4A 3ILNA 1XYPA 4UBHA 5JIAA 3UETA 1O5LA 1QWRA 5BNNA 3I7DA 3KHBA 3DEMA 5JXIA 1F35A 4BH9A 2RVAA 2VULA 2BZDA 4Y20A 2IXJA 1Q8QA 2WWJA 4GMP0 5F5QA 3S5QA 5T54A 2GMPA 2VNRA 3AMPA 3IDAA 5HI0A 5IK8A 2WSUA 3RWKX 1IQAA 2HWE1 5CFDC 1COV3 5DUVA 2UYBA 3LE0A 4CEYC 2XB6C 5JXGA 1ND3B 4IL7A 1Z78A 1VBC3 1NCQA 4MYEA 2UURA 4LE3A 3ZFGA 4R4XA 4LLFA 4V2VA 5FKBA 3LA7A 3R4DB 5FY7A 1SBEA 2JKBA 4LHSA 3RS6A 3PVOA 4IDZA 1WUVA 4M00A 4U2AA 5A7VA 1VBE3 3KGLA 4FTSA 1R1A1 1UOGA 1OFSA 3CJIC 1SBFA 4HETA 2VM9A 5A3NA 1RUE3 1CAXB 2J1EA 1D0HA 2ZKLA 4GAZA 2B4KA 5EPAA 5IVJA 3ACFA 4MLGA 2GALA 3WNLA 2ZXQA 2WT1A 4JKMA 4GULA 2E7AA 1HXS1 5H9RA 2X5IA 4LK7A 5FMBA 2JDZA 3VBOA 2ZGPA 3HR9A 1PIV3 5DDJ1 1IS3A 2NMNA 5FYVA 4MVTA 2O8QA 4A7YA 4BXFA 2E33A 2PHFA 3MFAA 5I91A 1VRBA 2BNOA 2Y0OA 4IEXA 3EBRA 3QEFA 1FV2A 3WP3A 4RFRB 3VKLA 4HOOA 1RUC3 4UOJA 4UW6A 3C7FA 2VTFA 3MYXA 4COWA 3T0DA 5AYCA 3OBRA 4CDUA 3SNMA 4BE3A 3FWEA 3PU8A 1WW4A 2ZA9A 2ID4A 1FYUA 2OKXA 3V64A 4LOSA 4CDWB 4IXLA 5FWJA 3WLUA 1WA4A 2I07B 1DP0A 4QGLA 2ZEXA 2RM22 4AL9A 4Q0SA 4M0HA 2VJXA 2VW0A 3MUY1 2RR11 1J83A 2MEV2 1NXD1 2RS32 5C3QA 1OF3A 2G4IA 1VIWB 3VSZA 2EAKA 2HWB3 2XJTA 4GALA 3WW1A 4CCLA 3B94A 4NN0A 2UY8A 2VGDA 4LHNA 1NCQB 1PGW1 3QH7A 5BNOA 4OUEA 1V00A 3C7EA 1FATA 4CPBD 3T3YA 1CN1A 3V0AB 4KCBA 4N9HA 4LIVA 1UYPA 4LUKA 1ZBA2 2VOKA 2X8SA 3UYJA 4IEZA 4URTA 1JYVA 1O4TA 3AZYA 3J7MA 5F3IA 5F3EA 3H3UA 4YRDA 5FY9A 3AZWA 4EN8B 1UOFA 3VDDC 5LA0A 4Q4X3 4N90A 2BGCA 4YW6A 4OLLA 2VBPA 2XLGA 4BQ3A 3R4YA 5CFDA 1LGCA 1SLLA 1TG7A 1CQ9A 2TEPA 4LOTA 1AUYA 3N9OA 3ZVXA 2YFSA 3BPZA 3ZN6A 2ZGLA 3M8LA 3Q9OA 1RTVA 1YYNA 4N9IA 4YVSC 1HRI3 3JXSA 5JIUA 5JOZA 2JB8A 4EWEA 3CMGA 2YBPA 2YC0A 3R4UA 3VUOA 5BNPA 2G9FA 1I3HA 3B9IA 4NWVA 2MHFA 4XF0A 2WO3A 3AKIA 3BYJA 3AMHA 4AI9A 1WBLA 1OLQA 4MX3A 5CA6A 4HVRA 3PVNA 1KITA 2VNGA 1LJ7A 2R0HA 4NIIA 5CKNA 4PLOA 1C1LA 3LEKA 3WATA 4AK5A 2JENA 4OI4A 5FZ7A 1PGW2 3MPPG 1CAUB 3RSJA 1UIJA 2RS11 2VQTA 1JN2P 1WMEA 4FTEA 3I3DA 3D60A 4XFCA 3PNAA 5D2AA 5GLWA 4L0PA 2QQOA 4AVTA 4XABA 1U5ZA 4XCBA 4Z1VA 5F5CA 3W21A 3S6PA 4LUMA 4LNVA 2Q8CA 3ZSEA 4AVAA 1AR73 1P8JA 2HEWF 2X8KA 2PAMA 5JZGA 4P00B 4O65A 4P5YA 5C6CA 1FI2A 4C1WA 4AEDC 1XE0A 3FC0A 1W6MB 4B4PA 4Q4V3 4NOTA 3ALQA 2GP3A 2PQSA 2VXJA 1OF4A 1LR5A 4OZXA 1GMMA 3J4UH 4UW5A 4FOYA 3HMYA 4KC8A 5CISA 5AFEA 4UYBA 3M70A 3NV1A 4L9BA 2D98A 3ZN6B 4I0WB 1PM7A 1WMFA 4OVEA 5H9QA 3O7OA 3WZ1A 1EAH3 4HZFA 1LB2A 2BQPA 4Q4V2 1W2TA 4XBNA 5BNOB 5J09A 2HJIA 3H1WA 3IMNA 1NE6A 4FCAA 4L8QA 4QPIB 5E16A 5FYIA 4C1XA 1WL7A 3WDUA 4PLNA 4SBVA 2DV9A 3ZSKA 4CTEA 2VUAA 2L9LA 2PHDA 2JE8A 3TAWA 1UY1A 3WHUA 4W6XA 1O4ZA 4UXAA 4A2UA 4NHXA 1F2NA 1V6NA 3AB0A 1LOCA 3DECA 4ZU7A 3LAGA 3QH6A 2R32A 3HNYM 4FAGA 1W8UA 3FBMA 3K77A 1W6PB 1GOFA 3K75B 4V2WA 4X8PA 4MOAA 1O59A 3A7QA 3WF0A 4XBLA 3TB0A 4BXSV 1RUH2 5FY0A 4B7KA 2BFUS 2DYCA 1GZWB 2E32A 3OUHA 1AVBA 3OGSA 5I93A 2F4PA 3FMGA 1ZRFA 2OA2A 4XDOA 1Q56A 3OBAA 4LBMA 4I09A 4XFBA 4Q1PA 4XFGA 2LM3A 3CL1A 1UN1A 1KFUL 2ARCA 2KD7A 2HYKA 4WZFA 1FT9A 1G8WA 4GWMA 2LW8A 4HONA 4PI2A 1TEIA 4RR3B 3UGGA 3VL9A 1DG6A 1W2AX 4KNCA 1SLTA 3ZXJA 2UY9A 1PK6A 4NAMA 4B1LA 2C5DA 3MW2A 4ZS2A 1F15A 1OUSA 5C2MA 1OQEA 1RUI2 1J84A 1HB2A 1BYHA 1X36A 4JQRA 3BIWE 5J36A 5FQ0A 1BHGA 3HNBM 4AVCA 1VBA1 5DG1A 4W6WA 1VBC2 2Y33A 1CZVA 3WG4A 3J26N 3VB9A 1NCRC 4YARA 1K5MC 1NZIA 3QOPA 3HJRA 3ZXLA 4C0BA 4OHYA 2DURA 2RJLA 2RDSA 1XE8A 4FPLA 5F37A 3C7OA 5D8AB 1BLZA 2WQ4A 1BJQA 4XDPA 5C4WB 2WL1A 1RUJ3 1GOGA 3KV4A 2OX0A 1S4CA 2GNDA 4K8FA 3THDA 3BU7A 4QXCA 5CFCB 5KBFA 3RZHA 2BPA2 2BVBA 1S0DA 3M3IA 1E5HA 1SQ4A 4QQHA 3SH3A 2AUYA 5I0DA 3U37A 1D4M3 4XOGA 2BW8A 3ORJA 2VQAA 3EQEA 2YROA 2NLRA 2ETEA 3HQXA 2ZGSA 5FUPA 1C1FA 3TNPB 2YFUA 5FPUA 5LEKA 1GU3A 4IEUA 2BGOA 3LQCA 3N9LA 4DS0A 4DUWA 3EYPA 2WFF3 4XW3A 3BOPA 1VBD1 2VY0A 1BMV1 2I2SA 3ES1A 1RHI3 3B7MA 3OBZA 2PYTA 1JYTA 3VL8A 1OPOA 5F3GA 2X8TA 3WF1A 3ZXAC 3O1MA 3T2TA 2PLV1 2ZZJA 2ZX0A 4I3PA 4FO9A 1BEV1 1I5PA 3VBHB 2EIEA 4WM7B 1SZBA 1HN0A 1ZA4A 5EFUA 4ZKTB 3NNGA 4LR4A 2RS33 1HDKA 5E6HA 4AZZA 2WFF1 1UIKA 4SLIA 3IDBB 1CD3G 4HPKA 2D44A 3BGAA 4HMZA 3RZZA 3B02A 5FY4A 2WJSA 5KHHA 2FZ1A 2D3PA 4P9IA 1OLMA 3S0MA 2ARBA 1VR3A 3DF0A 2OZJA 1GWKA 2B45X 1W8NA 4QQLA 1SG3A 1HV1A 2QZ3A 2RHPA 2QCSB 1Z0HA 4QDSA 4RN5A 2CGPA 1KQRA 4EJRA 1NKGA 3P2NA 1Z7S3 3ILFA 3J8F3 3RZJA 2IXLA 4RHV3 2WIIB 1YWKA 3CF6E 3RQ0A 2W1QA 3DPRA 4OHXA 3WPZA 1YFUA 3FN9A 4G9SB 3T2OA 5CFCA 4F7ZA 1CPMA 5DUXA 1Q3EA 5ANNA 2DTWA 2RS12 1HRI2 2WO1A 1EV12 3CNAA 1NT0A 1ENQA 3KT7A 3NNJA 2WA4A 1ASJ3 3THPA 4AI8A 2YDEA 1QH7A 4FPOB 4IV1B 3I2DA 4UFMA 4RL7A 2C1FA 1UWWA 2XQXA 3MIDA 5LBBA 4LO4B 2IUWA 3ELNA 1SLBA 5EJZB 3TBDA 4NHYA 1RUD1 2ZACA 1UNBA
chains in the Genus database with same CATH topology
3H3LA 3HBKA 3C2UA 4AK6A 5GLOA 3U75A 5JOYA 3OM5A 2YFSA 2B4WA 4CCDA 5FIXA 1PT2A 2EXJA 5JOZA 4AK7A 4PVIA 5AYDA 3LDKA 2AEYA 3OSDA 3KF3A 4O8NA 3VSRA 4UDKA 3AKIA 3BYJA 3ZXLA 3OM6A 3U14A 3WN2A 3SC7X 3C7OA 3LIHA 3R67A 5FMCA 3C7GA 4N1IA 4QQSA 3WATA 4AK5A 4KMIA 1UV4A 3D5YA 3S5QA 3D60A 4UFKA 3RWKX 5GLPA 3LIGA 1GYEB 1Y7BA 1YIFA 1YI7A 5GLKA 5FMDA 3QC2A 4O8PA 1GYHA 1W18A 3WMZA 5FKBA 4NOVA 3VSFA 4ONZA 4UDKE 4CCCA 5A7VB 2AC1A 4D47A 3LF7A 3WAUA 5A7VA 3LFIA 3KF5A 3BYLA 2QQWA 3LV4A 5FK8A 5GLMA 3WPYA 5C0PA 1Y9MA 5FLWA 1VKDA 2X8TA 3NMBA 3WPUA 3VT1A 3QEEA 4QHZA 4MLGA 5B6SA 3PIJA 4FFIA 4KC8A 3AKHA 2VDTA 5FMBA 2X8FA 3C7HA 4UFJA 5GLQA 2QQVA 4U6DA 2EXIA 2XQRA 4COTA 4FFFA 4AZZA 3VT0A 5GLNA 4UFLA 1Y9GA 4UDIA 3WMYA 3AKGA 1W2TA 1ST8A 2YFRA 4UDJA 3QEFA 3NQHA 3ZXKA 5A8DA 3IMMA 2YFTA 5JOWA 2ADEA 3C7FA 4CCEA 1WL7A 3WPVA 3PIGA 5AYCA 3UGHA 2OXBA 5AY9A 3BYNA 4JQTA 3ZR6A 3TAWA 3U1XA 4FFHA 4UFIA 3WASA 5AYEA 3ZR5A 4N2RA 3QEDA 4FFGA 2ADDA 2QQUA 3OM4A 3P2NA 1Y4WA 4N2ZA 2AEZA 5FK7A 4KCAA 4O8OA 3WN0A 5GLLA 3QZ4A 1OYGA 4B1MA 3VSZA 3K1UA 3VT2A 3D61A 3WPZA 3AKFA 3LEMA 3OM7A 5JOXA 3R4ZA 4PVAA 4HXCA 4U6BA 3C7EA 3WN1A 4UFHA 5ANNA 5FKCA 1GYDB 3BYKA 4KCBA 3VSSA 2EXHA 4UDGA 1UYPA 3CU9A 3KSTA 4UFMA 4N4BA 5A8CA 2X8SA 2EXKA 3OM2A 5B6TA 3UGGA 5GLRA 4KC7A 1YRZA 4EQVA 3LDRA 3UGFA 3ZXJA 3D5ZA 4B1LA 3R4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3L A;  3HBK A;  3C2U A;  4AK6 A;  5GLO A;  3U75 A;  5JOY A;  3OM5 A;  2YFS A;  2B4W A;  4CCD A;  5FIX A;  1PT2 A;  2EXJ A;  5JOZ A;  4AK7 A;  4PVI A;  5AYD A;  3LDK A;  2AEY A;  3OSD A;  3KF3 A;  4O8N A;  3VSR A;  4UDK A;  3AKI A;  3BYJ A;  3ZXL A;  3OM6 A;  3U14 A;  3WN2 A;  3SC7 X;  3C7O A;  3LIH A;  3R67 A;  5FMC A;  3C7G A;  4N1I A;  4QQS A;  3WAT A;  4AK5 A;  4KMI A;  1UV4 A;  3D5Y A;  3S5Q A;  3D60 A;  4UFK A;  3RWK X;  5GLP A;  3LIG A;  1GYE B;  1Y7B A;  1YIF A;  1YI7 A;  5GLK A;  5FMD A;  3QC2 A;  4O8P A;  1GYH A;  1W18 A;  3WMZ A;  5FKB A;  4NOV A;  3VSF A;  4ONZ A;  4UDK E;  4CCC A;  5A7V B;  2AC1 A;  4D47 A;  3LF7 A;  3WAU A;  5A7V A;  3LFI A;  3KF5 A;  3BYL A;  2QQW A;  3LV4 A;  5FK8 A;  5GLM A;  3WPY A;  5C0P A;  1Y9M A;  5FLW A;  1VKD A;  2X8T A;  3NMB A;  3WPU A;  3VT1 A;  3QEE A;  4QHZ A;  4MLG A;  5B6S A;  3PIJ A;  4FFI A;  4KC8 A;  3AKH A;  2VDT A;  5FMB A;  2X8F A;  3C7H A;  4UFJ A;  5GLQ A;  2QQV A;  4U6D A;  2EXI A;  2XQR A;  4COT A;  4FFF A;  4AZZ A;  3VT0 A;  5GLN A;  4UFL A;  1Y9G A;  4UDI A;  3WMY A;  3AKG A;  1W2T A;  1ST8 A;  2YFR A;  4UDJ A;  3QEF A;  3NQH A;  3ZXK A;  5A8D A;  3IMM A;  2YFT A;  5JOW A;  2ADE A;  3C7F A;  4CCE A;  1WL7 A;  3WPV A;  3PIG A;  5AYC A;  3UGH A;  2OXB A;  5AY9 A;  3BYN A;  4JQT A;  3ZR6 A;  3TAW A;  3U1X A;  4FFH A;  4UFI A;  3WAS A;  5AYE A;  3ZR5 A;  4N2R A;  3QED A;  4FFG A;  2ADD A;  2QQU A;  3OM4 A;  3P2N A;  1Y4W A;  4N2Z A;  2AEZ A;  5FK7 A;  4KCA A;  4O8O A;  3WN0 A;  5GLL A;  3QZ4 A;  1OYG A;  4B1M A;  3VSZ A;  3K1U A;  3VT2 A;  3D61 A;  3WPZ A;  3AKF A;  3LEM A;  3OM7 A;  5JOX A;  3R4Z A;  4PVA A;  4HXC A;  4U6B A;  3C7E A;  3WN1 A;  4UFH A;  5ANN A;  5FKC A;  1GYD B;  3BYK A;  4KCB A;  3VSS A;  2EXH A;  4UDG A;  1UYP A;  3CU9 A;  3KST A;  4UFM A;  4N4B A;  5A8C A;  2X8S A;  2EXK A;  3OM2 A;  5B6T A;  3UGG A;  5GLR A;  4KC7 A;  1YRZ A;  4EQV A;  3LDR A;  3UGF A;  3ZXJ A;  3D5Z A;  4B1L A;  3R4Y A; 
#chains in the Genus database with same CATH topology
 2FCU A;  2WA3 A;  2WSV A;  4NJ4 A;  5DAP A;  1ALY A;  4R9A A;  2EIC A;  5E8A A;  5EIY B;  2V73 A;  3I2O A;  3KCC A;  1WCD J;  4MGT A;  4XCA A;  3MZH A;  1AYN 2;  1PK6 C;  4DY5 A;  1UY4 A;  2YV8 A;  5C3P A;  4BZ4 A;  5DAW A;  3SHR A;  1CVN A;  3N7J A;  4JGZ C;  3BTY A;  4XAE A;  2V4A A;  2HH9 A;  2HWF 3;  4L99 A;  4HG6 B;  1JHJ A;  1RUG 1;  4A7K A;  4FVV A;  2IXI A;  2ZEW A;  1XSR A;  1JYC A;  1VBB 2;  2XG3 A;  1W8O A;  3GBW A;  3MIG A;  4KWJ A;  3G7D A;  1NZC A;  2VNV A;  5FBJ A;  4AGG A;  4BIS A;  5E89 A;  4Z8B A;  5F9T A;  3OPW A;  3VKO A;  1GUI A;  1NCQ C;  1EYB A;  1RJ8 A;  1RUG 2;  4PIY A;  5JWP A;  3H7Y A;  3BYW A;  2VVE A;  3WD5 A;  4LXL A;  2KXL A;  3TWI A;  3S5A A;  2A6Y A;  1ZZ9 A;  3N9Q A;  1YNA A;  2HWD 3;  4Y5T A;  3PUQ A;  2AZ5 A;  1XNA A;  1ODM A;  4K40 A;  4UBG A;  1VMJ A;  4RQP A;  3DYP A;  5B2G B;  2DVD A;  1IKQ A;  3WQ1 A;  4O8P A;  1AJK A;  1O3Q A;  1G7Y A;  1YFY A;  1OA3 A;  4DZG A;  5K9Y A;  5LZ6 A;  4YW3 A;  3AZX A;  1SCR A;  2JG9 C;  3EO6 A;  5EWS A;  3BYL A;  4OMD A;  3GHM A;  3UKT A;  4QQO A;  3LV4 A;  1BQP A;  3UNP A;  5C0P A;  1WLW A;  3WSO A;  1NAE A;  4ZON A;  4CA9 A;  2YMZ A;  4COZ A;  2Q1M A;  5C9A A;  1OVS A;  4NPM A;  1QIQ A;  3P3N A;  3ZMN A;  1A8M A;  2K9Z A;  4YVW A;  3ST7 A;  5ANQ A;  2J1R A;  4P9G A;  2BFU L;  1JYN A;  1POV 1;  1QJY 1;  1K42 A;  2LTN A;  2JD9 A;  3H50 A;  2ILM A;  3KMH A;  1UQX A;  5KXD A;  1O3S A;  3GNE A;  5FPL A;  4TSV A;  5BYN A;  1CGP A;  4XJZ A;  2EXI A;  3FUQ A;  1QJE A;  4EN6 B;  4AE2 A;  2IVJ A;  3UJO A;  3ZXK A;  4JRA A;  1XNB A;  1AR7 1;  4MGQ A;  1XNC A;  1RUF 3;  1W6Q B;  4XVH A;  1UZW A;  4LO5 B;  3PIG A;  3NL1 A;  4YNI A;  2GDF A;  2YPJ A;  5HXM A;  2ZTN A;  1E5S A;  3VLB B;  1IPS A;  3VBU B;  4Q0V A;  3PVE A;  1US2 A;  3NAP A;  1EUU A;  4YW2 A;  3VBR C;  1H2K A;  4BU2 A;  2JG9 B;  3E6C C;  1UKG A;  2RS5 3;  4ET7 A;  2QBX A;  1MS5 A;  4CEY B;  1A34 A;  4P9W A;  2P3J A;  1VAM A;  2AYH A;  4YW7 A;  4BQX A;  5T55 A;  4QX1 A;  3O1V A;  5A1F A;  2VOV A;  3AYD A;  2JJ6 A;  1S2E A;  4XDQ A;  3AKF A;  4FSJ A;  2Y6H A;  4DXS A;  1GAN A;  1CIY A;  3AXE A;  4RA0 A;  1PVC 1;  4ZPI A;  5GLT A;  1GYD B;  2XXZ A;  3MV1 1;  5D21 A;  3ZKU A;  5CAZ A;  5I8S A;  3VKF C;  1HN1 A;  1N1Y A;  4M4R A;  5FZ0 A;  1S55 A;  4GMP 1;  5CYY A;  1NLR A;  5B6T A;  2J1V A;  1GNZ A;  4XFH A;  1R08 3;  5AC9 2;  5ABJ A;  4JGY A;  1QQP 1;  1OOP A;  2ATF A;  2Q8D A;  5LY1 A;  2R04 1;  2JIC A;  1DLC A;  5FZL A;  2OW4 A;  4QGN A;  2ZZQ A;  1H8V A;  1J1T A;  1PO1 1;  2DVA A;  4PT6 A;  4DUV A;  1OUX A;  3SEP A;  2YU2 A;  4DOU A;  1SDW A;  4TN7 A;  5EJ3 A;  3CBN A;  1OKO A;  4Q4X 2;  3UKV A;  1LGB A;  1OVP A;  2HEY F;  1WW7 A;  4M3C F;  1OA2 A;  5FY8 A;  2WNV B;  3OY8 A;  3ZN5 A;  3B69 A;  4ATF A;  4NRQ A;  4JHZ A;  3MF6 A;  1VE0 A;  4NO4 A;  5E1R A;  5FMC A;  1S0F A;  3WNO A;  4RS5 A;  5GAL A;  3PL0 A;  4I3G A;  4QXH A;  4N1I A;  5DXD A;  1ZX5 A;  4E9K A;  4I30 A;  4CDQ A;  4P9J A;  2DUO A;  3TOJ A;  4KMI A;  2ZHM A;  3RGB A;  1M4W A;  1Q8P A;  4NHM A;  1D2Q A;  3LPF A;  4X8N A;  4XF4 A;  3LD8 A;  4Y4Y A;  1RGS A;  1US3 A;  1JZ4 A;  4UFK A;  1HQL A;  4LJH A;  5GZC A;  4U36 A;  2P2K A;  4Q4W 3;  4Y26 A;  2A3W A;  1PIV 2;  4RQP B;  5F2S A;  4AFD A;  3AKR A;  2VZU A;  1QXR A;  5FYT A;  2LS6 A;  5FMD A;  4JVA A;  1W18 A;  1RUC 1;  1XXN A;  3POF A;  4YW5 A;  4QMA A;  5A3W A;  4ONZ A;  1F5J A;  4UDK E;  3BIE A;  4M3C A;  2Q8E A;  4YZ1 A;  4XZP A;  2WR9 A;  4D6S A;  4OFG A;  3TRS B;  2ORZ A;  3RYP A;  2JG8 A;  3DXT A;  3I2F A;  3WPY A;  1PIV 1;  2D6M A;  3O1T A;  4XF3 A;  1RUN A;  2VZO A;  4AHZ A;  1MS8 A;  2HWC 1;  2PTM A;  4N7I A;  1RL3 A;  1YJK A;  3BOD A;  5FUI A;  2W2I A;  1QMJ A;  2QE3 A;  3POG A;  2F4L A;  4AF9 A;  4BK4 A;  4CVU A;  3VBO B;  3USU A;  2E7Q A;  2FQP A;  1W8W A;  2ZJC A;  1VRH 3;  2EIB A;  3DPR B;  5F6L B;  5BNN C;  4CP0 A;  1WBF A;  2HBT A;  3WV6 A;  5A7O A;  3V0B A;  1VBD 2;  2DCY A;  3K4D A;  4QHO A;  5FLH A;  4B4R A;  1BMV 2;  4LOR A;  3ZSM A;  4LT5 A;  2VCB A;  4GJZ A;  4JDM A;  2GSY A;  5A8D A;  3TEZ A;  1UW8 A;  1HXS 2;  3Q8E A;  4XC9 A;  4YGC A;  4CEW A;  4WM7 C;  3DXU A;  1VB4 A;  2NQY A;  4CEY A;  5E88 A;  2HWC 3;  1POV 3;  1F8V A;  3O1O A;  3UGH A;  1W8Z A;  2K0G A;  4BB3 A;  1RUI 1;  2ZGT A;  3NJV A;  4HKL A;  1SPP A;  3WAS A;  3URF A;  4KI5 M;  1X50 A;  2VZP A;  5F39 A;  2FHR A;  3CU7 A;  3T2P A;  3K46 A;  3QEE A;  1LGN A;  1G9A A;  4OI0 A;  3N9P A;  1HKD A;  4O7X A;  3RDI A;  3CEW A;  1ZBA 1;  2VAU A;  2ZX2 A;  4XAA A;  5KWR A;  4YLZ A;  1W05 A;  1W8F A;  5K8S A;  3BCW A;  1E57 A;  4UF0 A;  2FDF A;  1MEC 3;  3NWK A;  4MHR A;  4N53 A;  2TNF A;  3JQW A;  5J37 A;  1LAJ A;  1XE7 A;  4QQ2 A;  3NNL A;  4GB3 1;  4DUX A;  1NA1 C;  5L7O A;  3KHC A;  1MQT A;  3JBG 3;  2MEV 1;  2Z69 A;  3BOW A;  4JX0 A;  3AVR A;  5GLR A;  4Q1R A;  2OQ6 A;  5EYX A;  3NV4 A;  3UGF A;  1UOJ A;  3PUS A;  1CIW A;  5C4W C;  3I2H A;  1MS3 A;  4DPN A;  4K7J A;  4Y22 B;  2IXC A;  3AMN A;  2JEM A;  3B9C A;  4MXW A;  3L2Y A;  5FJK A;  3RI8 A;  4OUS A;  5KHG A;  5GLO A;  1QH6 A;  5JZG C;  2VW2 A;  1DHK B;  3NVC A;  2B4W A;  3A4U A;  3H42 B;  4FP3 A;  3MFC A;  1G9D A;  2W92 A;  1SFN A;  3J9S A;  4FPG A;  5AYD A;  1R08 2;  2CU5 A;  3FE5 A;  3LDK A;  4BIF A;  2R04 3;  3FL7 A;  3N4M A;  2O1Q A;  4O8N A;  4B7E A;  2DVB A;  1CX1 A;  2Z4F A;  5FPV A;  3SXW A;  1LOF C;  2VO5 A;  3MUZ 1;  5DZF A;  3FLR A;  3I2K A;  5DUW A;  5T5L A;  3WN2 A;  3MPB A;  1CJD A;  3D4K A;  4IER A;  1NUK A;  4ARY A;  4HSL A;  4CCN A;  3R67 A;  3M7A A;  2VL4 A;  5A3M A;  2Q4S A;  2R16 A;  4A6O A;  4E27 A;  4QQS A;  2XLF A;  1QNY A;  5CB7 A;  1NA1 B;  2YPD A;  2D3R A;  2BGP A;  4S2F A;  3B01 A;  3FHA A;  4AVV A;  1W0O A;  4ATE A;  1Y7B A;  3LIG A;  3NRU A;  4JV4 A;  3RPQ A;  2JDA A;  3T1L A;  5LRS A;  1MZ5 A;  4HFS A;  1RUJ 2;  3H8O A;  1B09 A;  3LPG A;  4QQP A;  2B42 B;  5EV7 A;  3NNM A;  5A7Q A;  4IEW A;  4B3N A;  1PHM A;  1R64 A;  1ULD A;  2OUJ A;  1UYZ A;  2ZCW A;  2XJU A;  3KVB A;  3MDP A;  1RC6 A;  3ZPY A;  1VAL A;  2P17 A;  2E26 A;  1UY3 A;  4CUG A;  5CKM A;  4CYD A;  5ACA 1;  5C8C B;  5CIR A;  4BK5 A;  2EAA A;  3RNS A;  5FYZ A;  5HV4 A;  2QZ2 A;  5FK8 A;  4XBQ A;  4BQ1 A;  4JGY C;  4CDX A;  5GLU A;  1ACC A;  4PBP A;  4K6B A;  1IS6 A;  4LO8 A;  3ZXF A;  4ZY9 A;  1XYN A;  5LBE A;  2XDV A;  1HB3 A;  2LRP A;  4WV8 A;  1UX6 A;  3ZYF A;  3WNX A;  1DGW A;  1XC6 A;  5L73 A;  3POS A;  2FMD A;  4LE4 A;  4COU A;  5F1R A;  3WMY A;  1NA1 A;  1DZQ A;  3WQB A;  2CYF A;  5I0T A;  1UZY A;  1FPN 1;  1JOP A;  5A7W B;  3I59 B;  4RGK A;  4QD2 A;  4Q5O A;  4XUQ A;  4XMA A;  2PHU A;  1W9T A;  3VBS A;  1AYN 1;  1GZW A;  1WKY A;  5HXV A;  4I0A A;  1W6N A;  1WMD A;  2MPF A;  1BVV A;  1BK1 A;  2D6K A;  2RM2 3;  1NXM A;  4IV3 C;  3L9J T;  1RIT A;  3MIF A;  4IW3 A;  1R09 1;  1I5Z A;  5A80 A;  1SFP A;  2KA3 A;  4XIL A;  4KCA A;  3H8U A;  5IFP A;  5GLL A;  4P9Y A;  2C4X A;  2A7A A;  3ZFG C;  4PQQ A;  5AVA A;  5FZG A;  3MEP A;  2OUH A;  4B8E A;  5EQU A;  4QHB A;  4FT8 A;  3S7E A;  2CV6 A;  2YGM A;  1W8T A;  1A3K A;  1SFY A;  3POY A;  4XHB A;  4KG8 A;  4Z92 B;  1W9W A;  4TLF A;  3VZO A;  3VBF B;  3WCS A;  3F2Z A;  2RR1 2;  3OM2 A;  2W1S A;  4QPW A;  1J58 A;  1Q43 A;  3S57 A;  3AZZ A;  1J3R A;  1RUJ 1;  4JHT A;  5L7O C;  3GHN A;  2P4E A;  3MGU A;  4P14 A;  5KHI A;  2AAC A;  2PFW A;  5BV6 A;  3GJA A;  3LKJ A;  4A3X A;  4PF1 A;  1S0I A;  2C0Z A;  3KV9 A;  4JGZ A;  4LBL A;  1OA4 A;  3LA3 A;  1LEC A;  1FXZ A;  3RJR A;  4FI9 A;  4KH9 A;  3CZJ A;  3LSD A;  4ZU4 A;  2VUJ A;  1L7R A;  3CJI B;  2PLV 2;  4AVB A;  1H1I A;  1QU0 A;  1PT2 A;  3OEB A;  1CAU A;  3R05 A;  1D4V B;  5FZ8 A;  1WD4 A;  2V72 A;  4YG6 A;  1W2N A;  1A6C A;  4QKB A;  3WNK A;  1R09 2;  2GC1 A;  2C24 A;  1K45 A;  3BUC A;  3K4A A;  3WF2 A;  1FV3 A;  3D3A A;  2Y38 A;  4YVS A;  1TE1 B;  3VD3 A;  4D94 A;  1AR8 3;  1IGO A;  3ZOI A;  4BCU A;  4PF5 A;  2Y6L A;  5IW0 A;  4CUC A;  1K5J A;  2VME A;  5C9A B;  1HX6 A;  2WLP A;  4PHZ A;  5FPX A;  5J48 A;  1F4A A;  4UW3 A;  1UV4 A;  1MS1 A;  2MEV 3;  1RUC 2;  2OPW A;  2FDG A;  1QGL A;  1NOV A;  1I6X A;  2HWB 2;  5FZH A;  4AVS A;  5GLP A;  2ZX1 A;  4Q4W 2;  4GB3 3;  4QX7 A;  1XQN A;  3V0B B;  3Q8F A;  1MS0 A;  2Q30 A;  1T6G C;  4GWI A;  2VMF A;  1JTZ X;  2ZMK A;  5FO8 B;  1MEC 1;  2OPK A;  4AFM A;  2VMH A;  2R06 3;  3KV6 A;  2P5B A;  3PVB B;  2XWJ B;  5FYB A;  2W39 A;  5KXB A;  3NJY A;  2Y0I A;  1UO9 A;  4Q26 A;  2W1U A;  1WGP A;  3LFI A;  2W08 A;  4JKK A;  5GKA C;  3PTY A;  5GLZ A;  1OLR A;  1UMH A;  2Y6G A;  2ZEY A;  1PVC 2;  2D7F A;  3OUI A;  1CON A;  2E9Q A;  5BNP B;  1ULO A;  3MO4 A;  1XBF A;  4AG4 A;  4CSW A;  2A6Z A;  3KB5 A;  4E4D X;  4PDW B;  3ZYJ B;  4IET A;  4CDX C;  5BPX A;  4CU8 A;  3KS7 A;  1WLD A;  2JE7 A;  4D7Y A;  1XPW A;  4OZO A;  3S30 A;  3OGV A;  1EAH 1;  4M4P A;  4Q0P A;  5FMO S;  1ENS A;  5JOW A;  3SH4 A;  3V0A A;  3VHN A;  2ADE A;  5LY2 A;  4AI2 A;  1ASJ 2;  2QQJ A;  1WW5 A;  1XNK A;  3AP4 A;  2JIG A;  1QY4 A;  1RYY A;  2YC4 A;  4IE6 A;  4HAN A;  5C8C C;  4YFZ A;  1PO1 3;  2QNK A;  1XSQ A;  3CZU A;  1OPM A;  3NV2 A;  2DCT A;  3T4H B;  4NVP A;  1V9U 1;  3MLJ A;  4D3W A;  3KQR A;  1E5R A;  3MLK A;  2XBO 3;  1UL9 A;  2OII A;  1PO2 2;  1W03 A;  2JDM A;  3HN3 A;  4W50 A;  1REE A;  3JQX A;  4QPI A;  3UJQ A;  2PXJ A;  4Q8K A;  2IC1 A;  2B7Y A;  4FQZ A;  4KWL A;  3WNM A;  5K0U A;  3ZFF C;  4AFB A;  1WD3 A;  3JUU A;  5A32 A;  1CJP A;  3FX3 A;  3JB4 C;  3IWZ A;  5JOX A;  2DCK A;  4U6B A;  4PVA A;  1ND3 C;  2H0B A;  3MIC A;  3PJY A;  5FPA A;  1TME 1;  1FNY A;  1S0C A;  4OYU A;  4Q4W 1;  5ABJ C;  1LKN A;  3AM2 A;  4IEY A;  1UU4 A;  4MSV A;  2JG8 B;  2R7E B;  1F4H A;  2YBK A;  3MHZ A;  2DBN A;  3WQ7 A;  2W95 A;  2ZHN A;  3AKP A;  4EQV A;  2E53 A;  1F31 A;  3KGZ A;  3NJX A;  4XUR A;  3ACG A;  3BVC A;  4FOQ A;  5ERL A;  5FZO A;  3WP4 A;  4BYY A;  1YCI A;  2RE9 A;  5AFB A;  3ZXG A;  3D5O A;  1AR7 2;  5FLJ A;  3VBR A;  5JZG B;  4MGK E;  2Y60 A;  2X10 A;  1CZS A;  3AP7 A;  1D4M 2;  2CHH A;  2YFZ A;  3WW3 A;  1AL2 1;  3ZYG A;  2WWS A;  3M3E A;  3O14 A;  2A1X A;  1RIN A;  2HWC 2;  2AR6 A;  4D6R A;  1W6P A;  3TEY A;  1QHD A;  1GP5 A;  1UD1 A;  1JMU B;  5FP8 A;  4N43 C;  4W4Z A;  1C8N A;  2BTV C;  4S2H A;  3U14 A;  1QJX 1;  4EN0 A;  5L9V A;  4FPH A;  1RVF 1;  1UY2 A;  3JU9 A;  4Q4X 1;  5FYM A;  3UK9 A;  4CDU C;  1V0A A;  4Q4Y 1;  4YZ3 A;  1HRV 2;  2YUE A;  2VQU A;  1N3P A;  1SDD B;  1K5M A;  5DAQ A;  1KS4 A;  4TXW A;  5DAV A;  1W6Q A;  4R9C A;  4R4Z A;  5L7O B;  4YGB A;  2G9Z A;  4PDW A;  3VZL A;  1RMU 2;  2ZS6 B;  4MV2 A;  3VD7 A;  1Q5O A;  3DL3 A;  5B4X A;  1V6L A;  5CU1 A;  3J7N A;  2ZAA A;  4C90 A;  4MH0 E;  5FZI A;  3RYR A;  2FDH A;  1YI7 A;  3N9N A;  5DUU A;  3IN9 A;  4HLT A;  2AEN A;  1G6N A;  2ZKN A;  3R6S A;  4BDV B;  4NOV A;  1Q8O A;  4CP2 A;  5A3O A;  3SQO A;  1QJY 2;  2VZQ A;  1ENX A;  2FDJ A;  2ZMN A;  3ATG A;  3N9M A;  1GP6 A;  3LF7 A;  2JKX A;  3HIF A;  1K3I A;  4I01 A;  4AOC A;  4BA6 A;  5LEJ A;  5DMY A;  1JZ6 A;  1GKB A;  2OT7 A;  2TUN A;  1VKD A;  2HWD 1;  2W47 A;  1O8S A;  2YHJ A;  1GZT A;  1EPW A;  1K5M B;  2OZ6 A;  1D2S A;  3AYE A;  2WO7 A;  5H9S A;  3WPU A;  2P3Y A;  3OEA A;  2BNM A;  5EJ1 B;  2VDT A;  3DPR C;  1KDM A;  2CNA A;  1ZRE A;  1IQD C;  2LUW A;  1FMD 1;  3O1S A;  3I97 A;  3KLS A;  5FZ3 A;  3C3V A;  3PU3 A;  2R04 2;  2VCA A;  5FZK A;  4EE2 A;  1AYM 3;  1AJO A;  1GSL A;  1RUD 2;  2RJ2 A;  5J1X A;  1VAK A;  4XPV A;  4XJA A;  4XZU G;  3L2H A;  4ZXK A;  3VD5 A;  1GP4 A;  4CUB A;  4JGZ B;  2DWR A;  1GZC A;  4PCR A;  4BWO A;  4AW7 A;  3CKH A;  5KC6 A;  4FPC A;  4IEV A;  4ARX A;  4XIK A;  1CES A;  1ZZ7 A;  1MVE A;  2BOI A;  1O4Y A;  3CJI A;  1NG0 A;  3BTA A;  3FJS A;  4UW4 A;  5FZO B;  1FPN 3;  1JBC A;  4LIT A;  3RMY A;  2A3Y A;  4NIA A;  2GH8 A;  3WXP A;  1YIP A;  2D5F A;  1UOB A;  4AAP A;  1WCK A;  3MIB A;  3HNM A;  4PIZ A;  4DXZ A;  4HN0 A;  4QB2 A;  4ISQ A;  1V6K A;  1LHN A;  1SLA A;  1U12 A;  1WLT A;  4CPB A;  4F3J A;  1EY2 A;  2RS1 3;  3VZJ A;  2FBE A;  2ZML A;  3EXU A;  1LOD A;  2X5I B;  2IZW A;  3KST A;  3NKG A;  4Y5Z 0;  2BRT A;  4N4B A;  3IAP A;  4BLI A;  4WVW A;  2VR4 A;  2G9G A;  2J7M A;  5T5J A;  3WF3 A;  1YRZ A;  1FOD 1;  5FZB A;  3LDB A;  4FAH A;  2P6H A;  5FZC A;  1HV0 A;  3A0K A;  3GGL A;  3ASI A;  2R1B A;  3RWN A;  3ZYI B;  5JOY A;  2VMI A;  1U5I A;  3D0S A;  4XEZ A;  3T09 A;  3ZIW A;  4ZZ5 A;  5A3T A;  4O9E A;  3IDE A;  1TVG A;  3VHO A;  2WFP A;  5C71 A;  4YFW A;  4IUG A;  4Z2A A;  2HWD 2;  3UL2 A;  3I49 A;  1VMH A;  3BU0 A;  4IND A;  5FWE A;  2W1W A;  4L2N A;  1QOT A;  2I45 A;  2P1B A;  1GQP A;  2EXJ A;  2WN3 A;  5C3S A;  3A22 A;  4RYD A;  2J1A A;  3ILR A;  1O7F A;  4AHW A;  3K48 A;  2RDN A;  3OY8 B;  1GBG A;  1V6M A;  2AEY A;  2DVF A;  2YB7 A;  1WA6 X;  3Q8C A;  4L92 A;  2WZE A;  1AXK A;  4R9B A;  4UDK A;  3VSR A;  3FFZ A;  2VOX A;  1DGW X;  1F5F A;  2XVG A;  3PJQ A;  1ZRD A;  3OOX A;  1LUL A;  2WS9 2;  3HN1 A;  5FYS A;  4DB5 A;  2WNU A;  4Y5S A;  2NN8 A;  4UT5 A;  5JCT A;  4CDW A;  1AR8 2;  5T5P A;  1LOA A;  1MZF A;  1I1E A;  4KL1 A;  2WZR 3;  4V1P A;  3ZM8 A;  3JCI A;  4F83 A;  2SLI A;  1X82 A;  4FXG B;  3SCG A;  3D5Y A;  2VBB A;  4KGQ A;  1BZW A;  3I3M A;  2GME A;  2Y6F A;  1GZ9 A;  1MS4 A;  1ASJ 1;  3OG2 A;  1YIF A;  3GCW A;  4GB3 2;  4AWD A;  1KJR A;  2UU8 A;  2QDN A;  4KMQ A;  1VBD 3;  2WKK A;  1GYH A;  3M4F A;  3WMZ A;  1GOH A;  4A4A A;  2QKD A;  1L7Q A;  2R06 2;  2BU9 A;  3PLQ A;  1GFF 2;  4N8M A;  3FLT A;  4CCC A;  5LB6 A;  1UZ0 A;  3RZL A;  4GIQ A;  4XJ8 A;  5DPN A;  1O91 A;  4ZZ8 A;  2KR2 A;  1ULG A;  1PVC 3;  1D4M 1;  3V65 A;  2UYA A;  3WT3 A;  4AEM A;  2VUD A;  3OUJ A;  2Y34 A;  1JW6 A;  1QJU 1;  2XVL A;  2DDU A;  1ZRI A;  2XGX A;  4TLG A;  4E2Q A;  2A5Z A;  3WNN A;  5B4N A;  4AEK A;  5JSO A;  1PZ8 A;  4NAO A;  1FOD 2;  4CU6 A;  2ZEZ A;  4D6Q A;  1YQ6 A;  2FCV A;  4FXK B;  2DU0 A;  1AR9 2;  3X29 B;  5LWB A;  3O1R A;  2HEV F;  5GLN A;  1ZZB A;  2XBO 2;  3WNP A;  3WDV A;  3AKG A;  4UDJ A;  1AR6 3;  2B39 A;  1JZ8 A;  1RUF 2;  3PUI A;  4TTG A;  3DGT A;  4NPR A;  2WZP P;  2HBU A;  4PLM A;  5DZG A;  4EZ4 A;  4AGV A;  3WHT A;  1DBN A;  1DFQ A;  4LA2 A;  4WVZ A;  4Y1X A;  3U0Z A;  2VNO A;  4JQT A;  5BNN B;  5F3C A;  2IFW A;  3ZR6 A;  3JD7 2;  4CU9 A;  2JX9 A;  2R0F A;  1ULE A;  3B93 A;  4UFI A;  2WN2 A;  4TZD A;  2PEL A;  5BXX A;  1OMI A;  1EV1 1;  5KR7 A;  1AR6 2;  2D40 A;  5FP7 A;  2GN7 A;  5GZG A;  4QAW A;  5JXH A;  4HL0 A;  1G9C A;  2VZ1 A;  3WN0 A;  2JG8 C;  2RDR A;  3V56 A;  4OHZ A;  3WDT A;  3K1U A;  3KVA A;  2B9V A;  3RFR A;  5FZE A;  5FO7 B;  1COV 1;  5J7M A;  3INA A;  4YM1 A;  2XUM A;  4N53 B;  3WN1 A;  4LKS A;  4TWT A;  2QDR A;  4UFH A;  1GLH A;  3AVS A;  3D6E A;  1H9P A;  3CDZ B;  4CXY A;  1V70 A;  5L9R A;  3DYO A;  4HKO A;  4CDW C;  5A8C A;  5FPB A;  1IG3 A;  4IES A;  2OS2 A;  3VZK A;  2V5Y A;  5IT6 A;  5ISL A;  1W3X A;  3LDR A;  3I54 A;  2Y6K A;  2ET1 A;  3WCR A;  1ONA A;  2D3S A;  4CCO A;  3W5M A;  1U5Y A;  4YZ2 A;  5I0S A;  4ES9 A;  2R1D A;  5JSR A;  4ONU A;  2E6V A;  1W9F A;  1YUD A;  4XET A;  5FXW A;  5FP3 A;  3IPV B;  4DXR A;  4FBF A;  1LEM A;  3MIE A;  4FQ4 A;  4A6S A;  2EID A;  5CG8 A;  4GWN A;  5A33 B;  4LEJ A;  1KGY A;  3OPZ A;  5A7P A;  1VAV A;  5FZ9 A;  1XJA A;  2GH2 A;  2XHK A;  1UZZ A;  1UX7 A;  2HKX A;  2WO2 A;  3FBY A;  3USU B;  3O5S A;  1ODN A;  5FYC A;  4RD7 A;  1YI9 A;  4H2A A;  3ZDV A;  5BNO C;  4CP9 A;  1H4G A;  3C7G A;  4BHP A;  5FXZ A;  2K2S A;  4BLJ A;  3AMM A;  3PHM A;  5A7N A;  5JMC A;  2YG0 A;  1TNF A;  4G3Y C;  3U4X A;  4A7Z A;  1GYE B;  1D0G A;  3I4I A;  4JCK A;  2EF6 A;  1PGL 1;  3WP5 A;  3NST A;  3HQU A;  2XVK A;  2WQ8 A;  3ABZ A;  5FXX A;  1CAX A;  3H3Z A;  1XRU A;  4ZXE A;  4YW4 A;  2XL7 A;  4AED B;  1POV 0;  3ZFG B;  2VPV A;  4NIH A;  4PJY A;  3T30 A;  1GQH A;  2IXH A;  4JKL A;  4PI0 A;  4DIN B;  5A7V B;  1U0A A;  3GCX A;  1AYM 2;  4RR3 A;  3KF5 A;  1BBT 3;  4J1X A;  1S0G A;  4GH4 A;  4K21 A;  1GWL A;  5A32 B;  4NHL A;  4I02 A;  5FLW A;  1H2N A;  3AFG A;  4DO0 A;  1WW6 A;  2GZW A;  3TNQ A;  2WC2 A;  3EJK A;  2XL9 A;  3QCW A;  3CJX A;  4FP2 A;  5GZD A;  1RXG A;  4AQ2 A;  2FDI A;  1QJU 3;  3VDB A;  2JXA A;  1Z7S 2;  2BEO A;  3J8F 2;  4QX8 A;  5FV3 A;  3VKM A;  2R49 A;  3I3E A;  1OQ1 A;  3VBH C;  2QQV A;  4XHX A;  4RFT 0;  1A78 A;  1CX4 A;  3OD4 A;  4NUB A;  1KRI A;  5FYU A;  2RM2 1;  3NO8 A;  5GJ6 A;  5F2W A;  3VDC A;  5CG9 A;  3P5B A;  4LPL A;  5G05 L;  1ZA7 A;  2B8M A;  2OYZ A;  1O8P A;  2JD4 A;  2RS5 1;  1NQJ A;  4R9D A;  2YFT A;  2DF7 A;  1KFX L;  1HB1 A;  4GQ7 A;  3S7I A;  1N1V A;  3UES A;  2D6L X;  4CCE A;  3SEE A;  3WPV A;  1BEV 2;  3LCP A;  3CIH A;  5FZ6 A;  3W9A A;  5JI7 A;  1HRV 3;  1DGL A;  2PHW A;  5DAB A;  1TZO A;  2W0X A;  3LEI A;  2VC9 A;  1OC1 A;  4Q4V 1;  4IE7 A;  5DZE A;  2VCM A;  3AC0 A;  1RMU 3;  1W0P A;  2CDP A;  5IVC A;  1H8T B;  1RUF 1;  4WM8 A;  3H8R A;  2W94 A;  3KWV A;  3LSE A;  2YU1 A;  3LB9 A;  4DQA A;  3D0J A;  4L97 A;  4LMF A;  3VBF C;  3HOB A;  4B1M A;  4OQ8 A;  1YHF A;  4MET A;  3IKW A;  2B5H A;  3QAC A;  4LHK A;  4LIU A;  3U78 A;  4MXW B;  1I9R A;  5CFD B;  1HRV 1;  3IB3 A;  5KC5 A;  3VBH A;  3LGR A;  2VQ0 A;  2WT2 A;  5HBA A;  1JZ3 A;  4J25 A;  3CHX A;  2V09 A;  3JBG 2;  1AF9 A;  4AGR A;  2PHL A;  5JPN B;  1W9S A;  5AVP A;  1PNF A;  4FPY A;  4AHX A;  2QFE A;  3NJZ A;  4CEW B;  1UZV A;  4N7U A;  3RZK A;  5A1L A;  1V6O A;  2FDK A;  3C2U A;  3H3L A;  4NR1 A;  3H9A A;  2R06 1;  3K51 A;  1MQT C;  3E6D A;  3HPN A;  4OI2 A;  3USS A;  3H0O A;  3W58 A;  5LCW L;  4Y3O A;  2BJS A;  3WEZ A;  1ZM1 A;  1SBD A;  1IHM A;  1QF3 A;  4LBQ B;  4CEW C;  1AZD A;  2VMD A;  3SCF A;  1AXZ A;  2GC0 A;  2E7T A;  4XFF A;  3BN6 A;  3FHI B;  1UMI A;  3DCQ A;  4RR3 C;  4OUM A;  5FOJ B;  4RHV 2;  4QPG B;  2XJP A;  3FZ3 A;  4CU7 A;  3WF4 A;  1IOA A;  1LES A;  1WZX A;  2Q1F A;  3D8C A;  5EHD A;  3OB8 A;  5F6K A;  1HXS 3;  1IPK A;  1FAY A;  2W3J A;  2HLE A;  1RUO A;  1LOG A;  1DQ2 A;  4HVQ A;  1VMF A;  2XHN A;  3QBQ A;  1DGR A;  4QX0 A;  1H8T C;  4CXW A;  1VBE 2;  4XUN A;  2C26 A;  5I8T A;  3VKN A;  1DGR N;  1B35 A;  1UPI A;  4EN9 B;  2H6B A;  3UT0 A;  1KXG A;  1JI6 A;  4Q0U A;  2CL2 A;  4D7T A;  4Q8L A;  4XJU A;  1LOE A;  4QX3 A;  2CGN A;  4B29 A;  3WAU A;  1YEW A;  2Z79 A;  1JZ7 A;  2VG9 A;  4L11 A;  1L3J A;  1RUH 3;  1W2O A;  3THC A;  1JXN A;  1PMJ X;  4GKY A;  4BMB A;  5GLM A;  3VD4 A;  3GZT B;  2WNE A;  4N43 B;  2HWE 3;  1GV9 A;  4EYU A;  5C70 A;  1N1S A;  4MGS A;  4QHZ A;  3AKS A;  5J3U A;  5A7W A;  5GM0 A;  2RS5 2;  4KU7 A;  2G19 A;  3GZU C;  3AL5 A;  3WG3 A;  2ARE A;  1PX4 A;  1LOB A;  4U6D A;  3WOG A;  1OFN A;  2DFC A;  4Q4Y 2;  3ZX7 A;  5HV0 A;  3AJZ A;  1TMF 3;  1RVF 2;  2GP5 A;  4IGQ A;  4JTN A;  1JYI A;  3KCX A;  4AXO A;  2W46 A;  1Z7S 1;  3J8F 1;  2DCJ A;  1QOS A;  3IAQ A;  4AFC A;  2D97 A;  3P1I A;  1DQ4 A;  3HT2 A;  1NLS A;  4YYO A;  4A42 A;  2WAB A;  3E1F 1;  3B3Q E;  5FO9 B;  4XIO A;  2VW1 A;  2WT0 A;  3GJB A;  2EIG A;  1W6M A;  1UKR A;  3DN7 A;  5GZE A;  1V6J A;  1X7N A;  2WNU C;  2RMU 3;  5ABJ B;  1LHO A;  4RS5 C;  3W59 A;  4NIG A;  1ULC A;  5FPZ A;  2F6B A;  1RUD 3;  3VBS C;  5IVB A;  1VRH 1;  1Y9Q A;  4K8R B;  3IM0 A;  1MS9 A;  2A70 A;  3C8X A;  1ZZ8 A;  2QUO A;  3NW4 A;  4NID A;  2BDR A;  1FX5 A;  1C8M 1;  1W90 A;  2VH9 A;  3WDX A;  1YJL A;  5JUV A;  4KG0 A;  1Q8S A;  2XWB B;  4HSJ A;  3OM7 A;  3R4Z A;  1BK0 A;  3ACI A;  3AYA A;  4R52 A;  2WRA A;  1DF0 A;  3WW2 A;  5IK5 A;  3BI3 A;  5CVR A;  1LHU A;  4AHY A;  1W2U A;  1W04 A;  3VSS A;  2QQP A;  4Y1Y A;  5LA1 A;  1DIW A;  5LA9 A;  3OF1 A;  4UAP A;  3WUC A;  1AL2 3;  3IT8 A;  4E4H A;  3I3Q A;  3K4Z A;  4KC7 A;  1VJ2 A;  2J42 A;  4Y4R A;  3BTX A;  3D5Z A;  3NAP B;  1X8E A;  2JEC A;  1YQC A;  1STM A;  3FLP A;  1ZBE 1;  1AX1 A;  1W06 A;  3PDQ A;  4XTM A;  2LRO A;  4DXT A;  4QT6 A;  1TNR A;  5A6X A;  2W68 A;  4XF1 A;  4DEV A;  1W99 A;  1B35 C;  2DUP A;  2ZGR A;  4H7M A;  4LBQ A;  4LK6 A;  2P37 A;  1H2L A;  4ORF A;  2CY6 A;  4URA A;  1UPS A;  3O1P A;  3RZM A;  2O14 A;  2QVS B;  1NCR B;  4FOV A;  4Y20 B;  3WIN E;  2FCT A;  2VVF A;  3CLP A;  3KF3 A;  3ZFF A;  3OPT A;  2Y6J A;  5CZK A;  2PHR A;  4CE8 A;  5FOB B;  1EP0 A;  1GQG A;  3TN9 2;  2BP6 A;  4E8C A;  3ETQ A;  3HT1 A;  4YWA A;  1JUH A;  2WYF A;  1F9K A;  3SLI A;  1NE4 A;  3PUR A;  5JMO A;  1T6B X;  1GNY A;  4P9X A;  2XOM A;  2F17 A;  2I74 A;  2XBO 1;  3VBF A;  1HJF A;  4WZC A;  3U4S A;  4DEQ A;  1G9F A;  3AJY A;  4Y24 A;  3MI8 A;  3H8X A;  1C8M 3;  1QNW A;  2ENR A;  1C5I A;  5GLK A;  4BQ5 A;  5FBZ A;  3N3H A;  1W6N B;  2DVG A;  1QJU 2;  1CR7 A;  3LZZ A;  2ET7 A;  5A70 A;  1ZRC A;  1H2M A;  1V9U 2;  4EN7 B;  4QB6 A;  1MAC A;  2CTV A;  1TL2 A;  1X8M A;  3ZPO A;  4AK3 A;  2A73 B;  1ZBE 2;  1H8T A;  2RMU 1;  3DYM A;  4YG3 A;  5K4L A;  4ERO A;  2V4V A;  1BBT 2;  1LEN A;  2XJR A;  3GZE A;  4XQW A;  1CAV A;  3K3O A;  5JAX A;  3IIA A;  2WAA A;  2A6V A;  2ZGQ A;  4J1W A;  3KT1 A;  3MLL A;  3MV0 1;  1EAH 2;  4ITC A;  4EWA A;  5JR2 A;  3AXD A;  3NMB A;  4QX2 A;  1JZ5 A;  3M3O A;  2GAU A;  2IXK A;  2NMO A;  1QKQ A;  2ZGO A;  2J22 A;  4IGO A;  3I59 A;  5K0U C;  5JLV A;  3AKH A;  3B00 A;  1V6I A;  1POQ A;  4UFJ A;  4TYS A;  4K20 A;  3AL6 A;  3D82 A;  4K1Y A;  1BBT 1;  4DMI A;  4YGE A;  4COT A;  2D6N A;  1GWM A;  3ON7 A;  2CAV A;  4CDX B;  1ST8 A;  2KM2 A;  1EUT A;  4HKW A;  2D43 A;  1NYW A;  4PDW C;  2PHX A;  4QXK A;  2BWC A;  1MVQ A;  1DYK A;  1XU2 A;  4HT1 T;  5DDJ 2;  1DYP A;  4W8J A;  5EP9 A;  4C8D A;  5BNP C;  3OYW A;  5K0U B;  1KD7 A;  2E63 A;  3GZA A;  4KGG A;  2JB4 A;  1CZT A;  2XUE A;  1C57 A;  4EZH A;  1RB8 G;  4ZU5 A;  1KS5 A;  5JR7 B;  3QED A;  1SLI A;  1MEC 2;  4MG2 A;  2QQU A;  3K3N A;  2HWF 2;  2CWS A;  4M3C B;  5GZF A;  3U07 A;  2AEZ A;  1DQ5 A;  4RSU A;  3ZFE B;  5JI9 A;  3E97 A;  5KHK A;  4M3C E;  4XQ4 A;  3I2J A;  2XH6 A;  3VDA A;  3ME2 A;  5LAS A;  4JDN A;  3D61 A;  3VT2 A;  4K3U A;  4QKD A;  5C5U A;  1S1A A;  3ZSJ A;  3ZYH A;  3GAL A;  5A3L A;  4OCT A;  1UMZ A;  5A1A A;  2Z2S B;  4XXP A;  2XLA A;  3RYK A;  5FJH A;  3PMS A;  4XJ9 A;  5C5T A;  4UDG A;  2O0O A;  1H6Y A;  5LRR A;  1VRH 2;  3VGI A;  1AL0 G;  1PX3 A;  2VZR A;  2EAL A;  4CP9 B;  5A33 A;  2MNG A;  1UCX A;  1D7P M;  2QJV A;  2ZHK A;  3VBU C;  2R07 2;  3WVJ A;  2Y26 A;  5FXV A;  3T4V A;  3TAY A;  5FLI A;  3POW A;  5H9P A;  3ITQ A;  4XFA A;  4OI1 A;  2UWA A;  2JDH A;  2NM1 A;  4NPL A;  3T1M A;  3MBW A;  3OTF A;  2A71 A;  5CEH A;  2JDY A;  3E5U A;  2GC3 A;  1CAV B;  2XR4 A;  1HW5 A;  3OBT A;  2YGL A;  3H7J A;  3AZV A;  1MZE A;  1B35 B;  3OCP A;  4B4Q A;  5KXE A;  4AK7 A;  4GZ9 A;  5SV8 A;  5M0T A;  1OQD A;  4E8D A;  1ZBA 3;  5IAT A;  1RXF A;  4P5H A;  1ZRR A;  3AP9 A;  2PQQ A;  2VE1 A;  1PO1 2;  2XJS A;  3GYD A;  4LUL A;  2PMW B;  3LOI A;  1W9Y A;  4LTA A;  4Q27 A;  5J98 B;  3MF9 A;  2JDK A;  1H1A A;  1JU3 A;  2Y8K A;  3N7L A;  4S2D A;  2TBV A;  1R09 3;  1VLN A;  2B9U A;  2VMC A;  2FMY A;  4X6R B;  1XOY A;  1NX9 A;  1KEX A;  3LWC A;  2YY1 A;  1ULF A;  4YZ5 A;  2JDP A;  1AYM 1;  4KWU A;  1PZ7 A;  5JVV A;  2EVX A;  1AR9 3;  3P6B A;  3TN9 3;  4Q4Y 3;  3A21 A;  4QPG C;  1AXY A;  4DIQ A;  3DV8 A;  1VPH A;  1AR6 1;  4E2G A;  4Z2W A;  3VHR A;  1C28 A;  4JC1 A;  4GJY A;  5A7S A;  1SAC A;  2ARA A;  2E31 A;  3WP6 A;  2YBS A;  2QQW A;  5FP9 A;  4ASK A;  4CZS A;  2XPJ A;  2DTY A;  3ZIX A;  1TMF 2;  4BJ0 A;  2X09 A;  3POJ A;  3N7M A;  1SPP B;  4QB1 A;  5DN2 A;  1C8M 2;  2D6O X;  3G6J B;  3ZYB A;  2DCZ A;  1PMI A;  1HLC A;  2IWG B;  3VT1 A;  4O61 A;  2XON A;  3Q8B A;  1HB4 A;  4A41 A;  1OD3 A;  3PIJ A;  4FFI A;  4H3W A;  3VV1 A;  4D8M A;  2JG9 A;  4MXV A;  3W20 A;  4ZS3 A;  4E2S A;  3OGR A;  4XXA A;  4GD4 A;  4BQY A;  3HEI A;  2WDB A;  1YQ8 A;  2BBV A;  4HVO A;  4RHV 1;  4Y1Z A;  3VD9 A;  5C9A C;  4CDQ C;  4FFF A;  2LAL A;  2X05 A;  2J1S A;  2QTW B;  4WVM B;  1SEF A;  2WYS A;  1JYX A;  1AHS A;  5T3N A;  5A3U A;  3IZO A;  2WAO A;  2C9K A;  1IS4 A;  1PK6 B;  3H1Y A;  3ZXD A;  5FY5 A;  4IV3 A;  1NY7 1;  1UXZ A;  4AEJ A;  1JHN A;  3NV3 A;  5FRE A;  1EPZ A;  4DFS A;  2OXB A;  2DFB A;  4LBO A;  1IS5 A;  5JXJ A;  1MZ6 A;  1DZR A;  5D8A A;  5GLV A;  3AFK A;  4HK8 A;  5IHR A;  2R30 A;  2ZGN A;  3LFM A;  1PGL 2;  4AYU A;  4GH4 C;  1S0E A;  3EHK A;  3ZR5 A;  5BY5 A;  3U10 A;  5FR3 A;  1O5U A;  5LA2 A;  1JOB A;  4A3Z A;  2W9X A;  4XUT A;  4YVW B;  4AAX A;  1RED A;  3JZV A;  5HPO A;  5IVF A;  1ZZ6 A;  2WZR 1;  3A0N A;  4JRL A;  1CWP A;  3KM5 A;  4IV1 C;  4QU2 A;  1BEV 3;  3LEG A;  2GU9 A;  3ACH A;  4NRM A;  4OQ9 A;  2PAK A;  5FDB A;  1ENR A;  4RGG A;  4QKF A;  1PGS A;  1FNZ A;  1N47 A;  2K46 A;  3BAL A;  1CAW A;  4AQ6 A;  2PLV 3;  3H1M A;  1LHW A;  1QJY 3;  5FZ4 A;  2DUQ A;  3O0X A;  4XUP A;  1BKZ A;  5C7G A;  3DUI A;  2Y64 A;  4UI9 L;  4W65 A;  4CP1 A;  3VBS B;  2WFF 2;  1X33 A;  1QQP 3;  3O0V A;  2GC2 A;  3AKQ A;  1DQ0 A;  3QLQ A;  4BQ2 A;  2ZGK A;  2YYO A;  4RS5 B;  1VBE 1;  1R08 1;  1XYO A;  4LKE A;  5D1I A;  4EWD A;  3IDC B;  1QEX A;  1SHW B;  3WG2 A;  3ZDS A;  4UWD A;  4AK6 A;  5FZD A;  2SBA A;  2XML A;  4LHL A;  3P3P A;  1VBB 1;  2RDQ A;  3KSC A;  3OGG A;  2PAE A;  3I2G A;  4WM8 C;  3T2Q A;  2WZ8 A;  3ZLI A;  1TME 3;  4LO6 B;  2X29 A;  1ND2 B;  5FUN A;  5AC9 3;  1CPN A;  3JBG 1;  1WMX A;  3K2O A;  4CCD A;  1W6O A;  3FFQ A;  5FIX A;  1WCU A;  4AED A;  4WVM A;  2W91 A;  2ZOE B;  1LTE A;  3HBZ A;  1YFX A;  3BB6 A;  4XF9 A;  4XJW A;  1OBN A;  3OM6 A;  5IWF A;  4K1Z A;  4KWK A;  1JH5 A;  2BBA A;  2NZ9 A;  1ZBE 3;  3SKV A;  1XB9 A;  3ZYP A;  4CUA A;  4DRR A;  4IEQ A;  3W5N A;  1V9U 3;  2BV4 A;  4C91 A;  3POB A;  1QDO A;  2ZGM A;  4H7L A;  1WCQ A;  2P6C A;  2ZBJ A;  4ES8 A;  3ZFF B;  3WY6 A;  4FPE A;  2BWA A;  4FPJ A;  2CAU A;  3O1U A;  1DQ6 A;  2ZGU A;  1R1A 3;  4CCK A;  3VDD A;  1JYW A;  1IG0 A;  3UV9 A;  2VCC A;  2W87 A;  2A75 A;  2UWB A;  1YLL A;  2AH2 A;  2C9A A;  5C8W A;  3AP5 A;  2JWP A;  3VSF A;  5FFO C;  5FZM A;  1UAI A;  3F95 A;  1EV1 3;  3IPV A;  3RVH A;  4M01 A;  4XE9 A;  5EZW A;  5L36 A;  1FMD 3;  2DBI A;  1S0J A;  4YVS B;  1XND A;  1VBA 2;  4QDR A;  2O8O A;  1JS9 A;  2VTX A;  4QXB A;  1N3Q A;  4XQD A;  5LK5 A;  3THT A;  3VBU A;  3ZN4 A;  4ASL A;  5IK7 A;  4MGZ E;  4QGM A;  1KDK A;  2J1U A;  3PME A;  1RIR A;  2RV9 A;  2VU9 A;  3M3C A;  3C7H A;  4IGP A;  3VDD B;  1HQW A;  2QQL A;  1WWY A;  3N36 A;  4Z82 A;  3WUD A;  5APA A;  4COY A;  5BUV A;  3VT0 A;  1TMF 1;  1H30 A;  1Y9G A;  4UFL A;  4LLO A;  5FZ1 A;  3NQH A;  2WIN B;  4QM9 A;  4YM0 A;  5L9B A;  3VBO C;  1WCS A;  5FTT C;  3TYJ A;  3GBG A;  3IBM A;  4PQ9 A;  1PVX A;  2DU1 A;  5IAV A;  1PO2 3;  2NPI A;  4K9S A;  1DU3 D;  1MQT B;  4GA9 A;  2ZAH A;  3JD7 3;  3MIH A;  3U1X A;  2EA7 A;  4XFI A;  5CNA A;  4LBK A;  5F32 A;  1UXX X;  1VBB 3;  3HAG A;  3HVD A;  3SKJ E;  5AYE A;  1UU6 A;  1W28 A;  1ND2 C;  1H9W A;  4Z07 A;  1G86 A;  3QD6 A;  4WM8 B;  3AKT A;  4QDQ A;  2ADD A;  4PBO A;  3SCH A;  5LW9 A;  2R07 3;  1RUG 3;  5A6Y A;  1NQD A;  4IQP A;  2WS9 3;  1OYG A;  1OD5 A;  4XYX A;  5T5O A;  1HIX A;  3KV5 A;  1J1L A;  2ZAB A;  3LEM A;  2GNB A;  3AX4 A;  4NMI A;  1YQ2 A;  4HXC A;  4RQP C;  1KJL A;  2WBK A;  4MGY E;  3KQ4 B;  2N7G A;  3VBR B;  3GXU A;  4P9L A;  4OHW A;  3VZM A;  2VZ3 A;  1QOO A;  2NYY A;  2A6X A;  1PNG A;  1H0B A;  3RG0 A;  4Y1U A;  2D93 A;  3OJB A;  2YC2 A;  2VEC A;  4D7S A;  4JAA A;  1GNH A;  2IVI B;  4NHK A;  4FPF A;  2CDO A;  3HBK A;  3ECQ A;  3M2M A;  4MHU A;  2WNV C;  4J6G A;  4QKN A;  3U75 A;  4XTP A;  1RJ7 A;  3CQO A;  4YVW C;  3WR0 A;  3OM5 A;  4CDU B;  1UYX A;  1Q8V A;  3HWJ A;  5KXC A;  1Y3T A;  4QPI C;  2XJV A;  1G9B A;  5C4W A;  1JOJ A;  4GH4 B;  5FMO L;  4E4Z A;  1QQP 2;  2VTX J;  2ZX4 A;  2NP0 A;  4Q29 A;  1TQ5 A;  5AC9 1;  1YXW A;  3AK0 A;  1J3Q A;  1VP6 A;  1L7L A;  3DKQ A;  3NKT A;  4IE5 A;  5FY1 A;  4CXX A;  2VZT A;  2P3I A;  1ULP A;  1W39 A;  1W8H A;  3GM8 A;  2OQ7 A;  3VHP A;  4EV0 A;  4X6Q B;  3SC7 X;  1FOD 3;  3LIH A;  2CSG A;  2H0V A;  5FQ0 B;  5J96 B;  3APB A;  1DDL A;  2ES3 A;  5BNQ A;  4CDQ B;  1DYO A;  3LA2 A;  1HRI 1;  1URX A;  3R4S A;  2Z5W A;  4Y1V A;  1S2B A;  5K7P A;  3BTZ A;  2X53 S;  4NWW A;  1JUI A;  1J3P A;  4A44 A;  4C0H A;  5IVY A;  4IV1 A;  3J7L A;  3SMH A;  1UYY A;  4WVV A;  2BOJ A;  3OYW B;  4KBB A;  4NRO A;  4N53 C;  4BQ4 A;  1AX0 A;  4QU1 A;  4D69 A;  3QC2 A;  1UU5 A;  2PHT A;  3BKZ A;  4CCJ A;  4DY3 A;  1REF A;  3ZO0 B;  1ZZC A;  2VMG A;  3WX5 A;  2CGO A;  3ZFE C;  1BCX A;  5FYY A;  5IAX A;  2AGS A;  1ZVF A;  1IKP A;  1RMU 1;  3KT4 A;  3NNF A;  4QWN A;  1QDC A;  4N43 A;  1COV 2;  3ENR A;  3LOB A;  5JDB A;  2RJK A;  3SIT A;  2E51 A;  3MW3 A;  3O0W A;  5G04 L;  1FPN 2;  1MR5 A;  1DCS A;  1N3O A;  2HYX A;  2WLQ A;  5DAX A;  1YFW A;  2WWU A;  2WS9 1;  1NLQ A;  3ETP A;  4D0Q A;  3ROU A;  2RR1 3;  1IZ3 A;  3EMR A;  4YPJ A;  3ZYR A;  1M06 G;  5GLQ A;  2FD8 A;  4XAC A;  2VVD A;  4OUL A;  5FZA A;  4UDI A;  1LCL A;  1W0N A;  5JPM B;  1DQ1 A;  1HJG A;  2Q0A A;  4IEP A;  3IMM A;  2ZHL A;  2XKO A;  4JGY B;  4MLO A;  4OMC A;  4Y22 A;  4DNY A;  1JZ2 A;  1LOF A;  3N35 A;  3NAP C;  4G4F A;  2P3K A;  1PO2 1;  2P34 A;  4YW1 A;  5FP4 A;  5AY9 A;  3WG1 A;  3BYN A;  4Y33 A;  4UF0 B;  1O6U A;  1C5H A;  3TEW A;  1RUH 1;  2C6S A;  2UWC A;  4FFH A;  5HCB A;  5IYY A;  3AP6 A;  4LO7 A;  2J1T A;  1WLC A;  4LQR A;  4IE0 A;  5IJR A;  4N2Z A;  5FAX A;  2BUK A;  5FK7 A;  4O8O A;  5DDJ 3;  4COV A;  1ZNP A;  3OGJ A;  5JSP A;  3QZ4 A;  5B6S A;  4JTO A;  1AR8 1;  4F8A A;  4MUV A;  2ARX A;  1X9P A;  2WUH A;  4JDO A;  1DLL A;  1QJX 2;  1VB2 A;  3Q8A A;  3TN9 1;  4I2O A;  4H55 A;  4BQW A;  1NCR A;  1O3T A;  2XJQ A;  2HWF 1;  4CRQ A;  4H14 A;  1QXJ A;  3I3B A;  4BM8 A;  1N1T A;  3BYK A;  3PUA A;  2OVU A;  1RUI 3;  3WDY A;  1OOP C;  1OHF A;  2VOT A;  1OLM E;  4ISR A;  1PZ9 A;  2ZPX A;  2BNN A;  2B46 X;  4HBN A;  4LBN A;  4Q0Q A;  1QJX 3;  1SLC A;  3VZN A;  2WQZ C;  1S0B A;  2Q8O A;  1DZT A;  4NRP A;  4QM8 A;  4RGA A;  3E5X A;  4GKX A;  1X9T A;  2PN5 A;  1VBC 1;  3UKN A;  5F5I A;  3ACL A;  2IFR A;  4M0N A;  4S2G A;  3ES4 A;  2BER A;  5HCF A;  3RJ2 X;  2XKP A;  3VN4 A;  2BVV A;  4AQT A;  2V5D A;  3B5L B;  1S2K A;  1LRH A;  1OXC A;  4MZU A;  4Q2F A;  1OT5 A;  2VUC A;  1H1M A;  1R1A 2;  3A23 A;  4I0B A;  3CO2 A;  3FUO A;  4YG0 A;  4PVI A;  3EB7 A;  3ZFE A;  1E5I A;  1IPJ A;  5SV5 A;  2GNM A;  1GIC A;  2WZR 2;  1LHV A;  5F7U A;  5TSW A;  3M1H A;  2QQM A;  4YZ4 A;  1QJZ A;  2Q5T A;  1C3H A;  5IVV A;  2D6P A;  4HK9 A;  4P02 B;  2JIJ A;  5FYH A;  1ND2 A;  5EYY A;  2BYV E;  3TEX A;  2VZV A;  4BPZ A;  4XUO A;  4P08 A;  3POE A;  2VOW A;  5HCA A;  5LBC A;  1JOD A;  5IK4 A;  4DRV A;  5CBL A;  5HCH A;  4CCM A;  5A3P A;  2VD7 A;  1RUE 2;  1AYN 3;  1SMV A;  5IUQ A;  3ZSL A;  1W6O B;  4PIX A;  2G1M A;  4XMI A;  1QJF A;  4NE9 A;  2FZ2 A;  1LU2 A;  1O3R A;  1PM4 A;  3OD0 A;  2JDN A;  2ORX A;  5LK7 B;  1RVF 3;  1GYK A;  4QX5 A;  2GNT A;  3AMQ A;  4LKD A;  3T0B A;  2AC1 A;  1U5X A;  4D47 A;  3PTR B;  4BIO A;  1FMD 2;  1OH3 A;  3PUH A;  3ZKY A;  4A45 A;  4AFA A;  2RS3 1;  2WNU B;  2GMM A;  2Q1Z B;  2RG4 A;  5DG2 A;  1Y9M A;  1Y43 B;  5IFT A;  1LU1 A;  3WDW A;  3WQ0 A;  5DQ0 A;  4YM3 A;  1PMH X;  1QXP A;  1YQ5 A;  2WNV A;  4LBQ D;  1OKQ A;  1R1Z A;  4ZHN A;  2RMU 2;  4IV3 B;  3T08 A;  1W3V A;  2CWM A;  3GF6 A;  3HD8 B;  1TME 2;  1H6X A;  2QQN A;  3R0R A;  2X8F A;  2ERF A;  4JZR A;  1NY7 2;  5KHJ A;  2JE9 A;  3E5Q A;  4LKF A;  1RHI 1;  5I8Y A;  2W52 A;  3DKW A;  4KQ7 A;  2XQR A;  2YZ4 A;  4AQS A;  5A6Q A;  1CAW B;  3J7H A;  4YM2 A;  1APN A;  4AI3 A;  2WNO A;  2R07 1;  2YFR A;  5T52 A;  5ACA 3;  3III A;  3SIS A;  1OOP B;  1OSG A;  5LBF A;  1SCS A;  4MAD A;  4MGI E;  4QPG A;  4GXL A;  3ZXE A;  4KBZ A;  3RRD A;  1UF2 C;  2JDU A;  2H6C A;  3MW4 A;  5IVE A;  3I8T A;  4WBB A;  5I0R A;  4KU8 A;  1JU4 A;  2A3X A;  2A6W A;  4GWJ A;  5C3R A;  4FTB A;  4LA3 A;  4YSF A;  1LED A;  2PA7 A;  2ZX3 A;  4N2R A;  5F8P A;  5ACA 2;  1T2X A;  4BOW A;  4FFG A;  2Z42 A;  3OM4 A;  4ASM B;  1Y4W A;  5C8C A;  4QPY A;  5CAD A;  4AI0 A;  4BME A;  5I0U A;  3I2I A;  2X5I C;  2QQI A;  3KZ4 C;  1YC6 1;  2QQK A;  3POI A;  4FPK A;  3U11 A;  4W6Y A;  1OUR A;  5C3O A;  3AYC A;  5FKC A;  5FZF A;  1AX2 A;  2W5F A;  3JB8 A;  1K12 A;  3BPS A;  3N7K A;  2EXH A;  4LBJ A;  5T50 A;  3CU9 A;  2D5H A;  4WM7 A;  1VBA 3;  1RUE 1;  4AI1 A;  1AL2 2;  3GDB A;  2EXK A;  4E4S A;  2HWE 2;  5CFC C;  5L19 A;  1HQN A;  1ND3 A;  4HN1 A;  5CKQ A;  1RHI 2;  2VXR A;  4AR2 A;  2VBD A;  5D8A C;  3KD4 A;  5LAT A;  1AR9 1;  4HPK B;  1UY0 A;  1J59 A;  3M3Q A;  3O12 A;  1BVP 1;  4FOW A;  4GMP 3;  3SH5 A;  5A6Z A;  5FCC A;  1XNT A;  2R6Q A;  4MO3 M;  1GR3 A;  1BXH A;  2GN3 A;  2VZS A;  5F5A A;  5FRA A;  3JD7 1;  4OHV A;  3RI9 A;  3RMX A;  3WW4 A;  1MPX A;  3KCY A;  3FHQ A;  1LNS A;  1H4H A;  1YO8 A;  1C4R A;  3ZMO A;  1OI6 A;  4YGD A;  3E6B A;  1A8D A;  2HWB 1;  1OH4 A;  3OSD A;  4IEO A;  3GBF A;  5EXO A;  2YXS A;  4O9G A;  5C33 A;  3RZG A;  3T0A A;  1XU1 A;  3HQR A;  4R8H A;  1ZYB A;  4IE4 A;  3ILN A;  1XYP A;  4UBH A;  5JIA A;  3UET A;  1O5L A;  1QWR A;  5BNN A;  3I7D A;  3KHB A;  3DEM A;  5JXI A;  1F35 A;  4BH9 A;  2RVA A;  2VUL A;  2BZD A;  4Y20 A;  2IXJ A;  1Q8Q A;  2WWJ A;  4GMP 0;  5F5Q A;  3S5Q A;  5T54 A;  2GMP A;  2VNR A;  3AMP A;  3IDA A;  5HI0 A;  5IK8 A;  2WSU A;  3RWK X;  1IQA A;  2HWE 1;  5CFD C;  1COV 3;  5DUV A;  2UYB A;  3LE0 A;  4CEY C;  2XB6 C;  5JXG A;  1ND3 B;  4IL7 A;  1Z78 A;  1VBC 3;  1NCQ A;  4MYE A;  2UUR A;  4LE3 A;  3ZFG A;  4R4X A;  4LLF A;  4V2V A;  5FKB A;  3LA7 A;  3R4D B;  5FY7 A;  1SBE A;  2JKB A;  4LHS A;  3RS6 A;  3PVO A;  4IDZ A;  1WUV A;  4M00 A;  4U2A A;  5A7V A;  1VBE 3;  3KGL A;  4FTS A;  1R1A 1;  1UOG A;  1OFS A;  3CJI C;  1SBF A;  4HET A;  2VM9 A;  5A3N A;  1RUE 3;  1CAX B;  2J1E A;  1D0H A;  2ZKL A;  4GAZ A;  2B4K A;  5EPA A;  5IVJ A;  3ACF A;  4MLG A;  2GAL A;  3WNL A;  2ZXQ A;  2WT1 A;  4JKM A;  4GUL A;  2E7A A;  1HXS 1;  5H9R A;  2X5I A;  4LK7 A;  5FMB A;  2JDZ A;  3VBO A;  2ZGP A;  3HR9 A;  1PIV 3;  5DDJ 1;  1IS3 A;  2NMN A;  5FYV A;  4MVT A;  2O8Q A;  4A7Y A;  4BXF A;  2E33 A;  2PHF A;  3MFA A;  5I91 A;  1VRB A;  2BNO A;  2Y0O A;  4IEX A;  3EBR A;  3QEF A;  1FV2 A;  3WP3 A;  4RFR B;  3VKL A;  4HOO A;  1RUC 3;  4UOJ A;  4UW6 A;  3C7F A;  2VTF A;  3MYX A;  4COW A;  3T0D A;  5AYC A;  3OBR A;  4CDU A;  3SNM A;  4BE3 A;  3FWE A;  3PU8 A;  1WW4 A;  2ZA9 A;  2ID4 A;  1FYU A;  2OKX A;  3V64 A;  4LOS A;  4CDW B;  4IXL A;  5FWJ A;  3WLU A;  1WA4 A;  2I07 B;  1DP0 A;  4QGL A;  2ZEX A;  2RM2 2;  4AL9 A;  4Q0S A;  4M0H A;  2VJX A;  2VW0 A;  3MUY 1;  2RR1 1;  1J83 A;  2MEV 2;  1NXD 1;  2RS3 2;  5C3Q A;  1OF3 A;  2G4I A;  1VIW B;  3VSZ A;  2EAK A;  2HWB 3;  2XJT A;  4GAL A;  3WW1 A;  4CCL A;  3B94 A;  4NN0 A;  2UY8 A;  2VGD A;  4LHN A;  1NCQ B;  1PGW 1;  3QH7 A;  5BNO A;  4OUE A;  1V00 A;  3C7E A;  1FAT A;  4CPB D;  3T3Y A;  1CN1 A;  3V0A B;  4KCB A;  4N9H A;  4LIV A;  1UYP A;  4LUK A;  1ZBA 2;  2VOK A;  2X8S A;  3UYJ A;  4IEZ A;  4URT A;  1JYV A;  1O4T A;  3AZY A;  3J7M A;  5F3I A;  5F3E A;  3H3U A;  4YRD A;  5FY9 A;  3AZW A;  4EN8 B;  1UOF A;  3VDD C;  5LA0 A;  4Q4X 3;  4N90 A;  2BGC A;  4YW6 A;  4OLL A;  2VBP A;  2XLG A;  4BQ3 A;  3R4Y A;  5CFD A;  1LGC A;  1SLL A;  1TG7 A;  1CQ9 A;  2TEP A;  4LOT A;  1AUY A;  3N9O A;  3ZVX A;  2YFS A;  3BPZ A;  3ZN6 A;  2ZGL A;  3M8L A;  3Q9O A;  1RTV A;  1YYN A;  4N9I A;  4YVS C;  1HRI 3;  3JXS A;  5JIU A;  5JOZ A;  2JB8 A;  4EWE A;  3CMG A;  2YBP A;  2YC0 A;  3R4U A;  3VUO A;  5BNP A;  2G9F A;  1I3H A;  3B9I A;  4NWV A;  2MHF A;  4XF0 A;  2WO3 A;  3AKI A;  3BYJ A;  3AMH A;  4AI9 A;  1WBL A;  1OLQ A;  4MX3 A;  5CA6 A;  4HVR A;  3PVN A;  1KIT A;  2VNG A;  1LJ7 A;  2R0H A;  4NII A;  5CKN A;  4PLO A;  1C1L A;  3LEK A;  3WAT A;  4AK5 A;  2JEN A;  4OI4 A;  5FZ7 A;  1PGW 2;  3MPP G;  1CAU B;  3RSJ A;  1UIJ A;  2RS1 1;  2VQT A;  1JN2 P;  1WME A;  4FTE A;  3I3D A;  3D60 A;  4XFC A;  3PNA A;  5D2A A;  5GLW A;  4L0P A;  2QQO A;  4AVT A;  4XAB A;  1U5Z A;  4XCB A;  4Z1V A;  5F5C A;  3W21 A;  3S6P A;  4LUM A;  4LNV A;  2Q8C A;  3ZSE A;  4AVA A;  1AR7 3;  1P8J A;  2HEW F;  2X8K A;  2PAM A;  5JZG A;  4P00 B;  4O65 A;  4P5Y A;  5C6C A;  1FI2 A;  4C1W A;  4AED C;  1XE0 A;  3FC0 A;  1W6M B;  4B4P A;  4Q4V 3;  4NOT A;  3ALQ A;  2GP3 A;  2PQS A;  2VXJ A;  1OF4 A;  1LR5 A;  4OZX A;  1GMM A;  3J4U H;  4UW5 A;  4FOY A;  3HMY A;  4KC8 A;  5CIS A;  5AFE A;  4UYB A;  3M70 A;  3NV1 A;  4L9B A;  2D98 A;  3ZN6 B;  4I0W B;  1PM7 A;  1WMF A;  4OVE A;  5H9Q A;  3O7O A;  3WZ1 A;  1EAH 3;  4HZF A;  1LB2 A;  2BQP A;  4Q4V 2;  1W2T A;  4XBN A;  5BNO B;  5J09 A;  2HJI A;  3H1W A;  3IMN A;  1NE6 A;  4FCA A;  4L8Q A;  4QPI B;  5E16 A;  5FYI A;  4C1X A;  1WL7 A;  3WDU A;  4PLN A;  4SBV A;  2DV9 A;  3ZSK A;  4CTE A;  2VUA A;  2L9L A;  2PHD A;  2JE8 A;  3TAW A;  1UY1 A;  3WHU A;  4W6X A;  1O4Z A;  4UXA A;  4A2U A;  4NHX A;  1F2N A;  1V6N A;  3AB0 A;  1LOC A;  3DEC A;  4ZU7 A;  3LAG A;  3QH6 A;  2R32 A;  3HNY M;  4FAG A;  1W8U A;  3FBM A;  3K77 A;  1W6P B;  1GOF A;  3K75 B;  4V2W A;  4X8P A;  4MOA A;  1O59 A;  3A7Q A;  3WF0 A;  4XBL A;  3TB0 A;  4BXS V;  1RUH 2;  5FY0 A;  4B7K A;  2BFU S;  2DYC A;  1GZW B;  2E32 A;  3OUH A;  1AVB A;  3OGS A;  5I93 A;  2F4P A;  3FMG A;  1ZRF A;  2OA2 A;  4XDO A;  1Q56 A;  3OBA A;  4LBM A;  4I09 A;  4XFB A;  4Q1P A;  4XFG A;  2LM3 A;  3CL1 A;  1UN1 A;  1KFU L;  2ARC A;  2KD7 A;  2HYK A;  4WZF A;  1FT9 A;  1G8W A;  4GWM A;  2LW8 A;  4HON A;  4PI2 A;  1TEI A;  4RR3 B;  3UGG A;  3VL9 A;  1DG6 A;  1W2A X;  4KNC A;  1SLT A;  3ZXJ A;  2UY9 A;  1PK6 A;  4NAM A;  4B1L A;  2C5D A;  3MW2 A;  4ZS2 A;  1F15 A;  1OUS A;  5C2M A;  1OQE A;  1RUI 2;  1J84 A;  1HB2 A;  1BYH A;  1X36 A;  4JQR A;  3BIW E;  5J36 A;  5FQ0 A;  1BHG A;  3HNB M;  4AVC A;  1VBA 1;  5DG1 A;  4W6W A;  1VBC 2;  2Y33 A;  1CZV A;  3WG4 A;  3J26 N;  3VB9 A;  1NCR C;  4YAR A;  1K5M C;  1NZI A;  3QOP A;  3HJR A;  3ZXL A;  4C0B A;  4OHY A;  2DUR A;  2RJL A;  2RDS A;  1XE8 A;  4FPL A;  5F37 A;  3C7O A;  5D8A B;  1BLZ A;  2WQ4 A;  1BJQ A;  4XDP A;  5C4W B;  2WL1 A;  1RUJ 3;  1GOG A;  3KV4 A;  2OX0 A;  1S4C A;  2GND A;  4K8F A;  3THD A;  3BU7 A;  4QXC A;  5CFC B;  5KBF A;  3RZH A;  2BPA 2;  2BVB A;  1S0D A;  3M3I A;  1E5H A;  1SQ4 A;  4QQH A;  3SH3 A;  2AUY A;  5I0D A;  3U37 A;  1D4M 3;  4XOG A;  2BW8 A;  3ORJ A;  2VQA A;  3EQE A;  2YRO A;  2NLR A;  2ETE A;  3HQX A;  2ZGS A;  5FUP A;  1C1F A;  3TNP B;  2YFU A;  5FPU A;  5LEK A;  1GU3 A;  4IEU A;  2BGO A;  3LQC A;  3N9L A;  4DS0 A;  4DUW A;  3EYP A;  2WFF 3;  4XW3 A;  3BOP A;  1VBD 1;  2VY0 A;  1BMV 1;  2I2S A;  3ES1 A;  1RHI 3;  3B7M A;  3OBZ A;  2PYT A;  1JYT A;  3VL8 A;  1OPO A;  5F3G A;  2X8T A;  3WF1 A;  3ZXA C;  3O1M A;  3T2T A;  2PLV 1;  2ZZJ A;  2ZX0 A;  4I3P A;  4FO9 A;  1BEV 1;  1I5P A;  3VBH B;  2EIE A;  4WM7 B;  1SZB A;  1HN0 A;  1ZA4 A;  5EFU A;  4ZKT B;  3NNG A;  4LR4 A;  2RS3 3;  1HDK A;  5E6H A;  4AZZ A;  2WFF 1;  1UIK A;  4SLI A;  3IDB B;  1CD3 G;  4HPK A;  2D44 A;  3BGA A;  4HMZ A;  3RZZ A;  3B02 A;  5FY4 A;  2WJS A;  5KHH A;  2FZ1 A;  2D3P A;  4P9I A;  1OLM A;  3S0M A;  2ARB A;  1VR3 A;  3DF0 A;  2OZJ A;  1GWK A;  2B45 X;  1W8N A;  4QQL A;  1SG3 A;  1HV1 A;  2QZ3 A;  2RHP A;  2QCS B;  1Z0H A;  4QDS A;  4RN5 A;  2CGP A;  1KQR A;  4EJR A;  1NKG A;  3P2N A;  1Z7S 3;  3ILF A;  3J8F 3;  3RZJ A;  2IXL A;  4RHV 3;  2WII B;  1YWK A;  3CF6 E;  3RQ0 A;  2W1Q A;  3DPR A;  4OHX A;  3WPZ A;  1YFU A;  3FN9 A;  4G9S B;  3T2O A;  5CFC A;  4F7Z A;  1CPM A;  5DUX A;  1Q3E A;  5ANN A;  2DTW A;  2RS1 2;  1HRI 2;  2WO1 A;  1EV1 2;  3CNA A;  1NT0 A;  1ENQ A;  3KT7 A;  3NNJ A;  2WA4 A;  1ASJ 3;  3THP A;  4AI8 A;  2YDE A;  1QH7 A;  4FPO B;  4IV1 B;  3I2D A;  4UFM A;  4RL7 A;  2C1F A;  1UWW A;  2XQX A;  3MID A;  5LBB A;  4LO4 B;  2IUW A;  3ELN A;  1SLB A;  5EJZ B;  3TBD A;  4NHY A;  1RUD 1;  2ZAC A;  1UNB A; 
#chains in the Genus database with same CATH homology
 3H3L A;  3HBK A;  3C2U A;  4AK6 A;  5GLO A;  3U75 A;  5JOY A;  3OM5 A;  2YFS A;  2B4W A;  4CCD A;  5FIX A;  1PT2 A;  2EXJ A;  5JOZ A;  4AK7 A;  4PVI A;  5AYD A;  3LDK A;  2AEY A;  3OSD A;  3KF3 A;  4O8N A;  3VSR A;  4UDK A;  3AKI A;  3BYJ A;  3ZXL A;  3OM6 A;  3U14 A;  3WN2 A;  3SC7 X;  3C7O A;  3LIH A;  3R67 A;  5FMC A;  3C7G A;  4N1I A;  4QQS A;  3WAT A;  4AK5 A;  4KMI A;  1UV4 A;  3D5Y A;  3S5Q A;  3D60 A;  4UFK A;  3RWK X;  5GLP A;  3LIG A;  1GYE B;  1Y7B A;  1YIF A;  1YI7 A;  5GLK A;  5FMD A;  3QC2 A;  4O8P A;  1GYH A;  1W18 A;  3WMZ A;  5FKB A;  4NOV A;  3VSF A;  4ONZ A;  4UDK E;  4CCC A;  5A7V B;  2AC1 A;  4D47 A;  3LF7 A;  3WAU A;  5A7V A;  3LFI A;  3KF5 A;  3BYL A;  2QQW A;  3LV4 A;  5FK8 A;  5GLM A;  3WPY A;  5C0P A;  1Y9M A;  5FLW A;  1VKD A;  2X8T A;  3NMB A;  3WPU A;  3VT1 A;  3QEE A;  4QHZ A;  4MLG A;  5B6S A;  3PIJ A;  4FFI A;  4KC8 A;  3AKH A;  2VDT A;  5FMB A;  2X8F A;  3C7H A;  4UFJ A;  5GLQ A;  2QQV A;  4U6D A;  2EXI A;  2XQR A;  4COT A;  4FFF A;  4AZZ A;  3VT0 A;  5GLN A;  4UFL A;  1Y9G A;  4UDI A;  3WMY A;  3AKG A;  1W2T A;  1ST8 A;  2YFR A;  4UDJ A;  3QEF A;  3NQH A;  3ZXK A;  5A8D A;  3IMM A;  2YFT A;  5JOW A;  2ADE A;  3C7F A;  4CCE A;  1WL7 A;  3WPV A;  3PIG A;  5AYC A;  3UGH A;  2OXB A;  5AY9 A;  3BYN A;  4JQT A;  3ZR6 A;  3TAW A;  3U1X A;  4FFH A;  4UFI A;  3WAS A;  5AYE A;  3ZR5 A;  4N2R A;  3QED A;  4FFG A;  2ADD A;  2QQU A;  3OM4 A;  3P2N A;  1Y4W A;  4N2Z A;  2AEZ A;  5FK7 A;  4KCA A;  4O8O A;  3WN0 A;  5GLL A;  3QZ4 A;  1OYG A;  4B1M A;  3VSZ A;  3K1U A;  3VT2 A;  3D61 A;  3WPZ A;  3AKF A;  3LEM A;  3OM7 A;  5JOX A;  3R4Z A;  4PVA A;  4HXC A;  4U6B A;  3C7E A;  3WN1 A;  4UFH A;  5ANN A;  5FKC A;  1GYD B;  3BYK A;  4KCB A;  3VSS A;  2EXH A;  4UDG A;  1UYP A;  3CU9 A;  3KST A;  4UFM A;  4N4B A;  5A8C A;  2X8S A;  2EXK A;  3OM2 A;  5B6T A;  3UGG A;  5GLR A;  4KC7 A;  1YRZ A;  4EQV A;  3LDR A;  3UGF A;  3ZXJ A;  3D5Z A;  4B1L A;  3R4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...