4FFIA

Crystal structure of levan fructotransferase d54n mutant from arthrobacter ureafaciens in complex with levanbiose
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
480
structure length
480
Chain Sequence
AVYHMTPPSGWLCNPQRPVTTHGAYQLYYLHSDQNNGPGGWDHASTTDGVAFTHHGTVMPLRPDFPVWSGSAVVDTANTAGFGAGAVVALATQPTDGVRKYQEQYLYWSTDGGFTFTALPDPVIVNTDGRAATTPAEIENAEWFRDPKIHWDTARGEWVCVIGRLRYAAFYTSPNLRDWTLRRNFDYPNHALGGIECPDLFEITADDGTRHWVLAASMDAYGIGLPMTYAYWTGTWDGEQFHADDLTPQWLDWGWDWYAAVTWPSIDAPETKRLAIAWMNNWKYAARDVPTDASDGYNGQNSIVRELRLARQPGGWYTLLSTPVAALTNYVTATTTLPDRTVDGSAVLPWNGRAYEIELDIAWDTATNVGISVGRSPDGTRHTNIGKYGADLYVDRGPSDLAGYSLAPYSRAAAPIDPGARSVHLRILVDTQSVEVFVNAGHTVLSQQVHFAEGDTGISLYTDGGPAHFTGIVVREIGQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Levan fructotransferase
publication title Structural and functional basis for substrate specificity and catalysis of levan fructotransferase.
pubmed doi rcsb
source organism Arthrobacter ureafaciens
total genus 132
structure length 480
sequence length 480
chains with identical sequence B, C, D
ec nomenclature ec 4.2.2.16: Levan fructotransferase (DFA-IV-forming).
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4ffiA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 4ffiA01
1GYHA 1GYEB 5AYEA 3U75A 3AKHA 2X8FA 1GYDB 3WMYA 3LFIA 4KCBA 4UFKA 3ZXKA 5FMDA 3WAUA 4MLGA 1WL7A 4NOVA 1YIFA 1W18A 4B1MA 3C7OA 3NQHA 5AYCA 3VT2A 4KC8A 3D61A 3LDKA 1PT2A 3SC7X 5GLOA 4FFIA 4UFHA 3VT0A 3LIGA 1YI7A 5AYDA 5GLMA 3AKIA 2EXJA 2X8SA 1Y7BA 3WN0A 3KSTA 2AC1A 4U6DA 4CCCA 4CCDA 4U6BA 5FKCA 3D5YA 4JQTA 3H3LA 4FFGA 4UFIA 3BYJA 3D5ZA 3KF3A 1Y9GA 4UFJA 5GLLA 3WPVA 5AY9A 4UFMA 3C7GA 5GLQA 3LF7A 3UGFA 4UDKE 4O8NA 5ANNA 2YFRA 5C0PA 2EXKA 4QHZA 4UDIA 2OXBA 3QZ4A 3LDRA 3C7HA 3P2NA 5GLPA 3VSZA 1W2TA 4FFHA 3OM2A 3KF5A 5JOXA 5GLKA 3QEEA 3WPYA 3ZR5A 5FKBA 5B6TA 4EQVA 1UYPA 3CU9A 3VSFA 3U14A 5A7VB 4AK6A 3K1UA 3PIJA 3OM6A 3QEDA 3WMZA 4N1IA 4B1LA 3WN2A 1Y4WA 5A7VA 3ZXLA 2EXIA 3UGHA 3VT1A 3ZXJA 2YFTA 3C2UA 5JOWA 3VSRA 3S5QA 2VDTA 3OM7A 2X8TA 4KMIA 4D47A 3LEMA 3AKFA 3BYKA 4AK7A 4N2ZA 3AKGA 4ONZA 4QQSA 1Y9MA 5JOYA 3ZR6A 5JOZA 3IMMA 1OYGA 2QQUA 4PVIA 5A8DA 3HBKA 1VKDA 4HXCA 3WASA 4FFFA 3PIGA 2ADDA 3BYLA 5FMBA 5FK8A 3RWKX 4UDJA 3C7EA 4N2RA 4UFLA 3OM4A 4UDKA 1ST8A 2ADEA 3D60A 3R67A 4AZZA 4CCEA 4PVAA 3WN1A 4N4BA 3UGGA 5B6SA 4UDGA 4COTA 3QC2A 3LIHA 2EXHA 4KC7A 3LV4A 5FLWA 3C7FA 3TAWA 3WPZA 2AEZA 4AK5A 3NMBA 2XQRA 3WATA 5FMCA 2QQVA 1UV4A 5FK7A 3VSSA 4O8PA 2AEYA 4O8OA 5GLNA 5GLRA 3U1XA 4KCAA 2YFSA 3BYNA 2QQWA 3R4ZA 3WPUA 3OSDA 5FIXA 1YRZA 3R4YA 2B4WA 5A8CA 3QEFA 3OM5A
chains in the Genus database with same CATH superfamily
4RS5A 3OD4A 3LB9A 2OPWA 4J1WA 3ZXFA 3WDVA 5BNOA 1AL21 5FYUA 1ZYBA 3AKSA 2GALA 5JSPA 1QJU3 4YM3A 4IEUA 3VD4A 2Z4FA 3BPSA 1CD3G 4W8JA 4QPWA 4D0QA 1SDDB 3C7OA 1W18A 3VZOA 3ZN4A 2ZGMA 4A6SA 5FZHA 4QM9A 4AWDA 2IZWA 1GQHA 5AC91 1LENA 3GZTB 1A6CA 4GH4B 3AJZA 3VKMA 4XF3A 2R061 1HDKA 4TXWA 4ASKA 5JPMB 1FATA 1U5XA 4Y1XA 2VO5A 2YGLA 2BU9A 3I3QA 2ZEWA 1SHWB 3T4VA 4YFZA 1OKOA 5A3LA 2GC1A 2G1MA 3KB5A 4CCCA 1QQP2 5FZMA 5HCAA 4LKSA 5IATA 2GMPA 1IG0A 1MACA 3NV1A 4O8NA 3IB3A 1W39A 2WNUA 5C0PA 1MZEA 1DGLA 4YARA 5BNNA 1P8JA 1YCIA 4G9SB 5A7PA 1DLLA 5J36A 3WF1A 2HWC3 4P08A 4QKDA 3ZPOA 2V5DA 5FOBB 5IVBA 2P37A 3TAYA 3WPYA 1BQPA 4IV3C 3WD5A 4BQXA 3AM2A 4XEZA 4Y1VA 4CEWC 1I3HA 3J8F3 1DYPA 2ZZQA 3NAPB 5JIUA 1W8ZA 4UYBA 4PI0A 3VZLA 2DBIA 1RUI1 1I5ZA 2OZ6A 1JZ8A 3F2ZA 1QXPA 3IM0A 5EYYA 1J83A 4YW5A 4COWA 2WFF3 2Q8CA 1QJX3 1ZM1A 4ZS3A 4OVEA 1FI2A 2I2SA 1F5FA 2E33A 2H6CA 2D40A 3A4UA 4K20A 4FXGB 4E9KA 3UKNA 3I2IA 4WVVA 1RUH2 5E89A 5EJ3A 1HRV1 1JHJA 3ZSLA 1Z7S3 4ZU5A 4QM8A 3SH4A 2FDFA 2Y64A 5JI9A 5F32A 3AKFA 3BYKA 4E4ZA 5EJZB 2WZR2 2Y8KA 5GLZA 4ATEA 1LOBA 3KS7A 2HBTA 1OVPA 5JUVA 4IERA 3WX5A 1DBNA 1ONAA 2X8KA 3A21A 1B35A 4LBOA 1BVP1 2NM1A 2VULA 2ES3A 2PQQA 3HBKA 5CAZA 5JZGB 2GC0A 5DAQA 5ABJC 3AFGA 3CZUA 4YVSC 4IQPA 4KGQA 4AFMA 4UDJA 2V72A 1EPWA 2VCBA 3MIBA 2WSUA 1AUYA 1H2LA 1V00A 2E9QA 2HWD1 4AHYA 2WLQA 1OI6A 5FP4A 4WM8A 3D60A 2B46X 4O7XA 5A32A 5IWFA 5F8PA 3GF6A 4M3CA 3ACFA 1JZ6A 5F3CA 1QF3A 2NMNA 4U36A 2WQZC 1AVBA 3VUOA 4LK7A 2B9VA 1NCQA 2MPFA 3TBDA 1OD3A 1SZBA 4H7LA 2VR4A 2WNVA 2Y38A 5GLRA 4JC1A 4I0WB 1S0BA 2YU2A 1OOPC 4AI8A 1XU1A 2ZOEB 1EV13 3E5XA 4ISRA 1WMDA 1H8TA 2D5HA 1WCQA 4XMIA 3I49A 1KS5A 1TQ5A 3M7AA 1PGW1 3PVEA 1LR5A 2RMU2 4PIXA 2FQPA 5IAVA 3KT1A 2HWB2 5FZ9A 4UFKA 1QOTA 1UAIA 4MGSA 3SCHA 3U0ZA 3GCXA 1L3JA 5BV6A 5GZEA 4CXWA 4F83A 2VW1A 3WNPA 3PTYA 4RD7A 3N9OA 2VTXJ 1XNKA 4GWIA 3R4UA 2AGSA 3LD8A 1BHGA 2BNNA 1COV1 5A33B 4ZU4A 1LGNA 1IS6A 1W2AX 2ZGNA 3LIGA 4FFIA 3ROUA 1VBC2 2QUOA 2VW2A 3AP6A 4Y26A 4EZ4A 3VGIA 1SFNA 4EN8B 3LPGA 2JXAA 3D5ZA 3B01A 4RFT0 1Y9GA 1SLIA 5CADA 2E26A 5FXXA 1ENQA 1TL2A 4V2VA 4Q4Y1 3T09A 1HQLA 1IPKA 2RS33 2FZ1A 1LOEA 1POV1 2VOWA 1WA6X 2RS13 3IDEA 3WNOA 4CDUB 2WT2A 3V56A 4COZA 4XXAA 3GDBA 5A6YA 2R071 3UL2A 1REDA 4DUXA 2YFZA 5DAXA 4YZ3A 2ZGRA 3QEEA 1CIWA 3VLBB 4PI2A 1F15A 4G4FA 1YI9A 2XG3A 3U14A 2DFBA 1S0FA 3EB7A 1M06G 1HLCA 4XUNA 1X36A 1RVF2 5C4WA 1AX0A 1EPZA 4DY3A 1BK1A 4QDSA 2FDJA 4MHUA 2SLIA 3AVSA 4CUBA 5GZGA 5I0SA 3A0KA 5DPNA 5JPNB 4JGZC 1CESA 1SPPB 1WBLA 3GZEA 4XJ8A 4BIOA 3S57A 2WN2A 2E7QA 5HV0A 3DYOA 2XBO2 4IV1A 1FV3A 4MH0E 4RYDA 2TUNA 2GC2A 2ZZJA 1VMHA 4OZXA 1PK6B 2C1FA 5SV5A 5BNPB 2H0BA 2ORXA 4XDPA 3ZR6A 4AQ2A 1O3RA 4META 4Q5OA 4BH9A 1KEXA 4LO7A 5J96B 2QQUA 1ND2A 4Q0SA 5AVPA 3EBRA 4C0HA 2GAUA 5K8SA 3MEPA 1B09A 1OH3A 4RHV3 2JDNA 4ASLA 2Q1MA 1RXGA 3HNYM 4P00B 4LTAA 4MZUA 4CDWC 3I3DA 5A7OA 2WJSA 2ZX4A 5DDJ3 2VE1A 3T1MA 3UGGA 1YWKA 2JIJA 4IEZA 3QC2A 2FMYA 4GZ9A 3RZHA 2CWSA 4P5HA 2XVGA 4TTGA 1IQAA 2B9UA 4JZRA 1GP6A 4CCJA 1W6QB 1PO21 2R7EB 4P14A 5C33A 5GZFA 4OFGA 4B4RA 2W52A 3WP4A 2B39A 4YM1A 2W46A 1PZ7A 1D2SA 3N9MA 3VZMA 4Q0VA 4CDQB 1TZOA 1RUC2 1S2EA 2YMZA 5C5TA 5CG8A 3R4YA 3GZUC 5T52A 1UOBA 3RZKA 4H7MA 1WD3A 2VMCA 3D82A 3SKJE 5FPVA 4YZ5A 4LITA 4QQPA 4NHMA 2E6VA 5DQ0A 3UNPA 2MEV2 1W6OA 2GNDA 2V09A 2W0XA 1IQDC 1HRI1 1IG3A 1MZ5A 3POFA 3BTYA 5C8CC 4B1MA 1O4TA 1V6MA 3NQHA 3MW4A 5A3UA 3WNKA 4WV8A 4O65A 3D61A 1RUG3 1SLAA 1AXKA 3CU7A 2ARBA 4DFSA 1EY2A 2IXLA 4FT8A 5T50A 5I93A 2XKPA 2XLFA 2J42A 2QZ3A 3AKIA 1W8UA 1JYWA 2GDFA 2XJUA 5G05L 3I2KA 2WC2A 5J09A 1JZ7A 3N9LA 5FUPA 4AF9A 5FPLA 2BOIA 3AZZA 2PYTA 5FP9A 1ZBE1 2RDRA 3CO2A 4OI1A 3NNGA 4B8EA 4AI2A 4PJYA 2Q8EA 1S0CA 2CWMA 1RIRA 2JE9A 3LDRA 3OG2A 4RFRB 3VSZA 4PBOA 3B00A 1OFSA 1RUD1 1GICA 3DYPA 5FO8B 4CUCA 3OM2A 1ULOA 1GNYA 1MEC1 1WD4A 2ZPXA 3ZFFA 4BOWA 3BU0A 2P1BA 4OQ8A 4Q0PA 5DG1A 4AI3A 4AOCA 3N7LA 4QMAA 5FWJA 1TVGA 2WA3A 4CEYA 2VZUA 5C9AA 1D0GA 4Q4X3 4LO8A 2JDUA 5A7VB 4B3NA 3VD5A 1PVC1 2WWUA 1PNFA 5CFDC 2ID4A 3I3BA 1UOFA 3GHMA 2DCYA 3W5MA 4BE3A 1RB8G 4E4DX 2BZDA 2VZTA 1LEDA 2B42B 1UIKA 3VT1A 2D98A 4HVQA 3IWZA 3N4MA 2YFUA 1QJY1 4QDQA 4AVTA 4XJUA 2BW8A 3E97A 2QQJA 1X8MA 2PELA 4QGNA 5FV3A 2IWGB 4COUA 2Y6JA 2D3RA 1PO13 1PIV2 3FUOA 3U37A 3I59B 1WA4A 2Z2SB 3AK0A 3PU3A 4MOAA 2VVFA 3I8TA 3LSEA 1RL3A 4ONZA 3T2TA 1QJZA 3NV3A 3THDA 2ZAHA 4IUGA 3JQXA 3CJIC 1H9WA 1W99A 2XJPA 5CA6A 1EAH2 3E1F1 1EUUA 3OGVA 1WCUA 1WLWA 5F6KA 1TNRA 4Q4Y3 1W2NA 4LBLA 4RGGA 3GBGA 3BPZA 4XFGA 1ZBA2 3DPRC 4MGZE 2V73A 4UDKA 1WUVA 3KLSA 4IE4A 4RR3C 3VBSC 1BXHA 2P17A 3M2MA 4WM7B 1BYHA 1NE4A 2WZ8A 1ENSA 5JI7A 3RZMA 2A3XA 3ZYRA 1DCSA 2Z69A 5FYHA 4IDZA 3MIGA 3BCWA 5FYZA 3TAWA 4JGYC 4BWOA 3EJKA 2BEOA 2WS91 2R6QA 2Y6KA 5GJ6A 2ATFA 1X7NA 1UYYA 1QOSA 3W9AA 3U1XA 1VBB2 3CQOA 4KCAA 1O3SA 3R4ZA 2ZX0A 2W1SA 4BU2A 3OSDA 1DFQA 3MLKA 3ZYFA 4MX3A 2BUKA 5T5OA 1QJU1 3Q9OA 3RFRA 5DUUA 1ALYA 2YU1A 4H14A 5JDBA 5LRSA 1CWPA 3AKHA 2WUHA 3OGSA 1S4CA 2HEYF 4CCOA 5F9TA 4B29A 1FNZA 4PQQA 4OYUA 5L19A 3I4IA 1WL7A 4QHOA 3BKZA 5FOJB 3ENRA 4URAA 5K9YA 4PIZA 1OQ1A 1GYKA 4A45A 3BOPA 5DN2A 2D3SA 3ZMNA 4AAXA 1SLCA 1ULGA 1DGWX 1CAVA 5FYBA 4W4ZA 5DZGA 2V4VA 3M3OA 1YI7A 3EO6A 4PLNA 4X8NA 1OA4A 2JG8A 4CP0A 5C6CA 5ACA1 3WN0A 1W8HA 2EICA 2VMGA 4U6DA 2HEVF 1JW6A 3WDWA 4FPFA 5JXIA 2R49A 3HPNA 3L9JT 4PF5A 3BYJA 2ZGUA 1PNGA 4O9EA 2HWC1 4QPIB 5GLQA 4L2NA 2JDHA 5GALA 3ZLIA 1V6LA 2B8MA 3QOPA 1W9FA 4FPKA 1LOCA 3T0AA 4FBFA 3ETPA 4Q29A 1W6PB 4OI4A 3V0BA 1W03A 4YGBA 2FDGA 1ND3C 4JRAA 3S30A 1D4M2 5L7OB 5CNAA 1R1A3 2Y6FA 4DZGA 4KBBA 4NPRA 4R4XA 1QJX1 4Q0UA 4DOUA 3LKJA 3WG1A 1OURA 4XBNA 2W95A 2W1QA 3I97A 4Q8KA 4XFBA 3VBFA 4CCLA 1HXS3 3S0MA 5DMYA 4QPGA 1ZZBA 5IJRA 1VPHA 1GOGA 1Z7S1 3H0OA 2WQ8A 5A6ZA 4XJ9A 2PHLA 3DUIA 3ZXLA 4DB5A 5KXCA 1Z78A 3WQ0A 4RS5C 1DIWA 3VBHA 3GGLA 2ZHNA 4N7UA 3NJXA 5BNOC 3NJZA 4ZZ5A 1W9YA 1UPIA 1DLCA 1XOYA 1MVEA 2O1QA 2RJKA 2WT1A 3LCPA 1G8WA 1UX6A 3HOBA 1RHI3 3AKGA 5J98B 3DL3A 3Q8AA 2A75A 2EA7A 4JCKA 1UZVA 1SACA 2JB8A 1N47A 5E88A 2JICA 1KXGA 4XQWA 2VCAA 1KITA 1UMHA 1NCRB 4M4RA 4N8MA 3BOWA 4HBNA 2HJIA 4Z8BA 3VHPA 2PTMA 5IVYA 1DQ4A 4MSVA 5EZWA 3WNXA 4N2RA 4LPLA 1MZFA 3PLQA 3OPWA 4NE9A 4QWNA 2ZEYA 4BM8A 4I01A 2UWBA 3VZJA 1EUTA 2OQ7A 2ZMKA 4LHLA 4YW4A 5FYIA 4HFSA 1RINA 4YW1A 4BDVB 3C8XA 2BWAA 1E5HA 1SDWA 2AZ5A 3ALQA 3DKWA 1HQWA 3EXUA 2WNUC 3VKNA 4FAHA 5B2GB 3K4ZA 1SEFA 3PVOA 2YY1A 3AMHA 5BNNC 4QD2A 5I0DA 2XQRA 3E5UA 5FPZA 4ARYA 1EV11 2QQVA 1REEA 4HETA 2P6HA 1UU6A 1XSQA 2A6VA 1AL22 2VZSA 2ZGLA 2ET1A 2BBVA 1CAUA 4GULA 2BP6A 4N43B 1MQTA 3V65A 5F5CA 1T2XA 1FPN3 5LW9A 3JB4C 1OA3A 5D8AB 5IFTA 4XF1A 1OVSA 5AC92 2RV9A 1VAKA 1O3QA 2FCUA 2HYXA 3MIFA 4AEDB 1NA1B 4NWWA 3JUUA 1STMA 1F5JA 3AMNA 4Y22A 5F5QA 1YQ8A 2BDRA 3WAUA 2VBDA 2F4PA 3DXTA 2VGDA 2E53A 4XF9A 1SMVA 4AHWA 1W2OA 3FL7A 1E5SA 3M3QA 4HSLA 5FO9B 1O3TA 4XDOA 1HB3A 2OUJA 5LB6A 1CZSA 1LB2A 3MPBA 1B35C 2EXJA 1NZIA 1VAMA 5FZLA 2NLRA 3JXSA 4IESA 4LBMA 3KSTA 2RS31 1PGL1 1GNHA 4XBQA 3H8XA 4Y20A 2RS11 3VBOB 1QJEA 3D5YA 3MFAA 3B7MA 1WWYA 3TOJA 4GMP0 2PHXA 4BK5A 3WXPA 3VKOA 2YFRA 1RUI2 2R32A 1PX4A 1VIWB 4YM2A 4WM8C 2D7FA 1G6NA 2VM9A 2WWSA 5L36A 4CDXA 2LRPA 3H9AA 3KMHA 4OMCA 4YGEA 5C2MA 3K51A 2P3YA 1GZWA 3WDXA 4DUWA 4ZU7A 1CJDA 4QGMA 3VBRA 1NCQC 1XNCA 2BYVE 3CDZB 4B7KA 2OW4A 5LCWL 1R082 3MUY1 5F2SA 1DZRA 2WNVC 4AHXA 3MICA 4QB6A 3K1UA 3OM6A 2QTWB 2R0HA 3IAPA 1OUXA 4N9IA 5AFEA 3ACIA 1V6OA 3AP7A 3QBQA 4GKXA 2G4IA 4KWJA 1UW8A 4HT1T 1H8TC 2KM2A 3C2UA 2OVUA 2AACA 2OX0A 1RMU2 2VAUA 3IIAA 1LAJA 3W59A 4LKDA 1L7LA 2VQ0A 1KDMA 1AR72 1UXXX 1XE0A 2WZR3 4LBNA 4EWAA 1YFYA 2CU5A 3N35A 1O4YA 2DCKA 2D6MA 2YDEA 4ZPIA 5C8WA 4Y3OA 2FCTA 4Y4RA 4HANA 4PDWA 4BQWA 2HWD2 4FTEA 2P4EA 3FWEA 2J7MA 1J3RA 4CPBA 1Q8VA 4RHV1 3VDDB 1SBFA 2BVBA 2QDNA 5FZOB 1W8TA 5A8DA 1JN2P 2VU9A 2B7YA 4JQRA 1Y9QA 1URXA 1QWRA 3WHUA 2TEPA 2VG9A 5F1RA 1Q8QA 1WLCA 2VQAA 1WW4A 5DDJ1 5K0UA 2YGMA 3H7JA 1DQ0A 3O1MA 2P3JA 3FJSA 3OBTA 4QDRA 4AGRA 5BYNA 1OXCA 1QH6A 1RUJ2 3LOIA 3T0DA 1AR92 3OPZA 4HKWA 4CP9B 3NW4A 5KXEA 1H2NA 4QQOA 2PAMA 1ZREA 2A6XA 3BGAA 3H3ZA 2X05A 1QJY3 3RJ2X 1ULDA 1PGW2 4LMFA 1H4GA 4P9YA 3SITA 1LGCA 1UY4A 3PVNA 2YFSA 3B69A 3KGLA 4DQAA 5FLHA 4D6QA 2MNGA 2ERFA 4IETA 4N53B 5J7MA 3OM5A 2RMU3 5LK5A 5C4WC 3D4KA 5C5UA 1GYHA 3T2OA 2YBSA 2DTWA 2VTFA 5IK8A 1GLHA 3BI3A 4R4ZA 1X50A 1AR82 2UYAA 4IGPA 1RUG1 5F5AA 1LGBA 4MLGA 5FZGA 1XJAA 2WQ4A 3KV5A 3ACLA 4UOJA 5FQ0B 4IV1C 3VT2A 5CFCB 4JKMA 1VBC3 3LDKA 4V1PA 2BRTA 2VMFA 1GWMA 1LOAA 1OLQA 3FBMA 5I0RA 1D4VB 3WUDA 1S0DA 1HKDA 3MF6A 4NN0A 1XBFA 1ND2C 3O1RA 2X8SA 1V6KA 1W6NA 4CXXA 1ASJ1 4FPJA 4MV2A 1A8MA 1CZVA 3N36A 2VNOA 5CIRA 1WMFA 2DUPA 3T2PA 1CAXB 4GQ7A 4P9JA 1UY3A 4IE7A 4OI0A 3C7GA 1BMV1 2Y34A 4CYDA 1CZTA 1UMIA 2D6KA 3TN92 3K3NA 3FBYA 3ZN6B 2FZ2A 3AP9A 2RVAA 1OMIA 3M3EA 2JDMA 4Q4X1 5T5LA 2W2IA 1XE8A 1Z0HA 3PUAA 2XWJB 5FLJA 4EZHA 3MPPG 2FMDA 1UY0A 3NNMA 4E8CA 5J1XA 2W1WA 1O5LA 5FMOS 1RVF3 4BB3A 5BY5A 4NROA 4CSWA 1VBA3 5JR2A 4LKEA 3AL6A 4ZKTB 2X5IC 3VBUA 2JENA 1WZXA 3DKQA 5F39A 4BYYA 2VVEA 1PO11 1JZ3A 1G9BA 2XBO3 4YFWA 1GR3A 2ZCWA 3VSRA 1JU3A 4RQPA 3OM7A 5ACA3 1YIPA 3PNAA 4IGOA 2WZPP 3VKFC 3PDQA 3ZYJB 4CE8A 4D47A 3RRDA 1W0PA 2HBUA 1LU2A 2VOXA 5IUQA 3UJQA 3P3PA 1OLRA 1CPNA 2RM21 1JOPA 2CDPA 2ORZA 2QQIA 1VBD2 3MIEA 3HR9A 3A0NA 3ES1A 4IEVA 4XUQA 5GZCA 5KC6A 2WRAA 4PVIA 1POQA 3KV9A 3MW3A 2WINB 4XTPA 3HNBM 3PIGA 4FPCA 5A1LA 5FK8A 4QPYA 4AGGA 2P34A 5A80A 2BWCA 2YXSA 2JE8A 4GAZA 2MHFA 4MXWB 3O5SA 5GLTA 1F8VA 5HXMA 1RUNA 2BGOA 5HBAA 1UYXA 1JH5A 1YHFA 3ME2A 1VLNA 5A3WA 4CUAA 4CCEA 4IV3B 3CMGA 3WN1A 4KI5M 5IK5A 4CEWB 2E32A 5J48A 4P9GA 1G86A 2R1BA 1ODNA 4COTA 1ZNPA 1BK0A 4OQ9A 3Q8BA 1SLTA 4QU2A 1QXRA 4A6OA 3PUSA 4XJAA 5FMCA 1F31A 3URFA 3ZFFC 2XJSA 4NPMA 3T0BA 5A7WB 1R092 1RUC3 1FNYA 2YC2A 5C7GA 1W06A 3JB8A 4CU9A 1YNAA 3B9CA 3DXUA 4CEYC 4WVMB 1ZA4A 3MI8A 4Y1ZA 5C9AC 4XTMA 1R64A 3FLRA 5E16A 5FJHA 1H8VA 2UWAA 4QKBA 4LUMA 2MEV3 4H55A 4ORFA 1JYNA 3O1PA 3I3MA 5AYEA 1I9RA 3LA2A 3NNJA 2EF6A 4PT6A 4XVHA 2WLPA 1J84A 2JD9A 4Q4V2 4AW7A 1AZDA 1NXD1 2N7GA 3ZFEA 2NZ9A 5CKQA 2XVKA 5ABJB 4AVBA 4YVSB 3LGRA 4DXZA 1ZBE2 2ZGPA 5KHJA 4KC8A 2JKBA 3CNAA 4YVWA 1FV2A 3LA7A 2DWRA 3SKVA 5EFUA 2R16A 1DZTA 3D8CA 1SFPA 3AZWA 1YO8A 2JG9A 4XW3A 3V0AA 2ENRA 3ZMOA 3ZVXA 4KU7A 1HV1A 1O6UA 2PHRA 4IEOA 2W1UA 1AYM2 4M0HA 4J25A 2W94A 2A3WA 2ET7A 5FP8A 1UZYA 3ZKYA 4CZSA 3AMMA 1KFUL 1R1A1 3NJVA 3GNEA 4B7EA 1G9FA 4HK8A 4Q1PA 3DV8A 1OLME 4IEPA 2RR12 4XAEA 1OOPB 5FZ4A 1RUE1 2E7TA 1C8M1 3KF5A 3P3NA 1HXS1 2VZ3A 3GJAA 4NHYA 4DEVA 1J3QA 4XFCA 2R1DA 5D2AA 3ZFGA 5B4NA 5JCTA 3M70A 2HWF2 4KL1A 5FFOC 3PIJA 3IN9A 5FZOA 1GFF2 1HQNA 1ULFA 2E51A 3AP4A 3HT2A 3ZXAC 2WA4A 4BQ5A 4E8DA 4EV0A 4UW6A 3WN2A 4C0BA 1RHI1 1WCDJ 2OZJA 4YG6A 3G7DA 1U5YA 1US2A 1S0GA 5DZFA 1AR62 1PIV3 2B5HA 5FJKA 2VDTA 3L2YA 2X09A 4XABA 1GMMA 3UETA 1W9WA 1ZZ8A 3OUHA 4LKFA 3CKHA 1TME2 4XFIA 4YW7A 5EV7A 1IS5A 2BFUS 1U5IA 4NRMA 2ZXQA 3BTAA 5L9RA 2PLV2 2DVBA 4PBPA 2NP0A 1J59A 1KJLA 2I07B 1NQJA 1EAH3 1TNFA 2ZS6B 1K12A 4FPHA 4XZPA 2RDQA 2VECA 3POYA 4H3WA 4LOSA 5FP3A 4I3PA 3CL1A 3QCWA 2ZBJA 3JBG2 1ZBA3 1V6IA 4HXCA 4JKLA 2OYZA 4ET7A 4YWAA 1V9U2 5EPAA 4N9HA 3RWKX 1W8OA 1J1TA 2JG8C 2IXJA 5FY1A 2Q5TA 4IGQA 1FOD1 2BJSA 2W87A 1H6YA 5CBLA 3ZN5A 4JHTA 3KVBA 1K5MA 3LFMA 5T5PA 5HCHA 3WQ7A 2UU8A 1BBT1 2X53S 4GKYA 3D5OA 5FUNA 4LK6A 4AZZA 1YC61 5FYVA 5B4XA 1UO9A 1VRH2 2K9ZA 1AYN2 2VZ1A 2XGXA 3HWJA 4AQ6A 1AXYA 2HKXA 4P9XA 2EXHA 5FLWA 5F6LB 1BJQA 5I0TA 4GB31 1OBNA 3ILFA 1FPN1 3OY8A 1VBB3 3AKPA 3RZLA 2GH8A 1FMD2 2O8OA 2UURA 4NOTA 4UF0A 1C57A 5I0UA 4OZOA 4JGZB 4OHWA 3PJQA 5CB7A 1WBFA 4P9WA 3VBFC 4GA9A 4PHZA 4DINB 4V2WA 4AFDA 4QPGC 2VZQA 5FPBA 5IVVA 4XIOA 1DYOA 2C26A 2P6CA 4BQ3A 4OHVA 2R30A 1E57A 2A71A 4WVZA 1X9PA 4KCBA 1Q43A 2IUWA 4YW6A 3VBHC 4JHZA 3JZVA 4NOVA 1X9TA 2DVDA 4QKNA 3JU9A 4GIQA 4M3CE 2LUWA 5KWRA 4S2FA 1I5PA 1ZZ6A 2HWC2 2QQOA 4KMQA 4UBGA 4UXAA 5A1AA 2XH6A 3IT8A 4R9BA 4Z1VA 5BNPA 1W8WA 3IPVB 1PT2A 3LOBA 5AYDA 2ZGKA 3B02A 4QT6A 5FYMA 3OOXA 4DPNA 3J8F2 1ZA7A 1RGSA 2PAKA 5CVRA 5A3NA 4CDWB 1OQDA 4FPEA 4GH4A 3T30A 5FRAA 3ZYGA 4PLOA 4AAPA 2ZHKA 3VZKA 4BPZA 4Q26A 4CCDA 2NQYA 1YJKA 1MR5A 1GANA 4O61A 4FFGA 5A7QA 1C1LA 1JYCA 2WFF2 1JU4A 2V4AA 2ZABA 5LEKA 4BMBA 1YQCA 3FC0A 4FI9A 4FOQA 4OCTA 3WLUA 3WW4A 1D4M3 4QXHA 1KGYA 3OYWB 1ULCA 1GNZA 1YFWA 3WZ1A 4A44A 5JMCA 1GOHA 2XXZA 4UAPA 4AVAA 2OA2A 3F95A 4I30A 1FXZA 1OF3A 2VXRA 2XMLA 5LA1A 3VSFA 3HN1A 1Y3TA 4AK6A 4QGLA 1DZQA 2F4LA 2E63A 1MQTC 1NQDA 2GU9A 3DEMA 3NAPA 2WZR1 4LOTA 2DF7A 2XQXA 4CU7A 1UWWA 2PHDA 3OB8A 5C8CB 1W04A 2YV8A 1RUF2 4D8MA 2RE9A 3OF1A 4HL0A 4QHBA 5C3SA 1TE1B 4IXLA 2CDOA 4AK3A 5IVEA 1ASJ3 2Y0IA 2BPA2 3PUHA 1HW5A 3MHZA 2C24A 4AXOA 2Q4SA 5LWBA 1JZ2A 2VCCA 2VUCA 3WW2A 4UW4A 1LOFA 3WF4A 1Y43B 1DF0A 2P5BA 1AF9A 2H0VA 4LQRA 3ZSEA 1CAWB 2TNFA 5KBFA 3WINE 4M0NA 1K3IA 1VBE2 3SCFA 1AHSA 3U4XA 3RZZA 1N3OA 1VKDA 2LROA 5C70A 3IAQA 3USSA 5BXXA 1JYTA 3MFCA 5F2WA 4DXTA 1TG7A 5EQUA 3BUCA 3KZ4C 1H1MA 5JZGA 2QDRA 3O0WA 2W5FA 2QZ2A 3E6DA 1I1EA 2EAAA 1CGPA 1W3VA 3ZYHA 4N4BA 2W3JA 3FHAA 4COYA 3FN9A 1V6NA 5FZ6A 3WPZA 5BNQA 3LV4A 1SQ4A 1VMFA 3BIWE 4Y1YA 5CFDB 2GSYA 5JWPA 4CP1A 2AH2A 3FMGA 5FY7A 4CDXC 1JYXA 2RMU1 1W0NA 4FCAA 4HKOA 4QXKA 4YVSA 3NV2A 3OD0A 5FLIA 4F3JA 2I74A 3VBRC 3Q8EA 4XETA 2D43A 2EIDA 2VTXA 2KD7A 4K6BA 2RM23 1CQ9A 1XPWA 4ONUA 3LQCA 3WHTA 2WO2A 2A3YA 3ES4A 2ZX1A 4AEJA 1WCKA 4KBZA 2RS53 3RYPA 1JZ5A 5FXVA 4PF1A 2XDVA 3MIHA 1VBC1 2R042 3CJIB 1SBDA 3QD6A 3HT1A 4YLZA 4ZHNA 3VD9A 5CISA 1A8DA 5DZEA 3CHXA 3HN3A 2PHFA 4HONA 4IEYA 4UW3A 3WG4A 2FDKA 2AR6A 3ZM8A 4R9AA 3PMSA 1TMF2 2DUOA 2DURA 3AB0A 5ANQA 3DPRB 2EAKA 2XPJA 3RI8A 4PDWC 1GP4A 1R1ZA 5GLOA 2DUQA 4RR3B 3VBSB 4XBLA 4A41A 3LEGA 2CL2A 1JBCA 1Y7BA 5HPOA 5FPAA 5A33A 3B5LB 2HLEA 5F37A 2VMIA 3UYJA 1POV0 2BGCA 1ODMA 3ETQA 3R6SA 5K0UC 4TZDA 4UFIA 2GH2A 4JGYB 3RI9A 3MLJA 2VY0A 3LF7A 1N3PA 3U07A 1UD1A 3LWCA 1W6MB 4W6YA 4QXCA 4UBHA 3NL1A 3P2NA 1NLSA 1RVF1 1N1VA 2WFPA 3LSDA 5LA2A 3H8OA 1VBA1 4LIVA 1H9PA 3KHBA 4XUOA 5FKBA 4CDUA 1LHOA 1PVXA 1UYPA 2VPVA 1MVQA 3DYMA 3I2DA 4CVUA 2XBO1 5C3RA 2D6OX 2XL9A 3K2OA 4A3ZA 3RQ0A 4AFBA 3VD7A 4K9SA 2XR4A 2O0OA 1NY71 1RMU3 5EP9A 4D6SA 3WG3A 4XC9A 5H9SA 1RUOA 4D7SA 1AR73 2YFTA 3OTFA 3ORJA 4RL7A 3ZXDA 4LXLA 3FHIB 3LA3A 2D6LX 5FZFA 5GLUA 3BN6A 3IDCB 1QEXA 3ZDVA 3GBFA 4ATFA 1SPPA 4I0AA 5DDJ2 4CTEA 1LHUA 4K1ZA 3O14A 1ZRCA 3AP5A 3N9QA 1HB4A 5JR7B 1DG6A 1OD5A 2LALA 3VB9A 3POJA 3E5QA 3OBRA 1PK6A 2RDNA 2DDUA 4J1XA 4Y5Z0 2C5DA 1JZ4A 1YUDA 2CAVA 4JVAA 4K40A 3UT0A 3RDIA 4JRLA 1UKGA 1W90A 2K0GA 3WP5A 1AJOA 5FPUA 2QFEA 4O9GA 3WQ1A 1RUE3 2WL1A 4OMDA 1C8M3 1JYIA 3EYPA 3M3CA 2HWE2 5FXZA 5GZDA 2PHUA 3WF0A 1OC1A 1UCXA 1RUJ3 1AR93 3B94A 4LBQB 1ND3B 3IIIA 3S7IA 1N3QA 4WZCA 4R8HA 4LULA 5EXOA 2ZJCA 3T3YA 2WYSA 3WR0A 2VCMA 4HPKB 4LLFA 5DAVA 4WVWA 1NLRA 5AVAA 1QOOA 4BIFA 1UIJA 2CSGA 4UDGA 1HIXA 1RUC1 4DY5A 4E2QA 3POBA 2W68A 3POIA 1CX4A 2IVJA 4XACA 2YB7A 2IXCA 4O8PA 2YHJA 4GJYA 4XYXA 1GV9A 5H9PA 2TBVA 3WF2A 4BZ4A 1HB2A 3JD73 1SG3A 2MEV1 2XL7A 2UYBA 3U78A 2J1SA 4RS5B 4PCRA 3WG2A 2PQSA 1W6QA 3BB6A 4CCNA 5FTTC 5JXHA 1HV0A 4AR2A 4G3YC 1A3KA 5BNOB 3D0JA 3RMYA 3FHQA 4LHNA 3QLQA 1KDKA 4Q4W2 4NIHA 5T3NA 4CDQA 4Y5TA 4J6GA 4OULA 4L11A 3WMYA 2VOKA 4HN1A 3N3HA 1BEV2 4MVTA 4E27A 4XAAA 4RQPC 1FOD3 1LULA 1YIFA 4XFHA 5FMOL 3I7DA 3KCXA 2OT7A 4XMAA 1KS4A 2BNMA 3DF0A 4BA6A 1BBT3 2DU1A 4MXVA 4Q0QA 4PLMA 3PTRB 4E4HA 3J9SA 4HSJA 3GHNA 4RA0A 4EYUA 3MW2A 5D21A 2DVFA 2FDIA 4QX7A 2W92A 2XLAA 4GB33 4MGTA 1VAVA 2AYHA 1HN1A 1UOJA 1JS9A 1WW5A 5C3OA 3I2HA 2WNUB 3IMNA 1HB1A 3LZZA 3M3IA 2ZEXA 3KT7A 2B45X 3KF3A 2Y0OA 1AX2A 1N1YA 2RJ2A 3TN93 1NUKA 4HLTA 4UFMA 5BNNB 5GM0A 1NAEA 4ZXKA 3ZYBA 5JSOA 2R062 2VXJA 2YG0A 4AE2A 3H8UA 4HN0A 4IL7A 4QHZA 1KQRA 2GP5A 2VUJA 1OT5A 3GJBA 3N7KA 2XWBB 4KG8A 1D0HA 3RS6A 5JXJA 1LKNA 2BV4A 3WDUA 1K42A 4RGAA 5DABA 2HH9A 5GLKA 1J58A 1UKRA 1F9KA 4YYOA 3NVCA 2LS6A 4UI9L 3N9NA 2ZHLA 3CLPA 3J26N 4BQ1A 4NIDA 4N90A 5K7PA 1VALA 3SLIA 2DV9A 3QH7A 4NHXA 2G9FA 1YQ5A 4YZ1A 1PIV1 1QQP3 2K46A 3TWIA 2D93A 4S2GA 5A7VA 3UKVA 1O59A 2EVXA 2JX9A 4MGIE 4CRQA 4URTA 2PA7A 3K4DA 3B9IA 5JLVA 4FPLA 2CGPA 1EAH1 4NAOA 1JI6A 1Q8PA 2YC0A 4KWLA 1XC6A 4KWUA 1BCXA 4X8PA 3BTZA 1O5UA 1VBD3 3HBZA 4N2ZA 1B35B 1S0IA 1ZBA1 1XRUA 1YQ2A 3ZFEC 4E4SA 5GLVA 3DN7A 2J1EA 1C5IA 2WAOA 2WKKA 2X29A 5IVJA 5JOZA 3I59A 3NWKA 4YVWC 1HRV2 1Q5OA 1BVVA 3MYXA 3QACA 4FFFA 1W3XA 4YG0A 3W20A 2QVSB 3BYLA 3WASA 1W2UA 3PHMA 1IHMA 2IFRA 3MV11 4WM8B 1JXNA 3J7LA 3OPTA 4GWMA 5D1IA 5K4LA 3WW3A 5A32B 1LECA 5CKNA 3APBA 4M3CB 1RUH3 4NWVA 5F3EA 1MS1A 2JECA 1LNSA 3MBWA 1ST8A 3SEPA 4PVAA 2UY9A 1VBB1 5FR3A 1H6XA 1JTZX 1G9DA 1NCQB 1NX9A 4FOYA 2ARCA 2JIGA 2ZEZA 2JDPA 4WM7A 3PMEA 4D3WA 4KC7A 2WNVB 3J7NA 1N1SA 2J1VA 3RPQA 1R093 2C4XA 2A6YA 4AVVA 4JV4A 2WABA 3DGTA 1UV4A 4MGKE 2VH9A 2AEYA 2PN5A 3TEXA 4EN7B 4O8OA 1YJLA 2ZGTA 3INAA 4NRQA 2ZGSA 4P5YA 4M3CF 5IK7A 3WVJA 1H8TB 4FVVA 1GQGA 1SLBA 2RDSA 3ZFGC 4LJHA 4OHZA 4BXSV 1PMIA 4Q27A 5BUVA 4XFAA 2DCTA 1HJGA 3RMXA 2YZ4A 1S2KA 2GN3A 4DXRA 3POSA 3VL8A 1MS9A 2YUEA 4YZ2A 2D6PA 4Q4V3 5FZ7A 3VHOA 2VMHA 2X8FA 5L9VA 1RTVA 2H6BA 2D6NA 3RYRA 2J1TA 3ZXKA 3AXEA 5A3OA 3MZHA 5DAWA 1YFUA 1LCLA 4OHXA 4W50A 2W91A 4ISQA 4E2SA 4UT5A 4QX2A 2YBKA 2WNOA 4OUSA 2BQPA 4DEQA 5LA0A 1HJFA 4YSFA 3VDAA 3X29B 4BQ4A 3CF6E 2W39A 1AYM3 4HKLA 3ON7A 4MHRA 1D4M1 5E8AA 1HXS2 3H8RA 4MG2A 1NXMA 2GNMA 4JKKA 4Q8LA 3TEYA 3AX4A 1QJFA 2HWB3 4XCAA 2CYFA 1COV2 2BFUL 1K5MC 2RR13 2VUAA 5HI0A 2XONA 4IE6A 2EXKA 2VD7A 3UJOA 3C7HA 4DXSA 1OUSA 4QPIA 4XHXA 2A6ZA 3RGBA 3ZR5A 1W6PA 5I91A 5KHGA 1W0OA 2FD8A 2HWF3 2XJTA 3RVHA 4EQVA 4FO9A 2Q8DA 1YEWA 3USUB 3W58A 3ZO0B 5C4WB 5L7OA 3P1IA 4N7IA 1QDOA 4BMEA 3SEEA 1U12A 2R072 5IT6A 1DQ2A 1VE0A 1AR63 4MYEA 5DXDA 5FY9A 3ZPYA 4A3XA 1C4RA 4RN5A 4IV1B 3BVCA 3H1MA 5GKAC 3TRSB 4XF0A 3TEZA 4M01A 2DTYA 4LR4A 3NRUA 1NKGA 5A3TA 5A70A 2ARAA 4YM0A 3JCIA 2XJRA 5HXVA 1YYNA 2PLV3 1JMUB 3AZXA 4NIAA 1Q56A 1IKPA 1GOFA 2P3KA 3LEMA 2ZX3A 2RG4A 1CVNA 2VZVA 3TNQA 1Y9MA 1ND2B 5C3QA 4ZONA 3JBG3 4BHPA 1FT9A 3U11A 3UESA 4XE9A 1V9U3 1XNTA 3FE5A 1A78A 1UPSA 1UU4A 3R4DB 5GLWA 2ADDA 3THCA 4LO4B 4QKFA 3ZXEA 4F7ZA 5J37A 2GMMA 1JODA 5KHKA 4GH4C 4TLFA 1DGRN 1NCRA 5EWSA 3ILNA 3H1WA 1QNWA 5JMOA 1VRH3 1AYN3 1OLMA 2EIEA 4Y24A 1G7YA 3VHRA 1QIQA 2DU0A 3WNMA 3BALA 1IPJA 2PMWB 2B4KA 2WAAA 5F5IA 3VHNA 3HQXA 1XNDA 3H50A 3SHRA 4NR1A 4IEWA 4Z2AA 1FMD3 3C7FA 3OJBA 4XOGA 1CONA 2W47A 2X5IB 1W28A 5G04L 3O1SA 3WATA 1PMHX 2VNGA 1QNYA 3AKTA 3Q8FA 3CBNA 2YC4A 3B93A 2GNTA 1L7QA 4XQ4A 1GBGA 3D6EA 2RS51 1APNA 3K46A 1YRZA 1O91A 4QQ2A 3ZOIA 4NJ4A 4SBVA 4AHZA 3O12A 4N43A 1W6OB 3FX3A 2XB6C 1LODA 2CGNA 3NAPC 4QXBA 1PO22 2JDKA 1W9TA 3PL0A 4R52A 5D8AA 3MO4A 4ES9A 5M0TA 1GYDB 2ZKNA 4XIKA 2J1AA 4FPYA 3B3QE 3C3VA 5CG9A 4L99A 5FMDA 3FLPA 4X6QB 2PAEA 5IFPA 4AEDA 4GXLA 1NA1A 1QH7A 1M4WA 3FFQA 4C1XA 3WUCA 4EROA 2XUEA 3HQRA 3SQOA 2VJXA 1LOFC 3HNMA 1WGPA 3SC7X 1K45A 1OH4A 3ZSMA 3O7OA 1UN1A 2VBBA 3K48A 1HRI2 5FY4A 3KWVA 1J3PA 4I3GA 1WKYA 5FY5A 2ZMLA 5JSRA 4R9DA 4QX3A 5LEJA 4NIGA 4M4PA 4YGCA 3AYEA 5I8YA 3WPVA 5JZGC 4HG6B 3UGFA 5FZDA 3ZFFB 3RG0A 4ITCA 5FZ3A 4P9IA 1OQEA 1R081 3VBOA 1GU3A 2OXBA 4CCKA 1ZRIA 5A6QA 1LHNA 4UDIA 5EYXA 1RYYA 4LUKA 1VR3A 4LO6B 4CEYB 5C9AB 2WO1A 1VRBA 3MUZ1 1Q8SA 4LLOA 2WYFA 4Z07A 4AQSA 1JYVA 1RMU1 4LHSA 2XHNA 4LA2A 4L8QA 1AR71 4ZXEA 1ACCA 3VDBA 2C9AA 4K21A 1RUD2 1RUF3 4KG0A 1FX5A 1MEC2 1LRHA 4AI0A 2JDZA 4NIIA 4D7TA 4L0PA 1S1AA 4MGQA 4Q2FA 4DUVA 1FYUA 3AKRA 4XUTA 5JOWA 2GNBA 3ZXGA 1GWKA 4HVOA 1PM7A 1QDCA 4FQ4A 1PVC2 5APAA 3TNPB 1A34A 2WNEA 3THPA 4AK7A 1OPOA 1YFXA 1Q8OA 1LEMA 3K3OA 4Y1UA 2XOMA 4BCUA 1VBE3 3ST7A 4Z92B 2SBAA 2PHWA 2IFWA 1QJY2 1O8SA 1RUJ1 3GCWA 3AL5A 1AR91 5FAXA 4JTOA 4DO0A 1XSRA 4XJZA 2CHHA 5A1FA 3U10A 3VDDA 1XU2A 5KHIA 4UFLA 4DMIA 4AYUA 4A7ZA 5C71A 2O14A 1CN1A 3AYCA 3I3EA 4FP3A 1PZ8A 2E31A 4NRPA 4S2HA 1CIYA 3R67A 1XYOA 2UWCA 3G6JB 3ZDSA 2QQMA 3JD71 2XVLA 4FSJA 4M00A 4GJZA 4CP9A 4DS0A 4EN0A 1DQ5A 3IDAA 3H7YA 5IK4A 4QAWA 4AGVA 2VMDA 5A3MA 2BERA 3RJRA 3MF9A 1DGRA 4A2UA 4CDUC 3BIEA 2I45A 4AQTA 1AR81 1OF4A 2ZGQA 3CJXA 2QQWA 5FZEA 4ARXA 1ULEA 2ZA9A 4GWJA 2W08A 3NNFA 5FIXA 5FZBA 2LW8A 3RNSA 2LM3A 5EJ1B 3AJYA 1WLDA 2WS92 1PX3A 1UZWA 5FZ1A 2R043 1US3A 2JEMA 4N53A 1VMJA 1DGWA 2PXJA 1ZX5A 4B4PA 3O1UA 3KD4A 3O0VA 3PU8A 3OCPA 3WCSA 3WNNA 1CAVB 1W8NA 1TMF3 3GALA 1NE6A 1QJU2 1SCRA 3ABZA 1PMJX 5AYCA 2JE7A 4U2AA 4NHKA 2JG8B 2K2SA 3RYKA 5FQ0A 2WDBA 2VZRA 3E6CC 1VP6A 3NV4A 4UFHA 2BVVA 1PK6C 3TN91 5CFCA 3AMPA 3SMHA 4SLIA 3KCCA 1IS3A 2RHPA 4C91A 3USUA 5BNPC 2F17A 1UU5A 4AEMA 1VBA2 3S7EA 3BTXA 5JIAA 5SV8A 1XQNA 5AY9A 2YPDA 3NO8A 5J3UA 3V0BB 4YG3A 3UKTA 2F6BA 3KV6A 3QZ4A 3FLTA 1CAXA 2PFWA 5FREA 4XILA 3OEAA 3SISA 4BQYA 4FAGA 1W2TA 5ACA2 1NY72 3M1HA 4QX1A 1G9AA 2OIIA 1QQP1 5F3GA 3ZSJA 4BXFA 1SBEA 2WT0A 3VBFB 3ZN6A 1JHNA 2DCZA 1DQ1A 4XURA 3WP6A 3CU9A 2XLGA 2VMEA 4QPGB 4XCBA 5HCBA 1QMJA 3SXWA 4AVSA 4QQLA 4NVPA 1U5ZA 3O1OA 5IW0A 5BPXA 5LATA 4YPJA 4MGYE 1GP5A 2JKXA 3O0XA 1AX1A 1NT0A 1ULPA 2ZKLA 2HEWF 4XQDA 3VBHB 4K8RB 1Y4WA 4D6RA 5FBJA 3KGZA 3OBZA 3WDYA 4JAAA 1VBD1 3VN4A 2BBAA 3WNLA 1UYZA 1QJX2 1JUHA 3AZYA 4CDQC 2UY8A 1ZVFA 1V0AA 2WO3A 5E6HA 3AMQA 4LORA 3OGJA 1RXFA 1OKQA 4KMIA 1NG0A 1XE7A 2IXHA 2VUDA 2JD4A 4OI2A 1RJ8A 2AENA 4LEJA 1Z7S2 4FTSA 3RWNA 1QY4A 4CXYA 2Y6LA 2CV6A 4GALA 4XJWA 5KR7A 2IXKA 3IMMA 5JVVA 3SCGA 2X5IA 1OYGA 5JAXA 1QXJA 2HWE3 4W6WA 4YZ4A 1RUH1 5FYCA 4XXPA 4UWDA 3CIHA 3WV6A 2XUMA 2QBXA 3OM4A 1MZ6A 2C6SA 5A7SA 4IEQA 1L7RA 5IAXA 2IXIA 3GM8A 4HMZA 5FXWA 1RC6A 2DFCA 3H42B 1R091 2WBKA 1E5IA 1O8PA 1YXWA 4MXWA 1H4HA 2ZHMA 5B6SA 1UQXA 2GN7A 4NAMA 4QQHA 3I2FA 3LIHA 2XKOA 3M8LA 2CTVA 2JB4A 1CAUB 2AEZA 4IV3A 4KWKA 1LHWA 1UNBA 2YYOA 1F2NA 4NPLA 1MQTB 3KM5A 3TYJA 4CEWA 1GZCA 1X8EA 4X6RB 5FK7A 1KFXL 3LEKA 3PJYA 1ZZ9A 4NMIA 1IPSA 1O7FA 2VNRA 2D3PA 3K75B 3N7JA 3KQ4B 3OGGA 4KU8A 5HV4A 2Y33A 4Q4V1 4OUEA 2WN3A 5FZ8A 1C1FA 4EE2A 4Q4W3 5AFBA 2Z42A 4LHKA 2RJLA 5A8CA 5A7WA 2X10A 4Y22B 3PVBB 2YROA 1ZZCA 2Q30A 1EV12 2D44A 4WVMA 5LRRA 1BEV3 1UY2A 3NNLA 2A70A 3HIFA 1J1LA 1NOVA 3LDBA 3WSOA 2Y6HA 4PQ9A 3OGRA 4OLLA 4QB2A 3ZIWA 5CU1A 4PIYA 1AJKA 3HQUA 2YBPA 1VB2A 1AYM1 1AL23 1RITA 4Z82A 4L92A 4IW3A 1HX6A 3HMYA 5FZCA 2QQPA 1GSLA 2JJ6A 4MADA 3WCRA 4EWEA 3VT0A 5LBCA 5ABJA 2Q0AA 4Y20B 5LY1A 2HWB1 4JDMA 1KRIA 1LTEA 2G19A 4IE0A 4XF4A 2RR11 5AC93 5CEHA 5FZIA 4DIQA 2AC1A 4NHLA 2PHTA 4BQ2A 4U6BA 4HVRA 2VL4A 2R063 2WSVA 3H3LA 3PURA 2J22A 4CCMA 5GLLA 4UFJA 2WR9A 3SH5A 2A5ZA 2BOJA 3RZGA 2W9XA 2J1RA 2L9LA 4CDXB 2HWF1 5DUWA 5GLPA 3E6BA 1WMEA 4R9CA 1NYWA 3VKLA 1IS4A 1GZWB 2RS32 3H1YA 1PGL2 3VBRB 5T54A 2R0FA 4GMP1 4WM7C 2RS12 5FP7A 4ASMB 1DYKA 1EYBA 3NKGA 5DAPA 1AR61 1OOPA 2VZPA 3S5AA 3KVAA 1WLTA 3LPFA 4FOVA 4AI9A 2EALA 3RZJA 5F7UA 3IBMA 5E1RA 4AI1A 2BTVC 1H0BA 1TME1 4Y4YA 1GUIA 3GZAA 4F8AA 1F35A 5A3PA 2CY6A 3MGUA 2PLV1 3O1TA 3MLLA 3AYAA 3T1LA 1VB4A 1GZTA 3JQWA 4LIUA 4L9BA 3H3UA 2Q1FA 1RUI3 2QJVA 3VD3A 5IVCA 1AXZA 3ATGA 2WO7A 2IVIB 2O8QA 3S5QA 2X8TA 3JBG1 1SCSA 1MS5A 3MV01 4PDWB 4TLGA 4HZFA 1O4ZA 5LBEA 4CP2A 1V9U1 1G9CA 4XFFA 3A22A 4UW5A 2AUYA 3WT3A 5DUXA 5IYYA 5JOYA 2VNVA 3MIDA 1HRV3 1H1IA 1R083 3J7MA 2FDHA 2GMEA 5K0UB 2GP3A 4CPBD 3EQEA 4YRDA 5EIYB 3CZJA 1H1AA 1VRH1 1AYN1 1F4HA 5FMBA 4I2OA 2D97A 5H9RA 2VW0A 5LZ6A 3POEA 1NLQA 3C7EA 3W5NA 2WZEA 4CA9A 3WW1A 1LU1A 1PM4A 2NMOA 1FMD1 4K7JA 3FUQA 4RHV2 2WWJA 4LE4A 3U4SA 5FBZA 1JUIA 1XYPA 4W6XA 3AZVA 3I2GA 5A7NA 1XYNA 4BISA 2FCVA 1KD7A 3M4FA 2BGPA 2HWD3 2ZMNA 5KHHA 1UL9A 4D7YA 5KC5A 4QPIC 2KA3A 3AVRA 3BU7A 1C5HA 3POWA 3VSSA 4CU8A 5IHRA 1ZRDA 5GLNA 2V5YA 1UY1A 4C90A 1UXZA 2JWPA 3EMRA 3BYNA 4NUBA 1MS8A 2GZWA 4TSVA 5L7OC 1OA2A 3Q8CA 4KNCA 5FY0A 2B4WA 3ACGA 2J1UA 3GBWA 3QEFA 4A7YA 3OEBA 4JGZA 1ENRA 1ZRRA 4DRRA 2HYKA 1S0EA 1GQPA 1X33A 4LT5A 2Y60A 5CKMA 3R05A 1S2BA 4QX8A 4LE3A 3LFIA 4ZS2A 2XHKA 4I0BA 3J8F1 1H2KA 4AFAA 2P3IA 3PUIA 2VOVA 5FYTA 5H9QA 3ZSKA 4D94A 2VVDA 4LBQD 4E2GA 1S55A 5HCFA 4HOOA 1OFNA 1QGLA 2WFF1 1WCSA 4NO4A 3DCQA 1NZCA 1CR7A 1W6NB 4AVCA 3QH6A 4KGGA 3J4UH 3IKWA 1RUG2 5LASA 4CU6A 3I54A 5FUIA 3T4HB 3IPVA 3GXUA 1REFA 1COV3 4XDQA 1D7PM 1C3HA 2LTNA 4JQTA 4EN6B 3VBUC 3AC0A 4CDWA 5I8TA 1AR83 1NCRC 2DYCA 3T2QA 5ISLA 3P5BA 2VBPA 5FPXA 1V6JA 3KT4A 2DVGA 5ANNA 4UDKE 4OHYA 2A73B 1KJRA 4LBKA 5FZKA 4P02B 4FFHA 1ASJ2 3L2HA 5CYYA 5JOXA 3HVDA 3OYWA 2GC3A 5FCCA 1RUF1 3N7MA 4HK9A 4ES8A 1POV3 3ZX7A 4I09A 1BMV2 3VBUB 4FP2A 4IEXA 1DHKB 4TWTA 2Z79A 2ZX2A 4C1WA 1SLLA 2R073 3R0RA 4IE5A 4FTBA 1WMXA 1UMZA 3HJRA 3WMZA 1WW6A 3SNMA 2AREA 4Q4X2 4B1LA 1WW7A 2KR2A 4RQPB 3AKQA 4KQ7A 3WY6A 1U0AA 3ZXJA 3OUIA 4MO3M 4N43C 3KCYA 4COVA 4C8DA 3KV4A 1VBE1 2C9KA 4ZY9A 3D3AA 4LNVA 4XUPA 5D8AC 3ASIA 3KSCA 4BJ0A 5C8CA 1LESA 2DBNA 4B4QA 5I8SA 5T55A 1JOJA 1T6GC 3K4AA 5EHDA 1XNAA 4A42A 5LY2A 4EWDA 3WP3A 4Y33A 4AEDC 3S6PA 1OSGA 2QNKA 1NA1C 5A6XA 1PO12 2JDAA 4BLJA 4W65A 2FBEA 1YLLA 1W9SA 3ZYPA 2ZACA 2D5FA 2WIIB 3GYDA 3AXDA 4YNIA 3R4SA 1AL0G 5IVFA 2XJQA 3MDPA 2C0ZA 1BKZA 1LHVA 1MS3A 4KH9A 4L97A 2E7AA 4TYSA 1T6BX 3IZOA 3VZNA 3TEWA 1CAWA 3T08A 5KXDA 1QHDA 3NJYA 3POGA 5L73A 5FYYA 1XXNA 2RM22 4Q4Y2 3KQRA 5C3PA 1RJ7A 3N9PA 2ARXA 3BODA 4LBJA 3D0SA 4BLIA 4MUVA 4YW3A 2P2KA 2ADEA 3AYDA 2RS52 4XHBA 2DCJA 1DQ6A 4BK4A 2OUHA 3J7HA 3VBOC 4RSUA 4Y5SA 2QQNA 3IDBB 3LAGA 2ZGOA 2QQKA 1F4AA 4EN9B 2NN8A 3CEWA 1W05A 5L9BA 3LE0A 2R041 5CFDA 3WPUA 4YGDA 2IC1A 1YQ6A 4P9LA 4S2DA 5CZKA 1PO23 2JG9C 4YW2A 3A23A 3FZ3A 4FQZA 5DUVA 1TMF1 1GYEB 1DU3D 3VDCA 3U75A 1HN0A 1TEIA 1EP0A 3ZFEB 1H30A 3VL9A 4A7KA 2QQLA 4INDA 4LO5B 3A7QA 2OKXA 4YVWB 1IOAA 3NKTA 3WDTA 4QB1A 1GWLA 3PUQA 1DDLA 2ZAAA 2CAUA 3AFKA 2JG9B 1GKBA 3CJIA 5FY8A 3V0AB 2Q1ZB 1HRI3 2G9ZA 4K8FA 5LA9A 5GLMA 3I2OA 1Q3EA 3DPRA 1XNBA 2BNOA 1MS4A 2KXLA 4QX5A 2Q8OA 4JDNA 4RR3A 3VBSA 1BLZA 2FHRA 4RGKA 5FKCA 1ZRFA 1PZ9A 3VDDC 1X82A 4DNYA 3LEIA 3V64A 1FAYA 4Z2WA 4K3UA 4EJRA 3EHKA 1C8NA 1OHFA 3OBAA 5FZ0A 4FOWA 1N1TA 4JGYA 4FPGA 4WZFA 1ZBE3 1JOBA 2EIBA 5FYSA 1SFYA 3ZFGB 1MPXA 1W6MA 3ITQA 2ETEA 5B6TA 3HAGA 1UZZA 3W21A 1W8FA 1GZ9A 1R1A2 2DVAA 2JDYA 1XB9A 1RUD3 1S0JA 4GWNA 3ZIXA 2NPIA 2Z5WA 1MEC3 2CGOA 2ILMA 5TSWA 5ERLA 1C28A 3ILRA 3QEDA 2ZTNA 2QCSB 2G9GA 3ECQA 5JXGA 4N1IA 2Y26A 1RUE2 1DP0A 3HD8B 4JX0A 1C8M2 2OS2A 4Q1RA 1H2MA 4K1YA 2EXIA 3UGHA 5LK7B 2XJVA 4AFCA 4DRVA 1LJ7A 1PVC3 2YPJA 3P6BA 5F3IA 4AG4A 4WBBA 1MS0A 4H2AA 2EIGA 3KHCA 4N53C 1I6XA 4OUMA 4JTNA 4A4AA 1LOGA 1BZWA 4LA3A 1VJ2A 2HWE1 4QQSA 1UF2C 3OUJA 4FXKB 1IZ3A 1CPMA 3FFZA 3WF3A 3ELNA 4QX0A 5DG2A 3K77A 1RHI2 1V70A 1UZ0A 4QU1A 4XZUG 1IKQA 3HEIA 1PGSA 3TB0A 4GD4A 2VQUA 4I02A 2OPKA 2OQ6A 3JD72 2A6WA 3DECA 1K5MB 4GMP3 4XPVA 3ZYIB 5CFCC 1QKQA 3BYWA 3UV9A 3VV1A 4D69A 4CUGA 3THTA 2VZOA 1CJPA 5FO7B 5LBFA 2Y6GA 5FWEA 1OPMA 4AL9A 2VQTA 4MLOA 5FZAA 2VOTA 3O1VA 3ZKUA 3SH3A 4FPOB 1TME3 3OY8B 2VC9A 3ACHA 1K5JA 1ND3A 4JDOA 4LBQA 1PHMA 4UF0B 2CNAA 5FDBA 3NSTA 1FOD2 4HPKA 3WEZA 3NMBA 4AK5A 2NYYA 4Q4W1 4TN7A 3RSJA 1BBT2 3UK9A 5KXBA 1IGOA 5T5JA 3WOGA 1ENXA 1UOGA 2A1XA 1BEV1 5LBBA 1CX1A 1D2QA 4ZZ8A 2QKDA 2QE3A 2WS93 4AEKA 3I2JA 1E5RA 1QU0A 3WQBA 4GB32 1UX7A 1FPN2 2A7AA 1ZZ7A
chains in the Genus database with same CATH topology
1GYHA 1GYEB 5AYEA 3U75A 3AKHA 2X8FA 1GYDB 3WMYA 3LFIA 4KCBA 4UFKA 3ZXKA 5FMDA 3WAUA 4MLGA 1WL7A 4NOVA 1YIFA 1W18A 4B1MA 3C7OA 3NQHA 5AYCA 3VT2A 4KC8A 3D61A 3LDKA 1PT2A 3SC7X 5GLOA 4FFIA 4UFHA 3VT0A 3LIGA 1YI7A 5AYDA 5GLMA 3AKIA 2EXJA 2X8SA 1Y7BA 3WN0A 3KSTA 2AC1A 4U6DA 4CCCA 4CCDA 4U6BA 5FKCA 3D5YA 4JQTA 3H3LA 4FFGA 4UFIA 3BYJA 3D5ZA 3KF3A 1Y9GA 4UFJA 5GLLA 3WPVA 5AY9A 4UFMA 3C7GA 5GLQA 3LF7A 3UGFA 4UDKE 4O8NA 5ANNA 2YFRA 5C0PA 2EXKA 4QHZA 4UDIA 2OXBA 3QZ4A 3LDRA 3C7HA 3P2NA 5GLPA 3VSZA 1W2TA 4FFHA 3OM2A 3KF5A 5JOXA 5GLKA 3QEEA 3WPYA 3ZR5A 5FKBA 5B6TA 4EQVA 1UYPA 3CU9A 3VSFA 3U14A 5A7VB 4AK6A 3K1UA 3PIJA 3OM6A 3QEDA 3WMZA 4N1IA 4B1LA 3WN2A 1Y4WA 5A7VA 3ZXLA 2EXIA 3UGHA 3VT1A 3ZXJA 2YFTA 3C2UA 5JOWA 3VSRA 3S5QA 2VDTA 3OM7A 2X8TA 4KMIA 4D47A 3LEMA 3AKFA 3BYKA 4AK7A 4N2ZA 3AKGA 4ONZA 4QQSA 1Y9MA 5JOYA 3ZR6A 5JOZA 3IMMA 1OYGA 2QQUA 4PVIA 5A8DA 3HBKA 1VKDA 4HXCA 3WASA 4FFFA 3PIGA 2ADDA 3BYLA 5FMBA 5FK8A 3RWKX 4UDJA 3C7EA 4N2RA 4UFLA 3OM4A 4UDKA 1ST8A 2ADEA 3D60A 3R67A 4AZZA 4CCEA 4PVAA 3WN1A 4N4BA 3UGGA 5B6SA 4UDGA 4COTA 3QC2A 3LIHA 2EXHA 4KC7A 3LV4A 5FLWA 3C7FA 3TAWA 3WPZA 2AEZA 4AK5A 3NMBA 2XQRA 3WATA 5FMCA 2QQVA 1UV4A 5FK7A 3VSSA 4O8PA 2AEYA 4O8OA 5GLNA 5GLRA 3U1XA 4KCAA 2YFSA 3BYNA 2QQWA 3R4ZA 3WPUA 3OSDA 5FIXA 1YRZA 3R4YA 2B4WA 5A8CA 3QEFA 3OM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GYH A;  1GYE B;  5AYE A;  3U75 A;  3AKH A;  2X8F A;  1GYD B;  3WMY A;  3LFI A;  4KCB A;  4UFK A;  3ZXK A;  5FMD A;  3WAU A;  4MLG A;  1WL7 A;  4NOV A;  1YIF A;  1W18 A;  4B1M A;  3C7O A;  3NQH A;  5AYC A;  3VT2 A;  4KC8 A;  3D61 A;  3LDK A;  1PT2 A;  3SC7 X;  5GLO A;  4FFI A;  4UFH A;  3VT0 A;  3LIG A;  1YI7 A;  5AYD A;  5GLM A;  3AKI A;  2EXJ A;  2X8S A;  1Y7B A;  3WN0 A;  3KST A;  2AC1 A;  4U6D A;  4CCC A;  4CCD A;  4U6B A;  5FKC A;  3D5Y A;  4JQT A;  3H3L A;  4FFG A;  4UFI A;  3BYJ A;  3D5Z A;  3KF3 A;  1Y9G A;  4UFJ A;  5GLL A;  3WPV A;  5AY9 A;  4UFM A;  3C7G A;  5GLQ A;  3LF7 A;  3UGF A;  4UDK E;  4O8N A;  5ANN A;  2YFR A;  5C0P A;  2EXK A;  4QHZ A;  4UDI A;  2OXB A;  3QZ4 A;  3LDR A;  3C7H A;  3P2N A;  5GLP A;  3VSZ A;  1W2T A;  4FFH A;  3OM2 A;  3KF5 A;  5JOX A;  5GLK A;  3QEE A;  3WPY A;  3ZR5 A;  5FKB A;  5B6T A;  4EQV A;  1UYP A;  3CU9 A;  3VSF A;  3U14 A;  5A7V B;  4AK6 A;  3K1U A;  3PIJ A;  3OM6 A;  3QED A;  3WMZ A;  4N1I A;  4B1L A;  3WN2 A;  1Y4W A;  5A7V A;  3ZXL A;  2EXI A;  3UGH A;  3VT1 A;  3ZXJ A;  2YFT A;  3C2U A;  5JOW A;  3VSR A;  3S5Q A;  2VDT A;  3OM7 A;  2X8T A;  4KMI A;  4D47 A;  3LEM A;  3AKF A;  3BYK A;  4AK7 A;  4N2Z A;  3AKG A;  4ONZ A;  4QQS A;  1Y9M A;  5JOY A;  3ZR6 A;  5JOZ A;  3IMM A;  1OYG A;  2QQU A;  4PVI A;  5A8D A;  3HBK A;  1VKD A;  4HXC A;  3WAS A;  4FFF A;  3PIG A;  2ADD A;  3BYL A;  5FMB A;  5FK8 A;  3RWK X;  4UDJ A;  3C7E A;  4N2R A;  4UFL A;  3OM4 A;  4UDK A;  1ST8 A;  2ADE A;  3D60 A;  3R67 A;  4AZZ A;  4CCE A;  4PVA A;  3WN1 A;  4N4B A;  3UGG A;  5B6S A;  4UDG A;  4COT A;  3QC2 A;  3LIH A;  2EXH A;  4KC7 A;  3LV4 A;  5FLW A;  3C7F A;  3TAW A;  3WPZ A;  2AEZ A;  4AK5 A;  3NMB A;  2XQR A;  3WAT A;  5FMC A;  2QQV A;  1UV4 A;  5FK7 A;  3VSS A;  4O8P A;  2AEY A;  4O8O A;  5GLN A;  5GLR A;  3U1X A;  4KCA A;  2YFS A;  3BYN A;  2QQW A;  3R4Z A;  3WPU A;  3OSD A;  5FIX A;  1YRZ A;  3R4Y A;  2B4W A;  5A8C A;  3QEF A;  3OM5 A; 
#chains in the Genus database with same CATH topology
 4RS5 A;  3OD4 A;  3LB9 A;  2OPW A;  4J1W A;  3ZXF A;  3WDV A;  5BNO A;  1AL2 1;  5FYU A;  1ZYB A;  3AKS A;  2GAL A;  5JSP A;  1QJU 3;  4YM3 A;  4IEU A;  3VD4 A;  2Z4F A;  3BPS A;  1CD3 G;  4W8J A;  4QPW A;  4D0Q A;  1SDD B;  3C7O A;  1W18 A;  3VZO A;  3ZN4 A;  2ZGM A;  4A6S A;  5FZH A;  4QM9 A;  4AWD A;  2IZW A;  1GQH A;  5AC9 1;  1LEN A;  3GZT B;  1A6C A;  4GH4 B;  3AJZ A;  3VKM A;  4XF3 A;  2R06 1;  1HDK A;  4TXW A;  4ASK A;  5JPM B;  1FAT A;  1U5X A;  4Y1X A;  2VO5 A;  2YGL A;  2BU9 A;  3I3Q A;  2ZEW A;  1SHW B;  3T4V A;  4YFZ A;  1OKO A;  5A3L A;  2GC1 A;  2G1M A;  3KB5 A;  4CCC A;  1QQP 2;  5FZM A;  5HCA A;  4LKS A;  5IAT A;  2GMP A;  1IG0 A;  1MAC A;  3NV1 A;  4O8N A;  3IB3 A;  1W39 A;  2WNU A;  5C0P A;  1MZE A;  1DGL A;  4YAR A;  5BNN A;  1P8J A;  1YCI A;  4G9S B;  5A7P A;  1DLL A;  5J36 A;  3WF1 A;  2HWC 3;  4P08 A;  4QKD A;  3ZPO A;  2V5D A;  5FOB B;  5IVB A;  2P37 A;  3TAY A;  3WPY A;  1BQP A;  4IV3 C;  3WD5 A;  4BQX A;  3AM2 A;  4XEZ A;  4Y1V A;  4CEW C;  1I3H A;  3J8F 3;  1DYP A;  2ZZQ A;  3NAP B;  5JIU A;  1W8Z A;  4UYB A;  4PI0 A;  3VZL A;  2DBI A;  1RUI 1;  1I5Z A;  2OZ6 A;  1JZ8 A;  3F2Z A;  1QXP A;  3IM0 A;  5EYY A;  1J83 A;  4YW5 A;  4COW A;  2WFF 3;  2Q8C A;  1QJX 3;  1ZM1 A;  4ZS3 A;  4OVE A;  1FI2 A;  2I2S A;  1F5F A;  2E33 A;  2H6C A;  2D40 A;  3A4U A;  4K20 A;  4FXG B;  4E9K A;  3UKN A;  3I2I A;  4WVV A;  1RUH 2;  5E89 A;  5EJ3 A;  1HRV 1;  1JHJ A;  3ZSL A;  1Z7S 3;  4ZU5 A;  4QM8 A;  3SH4 A;  2FDF A;  2Y64 A;  5JI9 A;  5F32 A;  3AKF A;  3BYK A;  4E4Z A;  5EJZ B;  2WZR 2;  2Y8K A;  5GLZ A;  4ATE A;  1LOB A;  3KS7 A;  2HBT A;  1OVP A;  5JUV A;  4IER A;  3WX5 A;  1DBN A;  1ONA A;  2X8K A;  3A21 A;  1B35 A;  4LBO A;  1BVP 1;  2NM1 A;  2VUL A;  2ES3 A;  2PQQ A;  3HBK A;  5CAZ A;  5JZG B;  2GC0 A;  5DAQ A;  5ABJ C;  3AFG A;  3CZU A;  4YVS C;  4IQP A;  4KGQ A;  4AFM A;  4UDJ A;  2V72 A;  1EPW A;  2VCB A;  3MIB A;  2WSU A;  1AUY A;  1H2L A;  1V00 A;  2E9Q A;  2HWD 1;  4AHY A;  2WLQ A;  1OI6 A;  5FP4 A;  4WM8 A;  3D60 A;  2B46 X;  4O7X A;  5A32 A;  5IWF A;  5F8P A;  3GF6 A;  4M3C A;  3ACF A;  1JZ6 A;  5F3C A;  1QF3 A;  2NMN A;  4U36 A;  2WQZ C;  1AVB A;  3VUO A;  4LK7 A;  2B9V A;  1NCQ A;  2MPF A;  3TBD A;  1OD3 A;  1SZB A;  4H7L A;  2VR4 A;  2WNV A;  2Y38 A;  5GLR A;  4JC1 A;  4I0W B;  1S0B A;  2YU2 A;  1OOP C;  4AI8 A;  1XU1 A;  2ZOE B;  1EV1 3;  3E5X A;  4ISR A;  1WMD A;  1H8T A;  2D5H A;  1WCQ A;  4XMI A;  3I49 A;  1KS5 A;  1TQ5 A;  3M7A A;  1PGW 1;  3PVE A;  1LR5 A;  2RMU 2;  4PIX A;  2FQP A;  5IAV A;  3KT1 A;  2HWB 2;  5FZ9 A;  4UFK A;  1QOT A;  1UAI A;  4MGS A;  3SCH A;  3U0Z A;  3GCX A;  1L3J A;  5BV6 A;  5GZE A;  4CXW A;  4F83 A;  2VW1 A;  3WNP A;  3PTY A;  4RD7 A;  3N9O A;  2VTX J;  1XNK A;  4GWI A;  3R4U A;  2AGS A;  3LD8 A;  1BHG A;  2BNN A;  1COV 1;  5A33 B;  4ZU4 A;  1LGN A;  1IS6 A;  1W2A X;  2ZGN A;  3LIG A;  4FFI A;  3ROU A;  1VBC 2;  2QUO A;  2VW2 A;  3AP6 A;  4Y26 A;  4EZ4 A;  3VGI A;  1SFN A;  4EN8 B;  3LPG A;  2JXA A;  3D5Z A;  3B01 A;  4RFT 0;  1Y9G A;  1SLI A;  5CAD A;  2E26 A;  5FXX A;  1ENQ A;  1TL2 A;  4V2V A;  4Q4Y 1;  3T09 A;  1HQL A;  1IPK A;  2RS3 3;  2FZ1 A;  1LOE A;  1POV 1;  2VOW A;  1WA6 X;  2RS1 3;  3IDE A;  3WNO A;  4CDU B;  2WT2 A;  3V56 A;  4COZ A;  4XXA A;  3GDB A;  5A6Y A;  2R07 1;  3UL2 A;  1RED A;  4DUX A;  2YFZ A;  5DAX A;  4YZ3 A;  2ZGR A;  3QEE A;  1CIW A;  3VLB B;  4PI2 A;  1F15 A;  4G4F A;  1YI9 A;  2XG3 A;  3U14 A;  2DFB A;  1S0F A;  3EB7 A;  1M06 G;  1HLC A;  4XUN A;  1X36 A;  1RVF 2;  5C4W A;  1AX0 A;  1EPZ A;  4DY3 A;  1BK1 A;  4QDS A;  2FDJ A;  4MHU A;  2SLI A;  3AVS A;  4CUB A;  5GZG A;  5I0S A;  3A0K A;  5DPN A;  5JPN B;  4JGZ C;  1CES A;  1SPP B;  1WBL A;  3GZE A;  4XJ8 A;  4BIO A;  3S57 A;  2WN2 A;  2E7Q A;  5HV0 A;  3DYO A;  2XBO 2;  4IV1 A;  1FV3 A;  4MH0 E;  4RYD A;  2TUN A;  2GC2 A;  2ZZJ A;  1VMH A;  4OZX A;  1PK6 B;  2C1F A;  5SV5 A;  5BNP B;  2H0B A;  2ORX A;  4XDP A;  3ZR6 A;  4AQ2 A;  1O3R A;  4MET A;  4Q5O A;  4BH9 A;  1KEX A;  4LO7 A;  5J96 B;  2QQU A;  1ND2 A;  4Q0S A;  5AVP A;  3EBR A;  4C0H A;  2GAU A;  5K8S A;  3MEP A;  1B09 A;  1OH3 A;  4RHV 3;  2JDN A;  4ASL A;  2Q1M A;  1RXG A;  3HNY M;  4P00 B;  4LTA A;  4MZU A;  4CDW C;  3I3D A;  5A7O A;  2WJS A;  2ZX4 A;  5DDJ 3;  2VE1 A;  3T1M A;  3UGG A;  1YWK A;  2JIJ A;  4IEZ A;  3QC2 A;  2FMY A;  4GZ9 A;  3RZH A;  2CWS A;  4P5H A;  2XVG A;  4TTG A;  1IQA A;  2B9U A;  4JZR A;  1GP6 A;  4CCJ A;  1W6Q B;  1PO2 1;  2R7E B;  4P14 A;  5C33 A;  5GZF A;  4OFG A;  4B4R A;  2W52 A;  3WP4 A;  2B39 A;  4YM1 A;  2W46 A;  1PZ7 A;  1D2S A;  3N9M A;  3VZM A;  4Q0V A;  4CDQ B;  1TZO A;  1RUC 2;  1S2E A;  2YMZ A;  5C5T A;  5CG8 A;  3R4Y A;  3GZU C;  5T52 A;  1UOB A;  3RZK A;  4H7M A;  1WD3 A;  2VMC A;  3D82 A;  3SKJ E;  5FPV A;  4YZ5 A;  4LIT A;  4QQP A;  4NHM A;  2E6V A;  5DQ0 A;  3UNP A;  2MEV 2;  1W6O A;  2GND A;  2V09 A;  2W0X A;  1IQD C;  1HRI 1;  1IG3 A;  1MZ5 A;  3POF A;  3BTY A;  5C8C C;  4B1M A;  1O4T A;  1V6M A;  3NQH A;  3MW4 A;  5A3U A;  3WNK A;  4WV8 A;  4O65 A;  3D61 A;  1RUG 3;  1SLA A;  1AXK A;  3CU7 A;  2ARB A;  4DFS A;  1EY2 A;  2IXL A;  4FT8 A;  5T50 A;  5I93 A;  2XKP A;  2XLF A;  2J42 A;  2QZ3 A;  3AKI A;  1W8U A;  1JYW A;  2GDF A;  2XJU A;  5G05 L;  3I2K A;  2WC2 A;  5J09 A;  1JZ7 A;  3N9L A;  5FUP A;  4AF9 A;  5FPL A;  2BOI A;  3AZZ A;  2PYT A;  5FP9 A;  1ZBE 1;  2RDR A;  3CO2 A;  4OI1 A;  3NNG A;  4B8E A;  4AI2 A;  4PJY A;  2Q8E A;  1S0C A;  2CWM A;  1RIR A;  2JE9 A;  3LDR A;  3OG2 A;  4RFR B;  3VSZ A;  4PBO A;  3B00 A;  1OFS A;  1RUD 1;  1GIC A;  3DYP A;  5FO8 B;  4CUC A;  3OM2 A;  1ULO A;  1GNY A;  1MEC 1;  1WD4 A;  2ZPX A;  3ZFF A;  4BOW A;  3BU0 A;  2P1B A;  4OQ8 A;  4Q0P A;  5DG1 A;  4AI3 A;  4AOC A;  3N7L A;  4QMA A;  5FWJ A;  1TVG A;  2WA3 A;  4CEY A;  2VZU A;  5C9A A;  1D0G A;  4Q4X 3;  4LO8 A;  2JDU A;  5A7V B;  4B3N A;  3VD5 A;  1PVC 1;  2WWU A;  1PNF A;  5CFD C;  2ID4 A;  3I3B A;  1UOF A;  3GHM A;  2DCY A;  3W5M A;  4BE3 A;  1RB8 G;  4E4D X;  2BZD A;  2VZT A;  1LED A;  2B42 B;  1UIK A;  3VT1 A;  2D98 A;  4HVQ A;  3IWZ A;  3N4M A;  2YFU A;  1QJY 1;  4QDQ A;  4AVT A;  4XJU A;  2BW8 A;  3E97 A;  2QQJ A;  1X8M A;  2PEL A;  4QGN A;  5FV3 A;  2IWG B;  4COU A;  2Y6J A;  2D3R A;  1PO1 3;  1PIV 2;  3FUO A;  3U37 A;  3I59 B;  1WA4 A;  2Z2S B;  3AK0 A;  3PU3 A;  4MOA A;  2VVF A;  3I8T A;  3LSE A;  1RL3 A;  4ONZ A;  3T2T A;  1QJZ A;  3NV3 A;  3THD A;  2ZAH A;  4IUG A;  3JQX A;  3CJI C;  1H9W A;  1W99 A;  2XJP A;  5CA6 A;  1EAH 2;  3E1F 1;  1EUU A;  3OGV A;  1WCU A;  1WLW A;  5F6K A;  1TNR A;  4Q4Y 3;  1W2N A;  4LBL A;  4RGG A;  3GBG A;  3BPZ A;  4XFG A;  1ZBA 2;  3DPR C;  4MGZ E;  2V73 A;  4UDK A;  1WUV A;  3KLS A;  4IE4 A;  4RR3 C;  3VBS C;  1BXH A;  2P17 A;  3M2M A;  4WM7 B;  1BYH A;  1NE4 A;  2WZ8 A;  1ENS A;  5JI7 A;  3RZM A;  2A3X A;  3ZYR A;  1DCS A;  2Z69 A;  5FYH A;  4IDZ A;  3MIG A;  3BCW A;  5FYZ A;  3TAW A;  4JGY C;  4BWO A;  3EJK A;  2BEO A;  2WS9 1;  2R6Q A;  2Y6K A;  5GJ6 A;  2ATF A;  1X7N A;  1UYY A;  1QOS A;  3W9A A;  3U1X A;  1VBB 2;  3CQO A;  4KCA A;  1O3S A;  3R4Z A;  2ZX0 A;  2W1S A;  4BU2 A;  3OSD A;  1DFQ A;  3MLK A;  3ZYF A;  4MX3 A;  2BUK A;  5T5O A;  1QJU 1;  3Q9O A;  3RFR A;  5DUU A;  1ALY A;  2YU1 A;  4H14 A;  5JDB A;  5LRS A;  1CWP A;  3AKH A;  2WUH A;  3OGS A;  1S4C A;  2HEY F;  4CCO A;  5F9T A;  4B29 A;  1FNZ A;  4PQQ A;  4OYU A;  5L19 A;  3I4I A;  1WL7 A;  4QHO A;  3BKZ A;  5FOJ B;  3ENR A;  4URA A;  5K9Y A;  4PIZ A;  1OQ1 A;  1GYK A;  4A45 A;  3BOP A;  5DN2 A;  2D3S A;  3ZMN A;  4AAX A;  1SLC A;  1ULG A;  1DGW X;  1CAV A;  5FYB A;  4W4Z A;  5DZG A;  2V4V A;  3M3O A;  1YI7 A;  3EO6 A;  4PLN A;  4X8N A;  1OA4 A;  2JG8 A;  4CP0 A;  5C6C A;  5ACA 1;  3WN0 A;  1W8H A;  2EIC A;  2VMG A;  4U6D A;  2HEV F;  1JW6 A;  3WDW A;  4FPF A;  5JXI A;  2R49 A;  3HPN A;  3L9J T;  4PF5 A;  3BYJ A;  2ZGU A;  1PNG A;  4O9E A;  2HWC 1;  4QPI B;  5GLQ A;  4L2N A;  2JDH A;  5GAL A;  3ZLI A;  1V6L A;  2B8M A;  3QOP A;  1W9F A;  4FPK A;  1LOC A;  3T0A A;  4FBF A;  3ETP A;  4Q29 A;  1W6P B;  4OI4 A;  3V0B A;  1W03 A;  4YGB A;  2FDG A;  1ND3 C;  4JRA A;  3S30 A;  1D4M 2;  5L7O B;  5CNA A;  1R1A 3;  2Y6F A;  4DZG A;  4KBB A;  4NPR A;  4R4X A;  1QJX 1;  4Q0U A;  4DOU A;  3LKJ A;  3WG1 A;  1OUR A;  4XBN A;  2W95 A;  2W1Q A;  3I97 A;  4Q8K A;  4XFB A;  3VBF A;  4CCL A;  1HXS 3;  3S0M A;  5DMY A;  4QPG A;  1ZZB A;  5IJR A;  1VPH A;  1GOG A;  1Z7S 1;  3H0O A;  2WQ8 A;  5A6Z A;  4XJ9 A;  2PHL A;  3DUI A;  3ZXL A;  4DB5 A;  5KXC A;  1Z78 A;  3WQ0 A;  4RS5 C;  1DIW A;  3VBH A;  3GGL A;  2ZHN A;  4N7U A;  3NJX A;  5BNO C;  3NJZ A;  4ZZ5 A;  1W9Y A;  1UPI A;  1DLC A;  1XOY A;  1MVE A;  2O1Q A;  2RJK A;  2WT1 A;  3LCP A;  1G8W A;  1UX6 A;  3HOB A;  1RHI 3;  3AKG A;  5J98 B;  3DL3 A;  3Q8A A;  2A75 A;  2EA7 A;  4JCK A;  1UZV A;  1SAC A;  2JB8 A;  1N47 A;  5E88 A;  2JIC A;  1KXG A;  4XQW A;  2VCA A;  1KIT A;  1UMH A;  1NCR B;  4M4R A;  4N8M A;  3BOW A;  4HBN A;  2HJI A;  4Z8B A;  3VHP A;  2PTM A;  5IVY A;  1DQ4 A;  4MSV A;  5EZW A;  3WNX A;  4N2R A;  4LPL A;  1MZF A;  3PLQ A;  3OPW A;  4NE9 A;  4QWN A;  2ZEY A;  4BM8 A;  4I01 A;  2UWB A;  3VZJ A;  1EUT A;  2OQ7 A;  2ZMK A;  4LHL A;  4YW4 A;  5FYI A;  4HFS A;  1RIN A;  4YW1 A;  4BDV B;  3C8X A;  2BWA A;  1E5H A;  1SDW A;  2AZ5 A;  3ALQ A;  3DKW A;  1HQW A;  3EXU A;  2WNU C;  3VKN A;  4FAH A;  5B2G B;  3K4Z A;  1SEF A;  3PVO A;  2YY1 A;  3AMH A;  5BNN C;  4QD2 A;  5I0D A;  2XQR A;  3E5U A;  5FPZ A;  4ARY A;  1EV1 1;  2QQV A;  1REE A;  4HET A;  2P6H A;  1UU6 A;  1XSQ A;  2A6V A;  1AL2 2;  2VZS A;  2ZGL A;  2ET1 A;  2BBV A;  1CAU A;  4GUL A;  2BP6 A;  4N43 B;  1MQT A;  3V65 A;  5F5C A;  1T2X A;  1FPN 3;  5LW9 A;  3JB4 C;  1OA3 A;  5D8A B;  5IFT A;  4XF1 A;  1OVS A;  5AC9 2;  2RV9 A;  1VAK A;  1O3Q A;  2FCU A;  2HYX A;  3MIF A;  4AED B;  1NA1 B;  4NWW A;  3JUU A;  1STM A;  1F5J A;  3AMN A;  4Y22 A;  5F5Q A;  1YQ8 A;  2BDR A;  3WAU A;  2VBD A;  2F4P A;  3DXT A;  2VGD A;  2E53 A;  4XF9 A;  1SMV A;  4AHW A;  1W2O A;  3FL7 A;  1E5S A;  3M3Q A;  4HSL A;  5FO9 B;  1O3T A;  4XDO A;  1HB3 A;  2OUJ A;  5LB6 A;  1CZS A;  1LB2 A;  3MPB A;  1B35 C;  2EXJ A;  1NZI A;  1VAM A;  5FZL A;  2NLR A;  3JXS A;  4IES A;  4LBM A;  3KST A;  2RS3 1;  1PGL 1;  1GNH A;  4XBQ A;  3H8X A;  4Y20 A;  2RS1 1;  3VBO B;  1QJE A;  3D5Y A;  3MFA A;  3B7M A;  1WWY A;  3TOJ A;  4GMP 0;  2PHX A;  4BK5 A;  3WXP A;  3VKO A;  2YFR A;  1RUI 2;  2R32 A;  1PX4 A;  1VIW B;  4YM2 A;  4WM8 C;  2D7F A;  1G6N A;  2VM9 A;  2WWS A;  5L36 A;  4CDX A;  2LRP A;  3H9A A;  3KMH A;  4OMC A;  4YGE A;  5C2M A;  3K51 A;  2P3Y A;  1GZW A;  3WDX A;  4DUW A;  4ZU7 A;  1CJD A;  4QGM A;  3VBR A;  1NCQ C;  1XNC A;  2BYV E;  3CDZ B;  4B7K A;  2OW4 A;  5LCW L;  1R08 2;  3MUY 1;  5F2S A;  1DZR A;  2WNV C;  4AHX A;  3MIC A;  4QB6 A;  3K1U A;  3OM6 A;  2QTW B;  2R0H A;  3IAP A;  1OUX A;  4N9I A;  5AFE A;  3ACI A;  1V6O A;  3AP7 A;  3QBQ A;  4GKX A;  2G4I A;  4KWJ A;  1UW8 A;  4HT1 T;  1H8T C;  2KM2 A;  3C2U A;  2OVU A;  2AAC A;  2OX0 A;  1RMU 2;  2VAU A;  3IIA A;  1LAJ A;  3W59 A;  4LKD A;  1L7L A;  2VQ0 A;  1KDM A;  1AR7 2;  1UXX X;  1XE0 A;  2WZR 3;  4LBN A;  4EWA A;  1YFY A;  2CU5 A;  3N35 A;  1O4Y A;  2DCK A;  2D6M A;  2YDE A;  4ZPI A;  5C8W A;  4Y3O A;  2FCT A;  4Y4R A;  4HAN A;  4PDW A;  4BQW A;  2HWD 2;  4FTE A;  2P4E A;  3FWE A;  2J7M A;  1J3R A;  4CPB A;  1Q8V A;  4RHV 1;  3VDD B;  1SBF A;  2BVB A;  2QDN A;  5FZO B;  1W8T A;  5A8D A;  1JN2 P;  2VU9 A;  2B7Y A;  4JQR A;  1Y9Q A;  1URX A;  1QWR A;  3WHU A;  2TEP A;  2VG9 A;  5F1R A;  1Q8Q A;  1WLC A;  2VQA A;  1WW4 A;  5DDJ 1;  5K0U A;  2YGM A;  3H7J A;  1DQ0 A;  3O1M A;  2P3J A;  3FJS A;  3OBT A;  4QDR A;  4AGR A;  5BYN A;  1OXC A;  1QH6 A;  1RUJ 2;  3LOI A;  3T0D A;  1AR9 2;  3OPZ A;  4HKW A;  4CP9 B;  3NW4 A;  5KXE A;  1H2N A;  4QQO A;  2PAM A;  1ZRE A;  2A6X A;  3BGA A;  3H3Z A;  2X05 A;  1QJY 3;  3RJ2 X;  1ULD A;  1PGW 2;  4LMF A;  1H4G A;  4P9Y A;  3SIT A;  1LGC A;  1UY4 A;  3PVN A;  2YFS A;  3B69 A;  3KGL A;  4DQA A;  5FLH A;  4D6Q A;  2MNG A;  2ERF A;  4IET A;  4N53 B;  5J7M A;  3OM5 A;  2RMU 3;  5LK5 A;  5C4W C;  3D4K A;  5C5U A;  1GYH A;  3T2O A;  2YBS A;  2DTW A;  2VTF A;  5IK8 A;  1GLH A;  3BI3 A;  4R4Z A;  1X50 A;  1AR8 2;  2UYA A;  4IGP A;  1RUG 1;  5F5A A;  1LGB A;  4MLG A;  5FZG A;  1XJA A;  2WQ4 A;  3KV5 A;  3ACL A;  4UOJ A;  5FQ0 B;  4IV1 C;  3VT2 A;  5CFC B;  4JKM A;  1VBC 3;  3LDK A;  4V1P A;  2BRT A;  2VMF A;  1GWM A;  1LOA A;  1OLQ A;  3FBM A;  5I0R A;  1D4V B;  3WUD A;  1S0D A;  1HKD A;  3MF6 A;  4NN0 A;  1XBF A;  1ND2 C;  3O1R A;  2X8S A;  1V6K A;  1W6N A;  4CXX A;  1ASJ 1;  4FPJ A;  4MV2 A;  1A8M A;  1CZV A;  3N36 A;  2VNO A;  5CIR A;  1WMF A;  2DUP A;  3T2P A;  1CAX B;  4GQ7 A;  4P9J A;  1UY3 A;  4IE7 A;  4OI0 A;  3C7G A;  1BMV 1;  2Y34 A;  4CYD A;  1CZT A;  1UMI A;  2D6K A;  3TN9 2;  3K3N A;  3FBY A;  3ZN6 B;  2FZ2 A;  3AP9 A;  2RVA A;  1OMI A;  3M3E A;  2JDM A;  4Q4X 1;  5T5L A;  2W2I A;  1XE8 A;  1Z0H A;  3PUA A;  2XWJ B;  5FLJ A;  4EZH A;  3MPP G;  2FMD A;  1UY0 A;  3NNM A;  4E8C A;  5J1X A;  2W1W A;  1O5L A;  5FMO S;  1RVF 3;  4BB3 A;  5BY5 A;  4NRO A;  4CSW A;  1VBA 3;  5JR2 A;  4LKE A;  3AL6 A;  4ZKT B;  2X5I C;  3VBU A;  2JEN A;  1WZX A;  3DKQ A;  5F39 A;  4BYY A;  2VVE A;  1PO1 1;  1JZ3 A;  1G9B A;  2XBO 3;  4YFW A;  1GR3 A;  2ZCW A;  3VSR A;  1JU3 A;  4RQP A;  3OM7 A;  5ACA 3;  1YIP A;  3PNA A;  4IGO A;  2WZP P;  3VKF C;  3PDQ A;  3ZYJ B;  4CE8 A;  4D47 A;  3RRD A;  1W0P A;  2HBU A;  1LU2 A;  2VOX A;  5IUQ A;  3UJQ A;  3P3P A;  1OLR A;  1CPN A;  2RM2 1;  1JOP A;  2CDP A;  2ORZ A;  2QQI A;  1VBD 2;  3MIE A;  3HR9 A;  3A0N A;  3ES1 A;  4IEV A;  4XUQ A;  5GZC A;  5KC6 A;  2WRA A;  4PVI A;  1POQ A;  3KV9 A;  3MW3 A;  2WIN B;  4XTP A;  3HNB M;  3PIG A;  4FPC A;  5A1L A;  5FK8 A;  4QPY A;  4AGG A;  2P34 A;  5A80 A;  2BWC A;  2YXS A;  2JE8 A;  4GAZ A;  2MHF A;  4MXW B;  3O5S A;  5GLT A;  1F8V A;  5HXM A;  1RUN A;  2BGO A;  5HBA A;  1UYX A;  1JH5 A;  1YHF A;  3ME2 A;  1VLN A;  5A3W A;  4CUA A;  4CCE A;  4IV3 B;  3CMG A;  3WN1 A;  4KI5 M;  5IK5 A;  4CEW B;  2E32 A;  5J48 A;  4P9G A;  1G86 A;  2R1B A;  1ODN A;  4COT A;  1ZNP A;  1BK0 A;  4OQ9 A;  3Q8B A;  1SLT A;  4QU2 A;  1QXR A;  4A6O A;  3PUS A;  4XJA A;  5FMC A;  1F31 A;  3URF A;  3ZFF C;  2XJS A;  4NPM A;  3T0B A;  5A7W B;  1R09 2;  1RUC 3;  1FNY A;  2YC2 A;  5C7G A;  1W06 A;  3JB8 A;  4CU9 A;  1YNA A;  3B9C A;  3DXU A;  4CEY C;  4WVM B;  1ZA4 A;  3MI8 A;  4Y1Z A;  5C9A C;  4XTM A;  1R64 A;  3FLR A;  5E16 A;  5FJH A;  1H8V A;  2UWA A;  4QKB A;  4LUM A;  2MEV 3;  4H55 A;  4ORF A;  1JYN A;  3O1P A;  3I3M A;  5AYE A;  1I9R A;  3LA2 A;  3NNJ A;  2EF6 A;  4PT6 A;  4XVH A;  2WLP A;  1J84 A;  2JD9 A;  4Q4V 2;  4AW7 A;  1AZD A;  1NXD 1;  2N7G A;  3ZFE A;  2NZ9 A;  5CKQ A;  2XVK A;  5ABJ B;  4AVB A;  4YVS B;  3LGR A;  4DXZ A;  1ZBE 2;  2ZGP A;  5KHJ A;  4KC8 A;  2JKB A;  3CNA A;  4YVW A;  1FV2 A;  3LA7 A;  2DWR A;  3SKV A;  5EFU A;  2R16 A;  1DZT A;  3D8C A;  1SFP A;  3AZW A;  1YO8 A;  2JG9 A;  4XW3 A;  3V0A A;  2ENR A;  3ZMO A;  3ZVX A;  4KU7 A;  1HV1 A;  1O6U A;  2PHR A;  4IEO A;  2W1U A;  1AYM 2;  4M0H A;  4J25 A;  2W94 A;  2A3W A;  2ET7 A;  5FP8 A;  1UZY A;  3ZKY A;  4CZS A;  3AMM A;  1KFU L;  1R1A 1;  3NJV A;  3GNE A;  4B7E A;  1G9F A;  4HK8 A;  4Q1P A;  3DV8 A;  1OLM E;  4IEP A;  2RR1 2;  4XAE A;  1OOP B;  5FZ4 A;  1RUE 1;  2E7T A;  1C8M 1;  3KF5 A;  3P3N A;  1HXS 1;  2VZ3 A;  3GJA A;  4NHY A;  4DEV A;  1J3Q A;  4XFC A;  2R1D A;  5D2A A;  3ZFG A;  5B4N A;  5JCT A;  3M70 A;  2HWF 2;  4KL1 A;  5FFO C;  3PIJ A;  3IN9 A;  5FZO A;  1GFF 2;  1HQN A;  1ULF A;  2E51 A;  3AP4 A;  3HT2 A;  3ZXA C;  2WA4 A;  4BQ5 A;  4E8D A;  4EV0 A;  4UW6 A;  3WN2 A;  4C0B A;  1RHI 1;  1WCD J;  2OZJ A;  4YG6 A;  3G7D A;  1U5Y A;  1US2 A;  1S0G A;  5DZF A;  1AR6 2;  1PIV 3;  2B5H A;  5FJK A;  2VDT A;  3L2Y A;  2X09 A;  4XAB A;  1GMM A;  3UET A;  1W9W A;  1ZZ8 A;  3OUH A;  4LKF A;  3CKH A;  1TME 2;  4XFI A;  4YW7 A;  5EV7 A;  1IS5 A;  2BFU S;  1U5I A;  4NRM A;  2ZXQ A;  3BTA A;  5L9R A;  2PLV 2;  2DVB A;  4PBP A;  2NP0 A;  1J59 A;  1KJL A;  2I07 B;  1NQJ A;  1EAH 3;  1TNF A;  2ZS6 B;  1K12 A;  4FPH A;  4XZP A;  2RDQ A;  2VEC A;  3POY A;  4H3W A;  4LOS A;  5FP3 A;  4I3P A;  3CL1 A;  3QCW A;  2ZBJ A;  3JBG 2;  1ZBA 3;  1V6I A;  4HXC A;  4JKL A;  2OYZ A;  4ET7 A;  4YWA A;  1V9U 2;  5EPA A;  4N9H A;  3RWK X;  1W8O A;  1J1T A;  2JG8 C;  2IXJ A;  5FY1 A;  2Q5T A;  4IGQ A;  1FOD 1;  2BJS A;  2W87 A;  1H6Y A;  5CBL A;  3ZN5 A;  4JHT A;  3KVB A;  1K5M A;  3LFM A;  5T5P A;  5HCH A;  3WQ7 A;  2UU8 A;  1BBT 1;  2X53 S;  4GKY A;  3D5O A;  5FUN A;  4LK6 A;  4AZZ A;  1YC6 1;  5FYV A;  5B4X A;  1UO9 A;  1VRH 2;  2K9Z A;  1AYN 2;  2VZ1 A;  2XGX A;  3HWJ A;  4AQ6 A;  1AXY A;  2HKX A;  4P9X A;  2EXH A;  5FLW A;  5F6L B;  1BJQ A;  5I0T A;  4GB3 1;  1OBN A;  3ILF A;  1FPN 1;  3OY8 A;  1VBB 3;  3AKP A;  3RZL A;  2GH8 A;  1FMD 2;  2O8O A;  2UUR A;  4NOT A;  4UF0 A;  1C57 A;  5I0U A;  4OZO A;  4JGZ B;  4OHW A;  3PJQ A;  5CB7 A;  1WBF A;  4P9W A;  3VBF C;  4GA9 A;  4PHZ A;  4DIN B;  4V2W A;  4AFD A;  4QPG C;  2VZQ A;  5FPB A;  5IVV A;  4XIO A;  1DYO A;  2C26 A;  2P6C A;  4BQ3 A;  4OHV A;  2R30 A;  1E57 A;  2A71 A;  4WVZ A;  1X9P A;  4KCB A;  1Q43 A;  2IUW A;  4YW6 A;  3VBH C;  4JHZ A;  3JZV A;  4NOV A;  1X9T A;  2DVD A;  4QKN A;  3JU9 A;  4GIQ A;  4M3C E;  2LUW A;  5KWR A;  4S2F A;  1I5P A;  1ZZ6 A;  2HWC 2;  2QQO A;  4KMQ A;  4UBG A;  4UXA A;  5A1A A;  2XH6 A;  3IT8 A;  4R9B A;  4Z1V A;  5BNP A;  1W8W A;  3IPV B;  1PT2 A;  3LOB A;  5AYD A;  2ZGK A;  3B02 A;  4QT6 A;  5FYM A;  3OOX A;  4DPN A;  3J8F 2;  1ZA7 A;  1RGS A;  2PAK A;  5CVR A;  5A3N A;  4CDW B;  1OQD A;  4FPE A;  4GH4 A;  3T30 A;  5FRA A;  3ZYG A;  4PLO A;  4AAP A;  2ZHK A;  3VZK A;  4BPZ A;  4Q26 A;  4CCD A;  2NQY A;  1YJK A;  1MR5 A;  1GAN A;  4O61 A;  4FFG A;  5A7Q A;  1C1L A;  1JYC A;  2WFF 2;  1JU4 A;  2V4A A;  2ZAB A;  5LEK A;  4BMB A;  1YQC A;  3FC0 A;  4FI9 A;  4FOQ A;  4OCT A;  3WLU A;  3WW4 A;  1D4M 3;  4QXH A;  1KGY A;  3OYW B;  1ULC A;  1GNZ A;  1YFW A;  3WZ1 A;  4A44 A;  5JMC A;  1GOH A;  2XXZ A;  4UAP A;  4AVA A;  2OA2 A;  3F95 A;  4I30 A;  1FXZ A;  1OF3 A;  2VXR A;  2XML A;  5LA1 A;  3VSF A;  3HN1 A;  1Y3T A;  4AK6 A;  4QGL A;  1DZQ A;  2F4L A;  2E63 A;  1MQT C;  1NQD A;  2GU9 A;  3DEM A;  3NAP A;  2WZR 1;  4LOT A;  2DF7 A;  2XQX A;  4CU7 A;  1UWW A;  2PHD A;  3OB8 A;  5C8C B;  1W04 A;  2YV8 A;  1RUF 2;  4D8M A;  2RE9 A;  3OF1 A;  4HL0 A;  4QHB A;  5C3S A;  1TE1 B;  4IXL A;  2CDO A;  4AK3 A;  5IVE A;  1ASJ 3;  2Y0I A;  2BPA 2;  3PUH A;  1HW5 A;  3MHZ A;  2C24 A;  4AXO A;  2Q4S A;  5LWB A;  1JZ2 A;  2VCC A;  2VUC A;  3WW2 A;  4UW4 A;  1LOF A;  3WF4 A;  1Y43 B;  1DF0 A;  2P5B A;  1AF9 A;  2H0V A;  4LQR A;  3ZSE A;  1CAW B;  2TNF A;  5KBF A;  3WIN E;  4M0N A;  1K3I A;  1VBE 2;  3SCF A;  1AHS A;  3U4X A;  3RZZ A;  1N3O A;  1VKD A;  2LRO A;  5C70 A;  3IAQ A;  3USS A;  5BXX A;  1JYT A;  3MFC A;  5F2W A;  4DXT A;  1TG7 A;  5EQU A;  3BUC A;  3KZ4 C;  1H1M A;  5JZG A;  2QDR A;  3O0W A;  2W5F A;  2QZ2 A;  3E6D A;  1I1E A;  2EAA A;  1CGP A;  1W3V A;  3ZYH A;  4N4B A;  2W3J A;  3FHA A;  4COY A;  3FN9 A;  1V6N A;  5FZ6 A;  3WPZ A;  5BNQ A;  3LV4 A;  1SQ4 A;  1VMF A;  3BIW E;  4Y1Y A;  5CFD B;  2GSY A;  5JWP A;  4CP1 A;  2AH2 A;  3FMG A;  5FY7 A;  4CDX C;  1JYX A;  2RMU 1;  1W0N A;  4FCA A;  4HKO A;  4QXK A;  4YVS A;  3NV2 A;  3OD0 A;  5FLI A;  4F3J A;  2I74 A;  3VBR C;  3Q8E A;  4XET A;  2D43 A;  2EID A;  2VTX A;  2KD7 A;  4K6B A;  2RM2 3;  1CQ9 A;  1XPW A;  4ONU A;  3LQC A;  3WHT A;  2WO2 A;  2A3Y A;  3ES4 A;  2ZX1 A;  4AEJ A;  1WCK A;  4KBZ A;  2RS5 3;  3RYP A;  1JZ5 A;  5FXV A;  4PF1 A;  2XDV A;  3MIH A;  1VBC 1;  2R04 2;  3CJI B;  1SBD A;  3QD6 A;  3HT1 A;  4YLZ A;  4ZHN A;  3VD9 A;  5CIS A;  1A8D A;  5DZE A;  3CHX A;  3HN3 A;  2PHF A;  4HON A;  4IEY A;  4UW3 A;  3WG4 A;  2FDK A;  2AR6 A;  3ZM8 A;  4R9A A;  3PMS A;  1TMF 2;  2DUO A;  2DUR A;  3AB0 A;  5ANQ A;  3DPR B;  2EAK A;  2XPJ A;  3RI8 A;  4PDW C;  1GP4 A;  1R1Z A;  5GLO A;  2DUQ A;  4RR3 B;  3VBS B;  4XBL A;  4A41 A;  3LEG A;  2CL2 A;  1JBC A;  1Y7B A;  5HPO A;  5FPA A;  5A33 A;  3B5L B;  2HLE A;  5F37 A;  2VMI A;  3UYJ A;  1POV 0;  2BGC A;  1ODM A;  3ETQ A;  3R6S A;  5K0U C;  4TZD A;  4UFI A;  2GH2 A;  4JGY B;  3RI9 A;  3MLJ A;  2VY0 A;  3LF7 A;  1N3P A;  3U07 A;  1UD1 A;  3LWC A;  1W6M B;  4W6Y A;  4QXC A;  4UBH A;  3NL1 A;  3P2N A;  1NLS A;  1RVF 1;  1N1V A;  2WFP A;  3LSD A;  5LA2 A;  3H8O A;  1VBA 1;  4LIV A;  1H9P A;  3KHB A;  4XUO A;  5FKB A;  4CDU A;  1LHO A;  1PVX A;  1UYP A;  2VPV A;  1MVQ A;  3DYM A;  3I2D A;  4CVU A;  2XBO 1;  5C3R A;  2D6O X;  2XL9 A;  3K2O A;  4A3Z A;  3RQ0 A;  4AFB A;  3VD7 A;  4K9S A;  2XR4 A;  2O0O A;  1NY7 1;  1RMU 3;  5EP9 A;  4D6S A;  3WG3 A;  4XC9 A;  5H9S A;  1RUO A;  4D7S A;  1AR7 3;  2YFT A;  3OTF A;  3ORJ A;  4RL7 A;  3ZXD A;  4LXL A;  3FHI B;  3LA3 A;  2D6L X;  5FZF A;  5GLU A;  3BN6 A;  3IDC B;  1QEX A;  3ZDV A;  3GBF A;  4ATF A;  1SPP A;  4I0A A;  5DDJ 2;  4CTE A;  1LHU A;  4K1Z A;  3O14 A;  1ZRC A;  3AP5 A;  3N9Q A;  1HB4 A;  5JR7 B;  1DG6 A;  1OD5 A;  2LAL A;  3VB9 A;  3POJ A;  3E5Q A;  3OBR A;  1PK6 A;  2RDN A;  2DDU A;  4J1X A;  4Y5Z 0;  2C5D A;  1JZ4 A;  1YUD A;  2CAV A;  4JVA A;  4K40 A;  3UT0 A;  3RDI A;  4JRL A;  1UKG A;  1W90 A;  2K0G A;  3WP5 A;  1AJO A;  5FPU A;  2QFE A;  4O9G A;  3WQ1 A;  1RUE 3;  2WL1 A;  4OMD A;  1C8M 3;  1JYI A;  3EYP A;  3M3C A;  2HWE 2;  5FXZ A;  5GZD A;  2PHU A;  3WF0 A;  1OC1 A;  1UCX A;  1RUJ 3;  1AR9 3;  3B94 A;  4LBQ B;  1ND3 B;  3III A;  3S7I A;  1N3Q A;  4WZC A;  4R8H A;  4LUL A;  5EXO A;  2ZJC A;  3T3Y A;  2WYS A;  3WR0 A;  2VCM A;  4HPK B;  4LLF A;  5DAV A;  4WVW A;  1NLR A;  5AVA A;  1QOO A;  4BIF A;  1UIJ A;  2CSG A;  4UDG A;  1HIX A;  1RUC 1;  4DY5 A;  4E2Q A;  3POB A;  2W68 A;  3POI A;  1CX4 A;  2IVJ A;  4XAC A;  2YB7 A;  2IXC A;  4O8P A;  2YHJ A;  4GJY A;  4XYX A;  1GV9 A;  5H9P A;  2TBV A;  3WF2 A;  4BZ4 A;  1HB2 A;  3JD7 3;  1SG3 A;  2MEV 1;  2XL7 A;  2UYB A;  3U78 A;  2J1S A;  4RS5 B;  4PCR A;  3WG2 A;  2PQS A;  1W6Q A;  3BB6 A;  4CCN A;  5FTT C;  5JXH A;  1HV0 A;  4AR2 A;  4G3Y C;  1A3K A;  5BNO B;  3D0J A;  3RMY A;  3FHQ A;  4LHN A;  3QLQ A;  1KDK A;  4Q4W 2;  4NIH A;  5T3N A;  4CDQ A;  4Y5T A;  4J6G A;  4OUL A;  4L11 A;  3WMY A;  2VOK A;  4HN1 A;  3N3H A;  1BEV 2;  4MVT A;  4E27 A;  4XAA A;  4RQP C;  1FOD 3;  1LUL A;  1YIF A;  4XFH A;  5FMO L;  3I7D A;  3KCX A;  2OT7 A;  4XMA A;  1KS4 A;  2BNM A;  3DF0 A;  4BA6 A;  1BBT 3;  2DU1 A;  4MXV A;  4Q0Q A;  4PLM A;  3PTR B;  4E4H A;  3J9S A;  4HSJ A;  3GHN A;  4RA0 A;  4EYU A;  3MW2 A;  5D21 A;  2DVF A;  2FDI A;  4QX7 A;  2W92 A;  2XLA A;  4GB3 3;  4MGT A;  1VAV A;  2AYH A;  1HN1 A;  1UOJ A;  1JS9 A;  1WW5 A;  5C3O A;  3I2H A;  2WNU B;  3IMN A;  1HB1 A;  3LZZ A;  3M3I A;  2ZEX A;  3KT7 A;  2B45 X;  3KF3 A;  2Y0O A;  1AX2 A;  1N1Y A;  2RJ2 A;  3TN9 3;  1NUK A;  4HLT A;  4UFM A;  5BNN B;  5GM0 A;  1NAE A;  4ZXK A;  3ZYB A;  5JSO A;  2R06 2;  2VXJ A;  2YG0 A;  4AE2 A;  3H8U A;  4HN0 A;  4IL7 A;  4QHZ A;  1KQR A;  2GP5 A;  2VUJ A;  1OT5 A;  3GJB A;  3N7K A;  2XWB B;  4KG8 A;  1D0H A;  3RS6 A;  5JXJ A;  1LKN A;  2BV4 A;  3WDU A;  1K42 A;  4RGA A;  5DAB A;  2HH9 A;  5GLK A;  1J58 A;  1UKR A;  1F9K A;  4YYO A;  3NVC A;  2LS6 A;  4UI9 L;  3N9N A;  2ZHL A;  3CLP A;  3J26 N;  4BQ1 A;  4NID A;  4N90 A;  5K7P A;  1VAL A;  3SLI A;  2DV9 A;  3QH7 A;  4NHX A;  2G9F A;  1YQ5 A;  4YZ1 A;  1PIV 1;  1QQP 3;  2K46 A;  3TWI A;  2D93 A;  4S2G A;  5A7V A;  3UKV A;  1O59 A;  2EVX A;  2JX9 A;  4MGI E;  4CRQ A;  4URT A;  2PA7 A;  3K4D A;  3B9I A;  5JLV A;  4FPL A;  2CGP A;  1EAH 1;  4NAO A;  1JI6 A;  1Q8P A;  2YC0 A;  4KWL A;  1XC6 A;  4KWU A;  1BCX A;  4X8P A;  3BTZ A;  1O5U A;  1VBD 3;  3HBZ A;  4N2Z A;  1B35 B;  1S0I A;  1ZBA 1;  1XRU A;  1YQ2 A;  3ZFE C;  4E4S A;  5GLV A;  3DN7 A;  2J1E A;  1C5I A;  2WAO A;  2WKK A;  2X29 A;  5IVJ A;  5JOZ A;  3I59 A;  3NWK A;  4YVW C;  1HRV 2;  1Q5O A;  1BVV A;  3MYX A;  3QAC A;  4FFF A;  1W3X A;  4YG0 A;  3W20 A;  2QVS B;  3BYL A;  3WAS A;  1W2U A;  3PHM A;  1IHM A;  2IFR A;  3MV1 1;  4WM8 B;  1JXN A;  3J7L A;  3OPT A;  4GWM A;  5D1I A;  5K4L A;  3WW3 A;  5A32 B;  1LEC A;  5CKN A;  3APB A;  4M3C B;  1RUH 3;  4NWV A;  5F3E A;  1MS1 A;  2JEC A;  1LNS A;  3MBW A;  1ST8 A;  3SEP A;  4PVA A;  2UY9 A;  1VBB 1;  5FR3 A;  1H6X A;  1JTZ X;  1G9D A;  1NCQ B;  1NX9 A;  4FOY A;  2ARC A;  2JIG A;  2ZEZ A;  2JDP A;  4WM7 A;  3PME A;  4D3W A;  4KC7 A;  2WNV B;  3J7N A;  1N1S A;  2J1V A;  3RPQ A;  1R09 3;  2C4X A;  2A6Y A;  4AVV A;  4JV4 A;  2WAB A;  3DGT A;  1UV4 A;  4MGK E;  2VH9 A;  2AEY A;  2PN5 A;  3TEX A;  4EN7 B;  4O8O A;  1YJL A;  2ZGT A;  3INA A;  4NRQ A;  2ZGS A;  4P5Y A;  4M3C F;  5IK7 A;  3WVJ A;  1H8T B;  4FVV A;  1GQG A;  1SLB A;  2RDS A;  3ZFG C;  4LJH A;  4OHZ A;  4BXS V;  1PMI A;  4Q27 A;  5BUV A;  4XFA A;  2DCT A;  1HJG A;  3RMX A;  2YZ4 A;  1S2K A;  2GN3 A;  4DXR A;  3POS A;  3VL8 A;  1MS9 A;  2YUE A;  4YZ2 A;  2D6P A;  4Q4V 3;  5FZ7 A;  3VHO A;  2VMH A;  2X8F A;  5L9V A;  1RTV A;  2H6B A;  2D6N A;  3RYR A;  2J1T A;  3ZXK A;  3AXE A;  5A3O A;  3MZH A;  5DAW A;  1YFU A;  1LCL A;  4OHX A;  4W50 A;  2W91 A;  4ISQ A;  4E2S A;  4UT5 A;  4QX2 A;  2YBK A;  2WNO A;  4OUS A;  2BQP A;  4DEQ A;  5LA0 A;  1HJF A;  4YSF A;  3VDA A;  3X29 B;  4BQ4 A;  3CF6 E;  2W39 A;  1AYM 3;  4HKL A;  3ON7 A;  4MHR A;  1D4M 1;  5E8A A;  1HXS 2;  3H8R A;  4MG2 A;  1NXM A;  2GNM A;  4JKK A;  4Q8L A;  3TEY A;  3AX4 A;  1QJF A;  2HWB 3;  4XCA A;  2CYF A;  1COV 2;  2BFU L;  1K5M C;  2RR1 3;  2VUA A;  5HI0 A;  2XON A;  4IE6 A;  2EXK A;  2VD7 A;  3UJO A;  3C7H A;  4DXS A;  1OUS A;  4QPI A;  4XHX A;  2A6Z A;  3RGB A;  3ZR5 A;  1W6P A;  5I91 A;  5KHG A;  1W0O A;  2FD8 A;  2HWF 3;  2XJT A;  3RVH A;  4EQV A;  4FO9 A;  2Q8D A;  1YEW A;  3USU B;  3W58 A;  3ZO0 B;  5C4W B;  5L7O A;  3P1I A;  4N7I A;  1QDO A;  4BME A;  3SEE A;  1U12 A;  2R07 2;  5IT6 A;  1DQ2 A;  1VE0 A;  1AR6 3;  4MYE A;  5DXD A;  5FY9 A;  3ZPY A;  4A3X A;  1C4R A;  4RN5 A;  4IV1 B;  3BVC A;  3H1M A;  5GKA C;  3TRS B;  4XF0 A;  3TEZ A;  4M01 A;  2DTY A;  4LR4 A;  3NRU A;  1NKG A;  5A3T A;  5A70 A;  2ARA A;  4YM0 A;  3JCI A;  2XJR A;  5HXV A;  1YYN A;  2PLV 3;  1JMU B;  3AZX A;  4NIA A;  1Q56 A;  1IKP A;  1GOF A;  2P3K A;  3LEM A;  2ZX3 A;  2RG4 A;  1CVN A;  2VZV A;  3TNQ A;  1Y9M A;  1ND2 B;  5C3Q A;  4ZON A;  3JBG 3;  4BHP A;  1FT9 A;  3U11 A;  3UES A;  4XE9 A;  1V9U 3;  1XNT A;  3FE5 A;  1A78 A;  1UPS A;  1UU4 A;  3R4D B;  5GLW A;  2ADD A;  3THC A;  4LO4 B;  4QKF A;  3ZXE A;  4F7Z A;  5J37 A;  2GMM A;  1JOD A;  5KHK A;  4GH4 C;  4TLF A;  1DGR N;  1NCR A;  5EWS A;  3ILN A;  3H1W A;  1QNW A;  5JMO A;  1VRH 3;  1AYN 3;  1OLM A;  2EIE A;  4Y24 A;  1G7Y A;  3VHR A;  1QIQ A;  2DU0 A;  3WNM A;  3BAL A;  1IPJ A;  2PMW B;  2B4K A;  2WAA A;  5F5I A;  3VHN A;  3HQX A;  1XND A;  3H50 A;  3SHR A;  4NR1 A;  4IEW A;  4Z2A A;  1FMD 3;  3C7F A;  3OJB A;  4XOG A;  1CON A;  2W47 A;  2X5I B;  1W28 A;  5G04 L;  3O1S A;  3WAT A;  1PMH X;  2VNG A;  1QNY A;  3AKT A;  3Q8F A;  3CBN A;  2YC4 A;  3B93 A;  2GNT A;  1L7Q A;  4XQ4 A;  1GBG A;  3D6E A;  2RS5 1;  1APN A;  3K46 A;  1YRZ A;  1O91 A;  4QQ2 A;  3ZOI A;  4NJ4 A;  4SBV A;  4AHZ A;  3O12 A;  4N43 A;  1W6O B;  3FX3 A;  2XB6 C;  1LOD A;  2CGN A;  3NAP C;  4QXB A;  1PO2 2;  2JDK A;  1W9T A;  3PL0 A;  4R52 A;  5D8A A;  3MO4 A;  4ES9 A;  5M0T A;  1GYD B;  2ZKN A;  4XIK A;  2J1A A;  4FPY A;  3B3Q E;  3C3V A;  5CG9 A;  4L99 A;  5FMD A;  3FLP A;  4X6Q B;  2PAE A;  5IFP A;  4AED A;  4GXL A;  1NA1 A;  1QH7 A;  1M4W A;  3FFQ A;  4C1X A;  3WUC A;  4ERO A;  2XUE A;  3HQR A;  3SQO A;  2VJX A;  1LOF C;  3HNM A;  1WGP A;  3SC7 X;  1K45 A;  1OH4 A;  3ZSM A;  3O7O A;  1UN1 A;  2VBB A;  3K48 A;  1HRI 2;  5FY4 A;  3KWV A;  1J3P A;  4I3G A;  1WKY A;  5FY5 A;  2ZML A;  5JSR A;  4R9D A;  4QX3 A;  5LEJ A;  4NIG A;  4M4P A;  4YGC A;  3AYE A;  5I8Y A;  3WPV A;  5JZG C;  4HG6 B;  3UGF A;  5FZD A;  3ZFF B;  3RG0 A;  4ITC A;  5FZ3 A;  4P9I A;  1OQE A;  1R08 1;  3VBO A;  1GU3 A;  2OXB A;  4CCK A;  1ZRI A;  5A6Q A;  1LHN A;  4UDI A;  5EYX A;  1RYY A;  4LUK A;  1VR3 A;  4LO6 B;  4CEY B;  5C9A B;  2WO1 A;  1VRB A;  3MUZ 1;  1Q8S A;  4LLO A;  2WYF A;  4Z07 A;  4AQS A;  1JYV A;  1RMU 1;  4LHS A;  2XHN A;  4LA2 A;  4L8Q A;  1AR7 1;  4ZXE A;  1ACC A;  3VDB A;  2C9A A;  4K21 A;  1RUD 2;  1RUF 3;  4KG0 A;  1FX5 A;  1MEC 2;  1LRH A;  4AI0 A;  2JDZ A;  4NII A;  4D7T A;  4L0P A;  1S1A A;  4MGQ A;  4Q2F A;  4DUV A;  1FYU A;  3AKR A;  4XUT A;  5JOW A;  2GNB A;  3ZXG A;  1GWK A;  4HVO A;  1PM7 A;  1QDC A;  4FQ4 A;  1PVC 2;  5APA A;  3TNP B;  1A34 A;  2WNE A;  3THP A;  4AK7 A;  1OPO A;  1YFX A;  1Q8O A;  1LEM A;  3K3O A;  4Y1U A;  2XOM A;  4BCU A;  1VBE 3;  3ST7 A;  4Z92 B;  2SBA A;  2PHW A;  2IFW A;  1QJY 2;  1O8S A;  1RUJ 1;  3GCW A;  3AL5 A;  1AR9 1;  5FAX A;  4JTO A;  4DO0 A;  1XSR A;  4XJZ A;  2CHH A;  5A1F A;  3U10 A;  3VDD A;  1XU2 A;  5KHI A;  4UFL A;  4DMI A;  4AYU A;  4A7Z A;  5C71 A;  2O14 A;  1CN1 A;  3AYC A;  3I3E A;  4FP3 A;  1PZ8 A;  2E31 A;  4NRP A;  4S2H A;  1CIY A;  3R67 A;  1XYO A;  2UWC A;  3G6J B;  3ZDS A;  2QQM A;  3JD7 1;  2XVL A;  4FSJ A;  4M00 A;  4GJZ A;  4CP9 A;  4DS0 A;  4EN0 A;  1DQ5 A;  3IDA A;  3H7Y A;  5IK4 A;  4QAW A;  4AGV A;  2VMD A;  5A3M A;  2BER A;  3RJR A;  3MF9 A;  1DGR A;  4A2U A;  4CDU C;  3BIE A;  2I45 A;  4AQT A;  1AR8 1;  1OF4 A;  2ZGQ A;  3CJX A;  2QQW A;  5FZE A;  4ARX A;  1ULE A;  2ZA9 A;  4GWJ A;  2W08 A;  3NNF A;  5FIX A;  5FZB A;  2LW8 A;  3RNS A;  2LM3 A;  5EJ1 B;  3AJY A;  1WLD A;  2WS9 2;  1PX3 A;  1UZW A;  5FZ1 A;  2R04 3;  1US3 A;  2JEM A;  4N53 A;  1VMJ A;  1DGW A;  2PXJ A;  1ZX5 A;  4B4P A;  3O1U A;  3KD4 A;  3O0V A;  3PU8 A;  3OCP A;  3WCS A;  3WNN A;  1CAV B;  1W8N A;  1TMF 3;  3GAL A;  1NE6 A;  1QJU 2;  1SCR A;  3ABZ A;  1PMJ X;  5AYC A;  2JE7 A;  4U2A A;  4NHK A;  2JG8 B;  2K2S A;  3RYK A;  5FQ0 A;  2WDB A;  2VZR A;  3E6C C;  1VP6 A;  3NV4 A;  4UFH A;  2BVV A;  1PK6 C;  3TN9 1;  5CFC A;  3AMP A;  3SMH A;  4SLI A;  3KCC A;  1IS3 A;  2RHP A;  4C91 A;  3USU A;  5BNP C;  2F17 A;  1UU5 A;  4AEM A;  1VBA 2;  3S7E A;  3BTX A;  5JIA A;  5SV8 A;  1XQN A;  5AY9 A;  2YPD A;  3NO8 A;  5J3U A;  3V0B B;  4YG3 A;  3UKT A;  2F6B A;  3KV6 A;  3QZ4 A;  3FLT A;  1CAX A;  2PFW A;  5FRE A;  4XIL A;  3OEA A;  3SIS A;  4BQY A;  4FAG A;  1W2T A;  5ACA 2;  1NY7 2;  3M1H A;  4QX1 A;  1G9A A;  2OII A;  1QQP 1;  5F3G A;  3ZSJ A;  4BXF A;  1SBE A;  2WT0 A;  3VBF B;  3ZN6 A;  1JHN A;  2DCZ A;  1DQ1 A;  4XUR A;  3WP6 A;  3CU9 A;  2XLG A;  2VME A;  4QPG B;  4XCB A;  5HCB A;  1QMJ A;  3SXW A;  4AVS A;  4QQL A;  4NVP A;  1U5Z A;  3O1O A;  5IW0 A;  5BPX A;  5LAT A;  4YPJ A;  4MGY E;  1GP5 A;  2JKX A;  3O0X A;  1AX1 A;  1NT0 A;  1ULP A;  2ZKL A;  2HEW F;  4XQD A;  3VBH B;  4K8R B;  1Y4W A;  4D6R A;  5FBJ A;  3KGZ A;  3OBZ A;  3WDY A;  4JAA A;  1VBD 1;  3VN4 A;  2BBA A;  3WNL A;  1UYZ A;  1QJX 2;  1JUH A;  3AZY A;  4CDQ C;  2UY8 A;  1ZVF A;  1V0A A;  2WO3 A;  5E6H A;  3AMQ A;  4LOR A;  3OGJ A;  1RXF A;  1OKQ A;  4KMI A;  1NG0 A;  1XE7 A;  2IXH A;  2VUD A;  2JD4 A;  4OI2 A;  1RJ8 A;  2AEN A;  4LEJ A;  1Z7S 2;  4FTS A;  3RWN A;  1QY4 A;  4CXY A;  2Y6L A;  2CV6 A;  4GAL A;  4XJW A;  5KR7 A;  2IXK A;  3IMM A;  5JVV A;  3SCG A;  2X5I A;  1OYG A;  5JAX A;  1QXJ A;  2HWE 3;  4W6W A;  4YZ4 A;  1RUH 1;  5FYC A;  4XXP A;  4UWD A;  3CIH A;  3WV6 A;  2XUM A;  2QBX A;  3OM4 A;  1MZ6 A;  2C6S A;  5A7S A;  4IEQ A;  1L7R A;  5IAX A;  2IXI A;  3GM8 A;  4HMZ A;  5FXW A;  1RC6 A;  2DFC A;  3H42 B;  1R09 1;  2WBK A;  1E5I A;  1O8P A;  1YXW A;  4MXW A;  1H4H A;  2ZHM A;  5B6S A;  1UQX A;  2GN7 A;  4NAM A;  4QQH A;  3I2F A;  3LIH A;  2XKO A;  3M8L A;  2CTV A;  2JB4 A;  1CAU B;  2AEZ A;  4IV3 A;  4KWK A;  1LHW A;  1UNB A;  2YYO A;  1F2N A;  4NPL A;  1MQT B;  3KM5 A;  3TYJ A;  4CEW A;  1GZC A;  1X8E A;  4X6R B;  5FK7 A;  1KFX L;  3LEK A;  3PJY A;  1ZZ9 A;  4NMI A;  1IPS A;  1O7F A;  2VNR A;  2D3P A;  3K75 B;  3N7J A;  3KQ4 B;  3OGG A;  4KU8 A;  5HV4 A;  2Y33 A;  4Q4V 1;  4OUE A;  2WN3 A;  5FZ8 A;  1C1F A;  4EE2 A;  4Q4W 3;  5AFB A;  2Z42 A;  4LHK A;  2RJL A;  5A8C A;  5A7W A;  2X10 A;  4Y22 B;  3PVB B;  2YRO A;  1ZZC A;  2Q30 A;  1EV1 2;  2D44 A;  4WVM A;  5LRR A;  1BEV 3;  1UY2 A;  3NNL A;  2A70 A;  3HIF A;  1J1L A;  1NOV A;  3LDB A;  3WSO A;  2Y6H A;  4PQ9 A;  3OGR A;  4OLL A;  4QB2 A;  3ZIW A;  5CU1 A;  4PIY A;  1AJK A;  3HQU A;  2YBP A;  1VB2 A;  1AYM 1;  1AL2 3;  1RIT A;  4Z82 A;  4L92 A;  4IW3 A;  1HX6 A;  3HMY A;  5FZC A;  2QQP A;  1GSL A;  2JJ6 A;  4MAD A;  3WCR A;  4EWE A;  3VT0 A;  5LBC A;  5ABJ A;  2Q0A A;  4Y20 B;  5LY1 A;  2HWB 1;  4JDM A;  1KRI A;  1LTE A;  2G19 A;  4IE0 A;  4XF4 A;  2RR1 1;  5AC9 3;  5CEH A;  5FZI A;  4DIQ A;  2AC1 A;  4NHL A;  2PHT A;  4BQ2 A;  4U6B A;  4HVR A;  2VL4 A;  2R06 3;  2WSV A;  3H3L A;  3PUR A;  2J22 A;  4CCM A;  5GLL A;  4UFJ A;  2WR9 A;  3SH5 A;  2A5Z A;  2BOJ A;  3RZG A;  2W9X A;  2J1R A;  2L9L A;  4CDX B;  2HWF 1;  5DUW A;  5GLP A;  3E6B A;  1WME A;  4R9C A;  1NYW A;  3VKL A;  1IS4 A;  1GZW B;  2RS3 2;  3H1Y A;  1PGL 2;  3VBR B;  5T54 A;  2R0F A;  4GMP 1;  4WM7 C;  2RS1 2;  5FP7 A;  4ASM B;  1DYK A;  1EYB A;  3NKG A;  5DAP A;  1AR6 1;  1OOP A;  2VZP A;  3S5A A;  3KVA A;  1WLT A;  3LPF A;  4FOV A;  4AI9 A;  2EAL A;  3RZJ A;  5F7U A;  3IBM A;  5E1R A;  4AI1 A;  2BTV C;  1H0B A;  1TME 1;  4Y4Y A;  1GUI A;  3GZA A;  4F8A A;  1F35 A;  5A3P A;  2CY6 A;  3MGU A;  2PLV 1;  3O1T A;  3MLL A;  3AYA A;  3T1L A;  1VB4 A;  1GZT A;  3JQW A;  4LIU A;  4L9B A;  3H3U A;  2Q1F A;  1RUI 3;  2QJV A;  3VD3 A;  5IVC A;  1AXZ A;  3ATG A;  2WO7 A;  2IVI B;  2O8Q A;  3S5Q A;  2X8T A;  3JBG 1;  1SCS A;  1MS5 A;  3MV0 1;  4PDW B;  4TLG A;  4HZF A;  1O4Z A;  5LBE A;  4CP2 A;  1V9U 1;  1G9C A;  4XFF A;  3A22 A;  4UW5 A;  2AUY A;  3WT3 A;  5DUX A;  5IYY A;  5JOY A;  2VNV A;  3MID A;  1HRV 3;  1H1I A;  1R08 3;  3J7M A;  2FDH A;  2GME A;  5K0U B;  2GP3 A;  4CPB D;  3EQE A;  4YRD A;  5EIY B;  3CZJ A;  1H1A A;  1VRH 1;  1AYN 1;  1F4H A;  5FMB A;  4I2O A;  2D97 A;  5H9R A;  2VW0 A;  5LZ6 A;  3POE A;  1NLQ A;  3C7E A;  3W5N A;  2WZE A;  4CA9 A;  3WW1 A;  1LU1 A;  1PM4 A;  2NMO A;  1FMD 1;  4K7J A;  3FUQ A;  4RHV 2;  2WWJ A;  4LE4 A;  3U4S A;  5FBZ A;  1JUI A;  1XYP A;  4W6X A;  3AZV A;  3I2G A;  5A7N A;  1XYN A;  4BIS A;  2FCV A;  1KD7 A;  3M4F A;  2BGP A;  2HWD 3;  2ZMN A;  5KHH A;  1UL9 A;  4D7Y A;  5KC5 A;  4QPI C;  2KA3 A;  3AVR A;  3BU7 A;  1C5H A;  3POW A;  3VSS A;  4CU8 A;  5IHR A;  1ZRD A;  5GLN A;  2V5Y A;  1UY1 A;  4C90 A;  1UXZ A;  2JWP A;  3EMR A;  3BYN A;  4NUB A;  1MS8 A;  2GZW A;  4TSV A;  5L7O C;  1OA2 A;  3Q8C A;  4KNC A;  5FY0 A;  2B4W A;  3ACG A;  2J1U A;  3GBW A;  3QEF A;  4A7Y A;  3OEB A;  4JGZ A;  1ENR A;  1ZRR A;  4DRR A;  2HYK A;  1S0E A;  1GQP A;  1X33 A;  4LT5 A;  2Y60 A;  5CKM A;  3R05 A;  1S2B A;  4QX8 A;  4LE3 A;  3LFI A;  4ZS2 A;  2XHK A;  4I0B A;  3J8F 1;  1H2K A;  4AFA A;  2P3I A;  3PUI A;  2VOV A;  5FYT A;  5H9Q A;  3ZSK A;  4D94 A;  2VVD A;  4LBQ D;  4E2G A;  1S55 A;  5HCF A;  4HOO A;  1OFN A;  1QGL A;  2WFF 1;  1WCS A;  4NO4 A;  3DCQ A;  1NZC A;  1CR7 A;  1W6N B;  4AVC A;  3QH6 A;  4KGG A;  3J4U H;  3IKW A;  1RUG 2;  5LAS A;  4CU6 A;  3I54 A;  5FUI A;  3T4H B;  3IPV A;  3GXU A;  1REF A;  1COV 3;  4XDQ A;  1D7P M;  1C3H A;  2LTN A;  4JQT A;  4EN6 B;  3VBU C;  3AC0 A;  4CDW A;  5I8T A;  1AR8 3;  1NCR C;  2DYC A;  3T2Q A;  5ISL A;  3P5B A;  2VBP A;  5FPX A;  1V6J A;  3KT4 A;  2DVG A;  5ANN A;  4UDK E;  4OHY A;  2A73 B;  1KJR A;  4LBK A;  5FZK A;  4P02 B;  4FFH A;  1ASJ 2;  3L2H A;  5CYY A;  5JOX A;  3HVD A;  3OYW A;  2GC3 A;  5FCC A;  1RUF 1;  3N7M A;  4HK9 A;  4ES8 A;  1POV 3;  3ZX7 A;  4I09 A;  1BMV 2;  3VBU B;  4FP2 A;  4IEX A;  1DHK B;  4TWT A;  2Z79 A;  2ZX2 A;  4C1W A;  1SLL A;  2R07 3;  3R0R A;  4IE5 A;  4FTB A;  1WMX A;  1UMZ A;  3HJR A;  3WMZ A;  1WW6 A;  3SNM A;  2ARE A;  4Q4X 2;  4B1L A;  1WW7 A;  2KR2 A;  4RQP B;  3AKQ A;  4KQ7 A;  3WY6 A;  1U0A A;  3ZXJ A;  3OUI A;  4MO3 M;  4N43 C;  3KCY A;  4COV A;  4C8D A;  3KV4 A;  1VBE 1;  2C9K A;  4ZY9 A;  3D3A A;  4LNV A;  4XUP A;  5D8A C;  3ASI A;  3KSC A;  4BJ0 A;  5C8C A;  1LES A;  2DBN A;  4B4Q A;  5I8S A;  5T55 A;  1JOJ A;  1T6G C;  3K4A A;  5EHD A;  1XNA A;  4A42 A;  5LY2 A;  4EWD A;  3WP3 A;  4Y33 A;  4AED C;  3S6P A;  1OSG A;  2QNK A;  1NA1 C;  5A6X A;  1PO1 2;  2JDA A;  4BLJ A;  4W65 A;  2FBE A;  1YLL A;  1W9S A;  3ZYP A;  2ZAC A;  2D5F A;  2WII B;  3GYD A;  3AXD A;  4YNI A;  3R4S A;  1AL0 G;  5IVF A;  2XJQ A;  3MDP A;  2C0Z A;  1BKZ A;  1LHV A;  1MS3 A;  4KH9 A;  4L97 A;  2E7A A;  4TYS A;  1T6B X;  3IZO A;  3VZN A;  3TEW A;  1CAW A;  3T08 A;  5KXD A;  1QHD A;  3NJY A;  3POG A;  5L73 A;  5FYY A;  1XXN A;  2RM2 2;  4Q4Y 2;  3KQR A;  5C3P A;  1RJ7 A;  3N9P A;  2ARX A;  3BOD A;  4LBJ A;  3D0S A;  4BLI A;  4MUV A;  4YW3 A;  2P2K A;  2ADE A;  3AYD A;  2RS5 2;  4XHB A;  2DCJ A;  1DQ6 A;  4BK4 A;  2OUH A;  3J7H A;  3VBO C;  4RSU A;  4Y5S A;  2QQN A;  3IDB B;  3LAG A;  2ZGO A;  2QQK A;  1F4A A;  4EN9 B;  2NN8 A;  3CEW A;  1W05 A;  5L9B A;  3LE0 A;  2R04 1;  5CFD A;  3WPU A;  4YGD A;  2IC1 A;  1YQ6 A;  4P9L A;  4S2D A;  5CZK A;  1PO2 3;  2JG9 C;  4YW2 A;  3A23 A;  3FZ3 A;  4FQZ A;  5DUV A;  1TMF 1;  1GYE B;  1DU3 D;  3VDC A;  3U75 A;  1HN0 A;  1TEI A;  1EP0 A;  3ZFE B;  1H30 A;  3VL9 A;  4A7K A;  2QQL A;  4IND A;  4LO5 B;  3A7Q A;  2OKX A;  4YVW B;  1IOA A;  3NKT A;  3WDT A;  4QB1 A;  1GWL A;  3PUQ A;  1DDL A;  2ZAA A;  2CAU A;  3AFK A;  2JG9 B;  1GKB A;  3CJI A;  5FY8 A;  3V0A B;  2Q1Z B;  1HRI 3;  2G9Z A;  4K8F A;  5LA9 A;  5GLM A;  3I2O A;  1Q3E A;  3DPR A;  1XNB A;  2BNO A;  1MS4 A;  2KXL A;  4QX5 A;  2Q8O A;  4JDN A;  4RR3 A;  3VBS A;  1BLZ A;  2FHR A;  4RGK A;  5FKC A;  1ZRF A;  1PZ9 A;  3VDD C;  1X82 A;  4DNY A;  3LEI A;  3V64 A;  1FAY A;  4Z2W A;  4K3U A;  4EJR A;  3EHK A;  1C8N A;  1OHF A;  3OBA A;  5FZ0 A;  4FOW A;  1N1T A;  4JGY A;  4FPG A;  4WZF A;  1ZBE 3;  1JOB A;  2EIB A;  5FYS A;  1SFY A;  3ZFG B;  1MPX A;  1W6M A;  3ITQ A;  2ETE A;  5B6T A;  3HAG A;  1UZZ A;  3W21 A;  1W8F A;  1GZ9 A;  1R1A 2;  2DVA A;  2JDY A;  1XB9 A;  1RUD 3;  1S0J A;  4GWN A;  3ZIX A;  2NPI A;  2Z5W A;  1MEC 3;  2CGO A;  2ILM A;  5TSW A;  5ERL A;  1C28 A;  3ILR A;  3QED A;  2ZTN A;  2QCS B;  2G9G A;  3ECQ A;  5JXG A;  4N1I A;  2Y26 A;  1RUE 2;  1DP0 A;  3HD8 B;  4JX0 A;  1C8M 2;  2OS2 A;  4Q1R A;  1H2M A;  4K1Y A;  2EXI A;  3UGH A;  5LK7 B;  2XJV A;  4AFC A;  4DRV A;  1LJ7 A;  1PVC 3;  2YPJ A;  3P6B A;  5F3I A;  4AG4 A;  4WBB A;  1MS0 A;  4H2A A;  2EIG A;  3KHC A;  4N53 C;  1I6X A;  4OUM A;  4JTN A;  4A4A A;  1LOG A;  1BZW A;  4LA3 A;  1VJ2 A;  2HWE 1;  4QQS A;  1UF2 C;  3OUJ A;  4FXK B;  1IZ3 A;  1CPM A;  3FFZ A;  3WF3 A;  3ELN A;  4QX0 A;  5DG2 A;  3K77 A;  1RHI 2;  1V70 A;  1UZ0 A;  4QU1 A;  4XZU G;  1IKQ A;  3HEI A;  1PGS A;  3TB0 A;  4GD4 A;  2VQU A;  4I02 A;  2OPK A;  2OQ6 A;  3JD7 2;  2A6W A;  3DEC A;  1K5M B;  4GMP 3;  4XPV A;  3ZYI B;  5CFC C;  1QKQ A;  3BYW A;  3UV9 A;  3VV1 A;  4D69 A;  4CUG A;  3THT A;  2VZO A;  1CJP A;  5FO7 B;  5LBF A;  2Y6G A;  5FWE A;  1OPM A;  4AL9 A;  2VQT A;  4MLO A;  5FZA A;  2VOT A;  3O1V A;  3ZKU A;  3SH3 A;  4FPO B;  1TME 3;  3OY8 B;  2VC9 A;  3ACH A;  1K5J A;  1ND3 A;  4JDO A;  4LBQ A;  1PHM A;  4UF0 B;  2CNA A;  5FDB A;  3NST A;  1FOD 2;  4HPK A;  3WEZ A;  3NMB A;  4AK5 A;  2NYY A;  4Q4W 1;  4TN7 A;  3RSJ A;  1BBT 2;  3UK9 A;  5KXB A;  1IGO A;  5T5J A;  3WOG A;  1ENX A;  1UOG A;  2A1X A;  1BEV 1;  5LBB A;  1CX1 A;  1D2Q A;  4ZZ8 A;  2QKD A;  2QE3 A;  2WS9 3;  4AEK A;  3I2J A;  1E5R A;  1QU0 A;  3WQB A;  4GB3 2;  1UX7 A;  1FPN 2;  2A7A A;  1ZZ7 A; 
#chains in the Genus database with same CATH homology
 1GYH A;  1GYE B;  5AYE A;  3U75 A;  3AKH A;  2X8F A;  1GYD B;  3WMY A;  3LFI A;  4KCB A;  4UFK A;  3ZXK A;  5FMD A;  3WAU A;  4MLG A;  1WL7 A;  4NOV A;  1YIF A;  1W18 A;  4B1M A;  3C7O A;  3NQH A;  5AYC A;  3VT2 A;  4KC8 A;  3D61 A;  3LDK A;  1PT2 A;  3SC7 X;  5GLO A;  4FFI A;  4UFH A;  3VT0 A;  3LIG A;  1YI7 A;  5AYD A;  5GLM A;  3AKI A;  2EXJ A;  2X8S A;  1Y7B A;  3WN0 A;  3KST A;  2AC1 A;  4U6D A;  4CCC A;  4CCD A;  4U6B A;  5FKC A;  3D5Y A;  4JQT A;  3H3L A;  4FFG A;  4UFI A;  3BYJ A;  3D5Z A;  3KF3 A;  1Y9G A;  4UFJ A;  5GLL A;  3WPV A;  5AY9 A;  4UFM A;  3C7G A;  5GLQ A;  3LF7 A;  3UGF A;  4UDK E;  4O8N A;  5ANN A;  2YFR A;  5C0P A;  2EXK A;  4QHZ A;  4UDI A;  2OXB A;  3QZ4 A;  3LDR A;  3C7H A;  3P2N A;  5GLP A;  3VSZ A;  1W2T A;  4FFH A;  3OM2 A;  3KF5 A;  5JOX A;  5GLK A;  3QEE A;  3WPY A;  3ZR5 A;  5FKB A;  5B6T A;  4EQV A;  1UYP A;  3CU9 A;  3VSF A;  3U14 A;  5A7V B;  4AK6 A;  3K1U A;  3PIJ A;  3OM6 A;  3QED A;  3WMZ A;  4N1I A;  4B1L A;  3WN2 A;  1Y4W A;  5A7V A;  3ZXL A;  2EXI A;  3UGH A;  3VT1 A;  3ZXJ A;  2YFT A;  3C2U A;  5JOW A;  3VSR A;  3S5Q A;  2VDT A;  3OM7 A;  2X8T A;  4KMI A;  4D47 A;  3LEM A;  3AKF A;  3BYK A;  4AK7 A;  4N2Z A;  3AKG A;  4ONZ A;  4QQS A;  1Y9M A;  5JOY A;  3ZR6 A;  5JOZ A;  3IMM A;  1OYG A;  2QQU A;  4PVI A;  5A8D A;  3HBK A;  1VKD A;  4HXC A;  3WAS A;  4FFF A;  3PIG A;  2ADD A;  3BYL A;  5FMB A;  5FK8 A;  3RWK X;  4UDJ A;  3C7E A;  4N2R A;  4UFL A;  3OM4 A;  4UDK A;  1ST8 A;  2ADE A;  3D60 A;  3R67 A;  4AZZ A;  4CCE A;  4PVA A;  3WN1 A;  4N4B A;  3UGG A;  5B6S A;  4UDG A;  4COT A;  3QC2 A;  3LIH A;  2EXH A;  4KC7 A;  3LV4 A;  5FLW A;  3C7F A;  3TAW A;  3WPZ A;  2AEZ A;  4AK5 A;  3NMB A;  2XQR A;  3WAT A;  5FMC A;  2QQV A;  1UV4 A;  5FK7 A;  3VSS A;  4O8P A;  2AEY A;  4O8O A;  5GLN A;  5GLR A;  3U1X A;  4KCA A;  2YFS A;  3BYN A;  2QQW A;  3R4Z A;  3WPU A;  3OSD A;  5FIX A;  1YRZ A;  3R4Y A;  2B4W A;  5A8C A;  3QEF A;  3OM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...