2X8SA

Crystal structure of the abn2 d171a mutant in complex with arabinotriose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
443
structure length
443
Chain Sequence
KPIFKEVSVHDPSIIETNGTFYVFGSHLASAKSNDLMQWQQLTTSVSNDNPLIPNVYEELKETFEWAQSDTLWAADVTQLADGKYYMYYNACRGDSPRSAMGVAVADNIEGPYKNKGIFLKSGMEGTSSDGTPYDATKHPNVVAPHTFFDKDGKLWMVYGSYSGGIFILEMNPKTGFPLPGQGYGKKLLGGNHSRIEGPYVLYNPDTQYYYLYLSYGGLDATGGYNIRVARSKKPDGPYYDAEGNPMLDVRGKGGTFFDDRSIEPYGVKLMGSYTFETENEKGTGYVSPGHNSAYYDEKTGRSYLIFHTRFPGRGEEHEVRVHQLFMNKDGWPVAAPYRYAGETLKEVKQKDITGTYKLIQHGKDISADIKQTINIQLNKNHTISGEMTGTWRKTGKNTADITLAGKKYNGVFLRQWDSVREKNVMTFSVLNTSGEAVWGSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDO-ALPHA-1,5-L-ARABINANASE
publication title New Evidence for the Role of Calcium in the Glycosidase Reaction of Gh43 Arabinanases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 131
structure length 443
sequence length 443
chains with identical sequence B
ec nomenclature ec 3.2.1.99: Arabinan endo-1,5-alpha-L-arabinosidase.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF16369 GH43_C C-terminal lipocalin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.10 Mainly Beta Beta Barrel Lipocalin Lipocalin 2x8sA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2x8sA01
3CU9A 3SC7X 2X8FA 3VSFA 3ZXKA 3WPZA 5B6TA 3BYLA 3LV4A 2AC1A 5FMBA 3WN2A 2QQUA 4COTA 3QC2A 4UDKE 5GLNA 5FK7A 1UYPA 3QEDA 3KF3A 2X8SA 4PVAA 3U75A 3P2NA 3QEEA 4AK6A 3QEFA 3UGHA 5A7VB 5GLMA 4PVIA 2B4WA 3BYKA 2EXIA 4FFIA 2RN4A 1Y7BA 3VSZA 1VKDA 3D60A 3VSSA 3VT2A 5JOXA 5AYEA 1JIWI 3LDKA 5AY9A 5GLKA 3WPUA 5JOYA 2X8TA 3QZ4A 3WN1A 3OM6A 2AEYA 3LIGA 3WMYA 3UGGA 1YIFA 3WAUA 3LIHA 3R67A 5A7VA 3U14A 3K1UA 3ZXLA 3PIJA 2VDTA 2YFSA 3C7HA 4AK5A 2EXHA 3C7FA 3KF5A 3R4YA 1YRZA 4O8OA 5FK8A 2XQRA 3LF7A 3UGFA 4UDGA 3C7GA 4KC7A 4N2ZA 2YFRA 4KCAA 5GLLA 3D5YA 4KC8A 3NQHA 4AK7A 3WN0A 3BYNA 5AYCA 3AKIA 5GLRA 3AKFA 3D5ZA 1GYEB 4UDIA 3WASA 1Y9GA 4UDKA 3WATA 1OYGA 4MLGA 1YI7A 5C0PA 4N2RA 3RWKX 3OM7A 4KMIA 5JOWA 3AKHA 5FIXA 3LEMA 5B6SA 3PIGA 1PT2A 1SMPI 3VT0A 4ONZA 3WPYA 2QQWA 3C2UA 5FKCA 5GLOA 1Y9MA 1GYHA 2AEZA 1UV4A 3WPVA 3LFIA 4D47A 5A8CA 4KCBA 1W2TA 5FMDA 1WL7A 3AKGA 5FKBA 3LDRA 4N1IA 5ANNA 4O8NA 4U6BA 4QQSA 5GLPA 3BYJA 1Y4WA 4FFGA 3OM4A 3OM2A 4NOVA 2ADDA 3KSTA 3VSRA 5FLWA 5FMCA 4U6DA 3WMZA 3R4ZA 2YFTA 3VT1A 1W18A 3ZXJA 4N4BA 4O8PA 2EXKA 3TAWA 3C7EA 4FFHA 3OM5A 3C7OA 1ST8A 2EXJA 4FFFA 4UDJA 3D61A 2OXBA 5A8DA 2QQVA 5AYDA 5JOZA 2ADEA 5GLQA 4EQVA 1GYDB
chains in the Genus database with same CATH superfamily
2MJIA 3PDFA 5L8IA 2K23A 4DQ3A 3WPZA 3MG5A 2AC1A 3WJCA 1D3SA 3QC2A 2NNDA 2A3FX 1SRJA 4HPAA 1W4TA 1S7DA 4EDEA 2GTLO 4YFPA 4Y0QA 3T6LA 3BSZE 1LF7A 4MEEA 3ZQ3A 2OFAA 1T68X 4RUNA 3RDUA 3IA8A 3UEWA 4OS3A 1CBSA 3TGAA 4DNEA 1YIFA 3GE2A 4NLIA 3RDMA 4YCHA 1XCAA 2AT6X 5EEEA 1N0SA 4KC8A 4BJ8A 4JO6A 3AKIA 4Z28A 4NYQA 4MVLA 4KMIA 4ZGUA 5C2MA 1I4UA 5EEDA 2WUTA 1BBPA 2OZQA 4LKTA 4CV7A 1LDOA 3NADA 5IRAA 1VWKB 4IB9A 1EPBA 3VG5A 5LKEA 4GH7A 4QQSA 3L4RA 5LJEA 5B10O 4O3ZA 1HQPA 2ALLX 3T1DA 1OSPO 4ORSA 1SY2A 5F58A 2R73A 3ZW0B 2R56A 4YFRA 4YVBA 1ALBA 4A8ZA 3OM5A 3KVNA 4GETA 5AYDA 2FKGA 3S26A 1EI5A 1LIBA 1IIUA 3PH5A 4XMFA 5FK7A 3MVFA 1FENA 3FYFA 1JZUA 3KF3A 3VU1A 1SWJA 4CDFA 1SRHA 1Y7BA 3B2KA 2NNQA 2CM4A 3UAQA 2L9CA 3STNA 5FQ7E 5HCCC 3RKGA 2IZGB 4GGRA 1MDCA 2Z4HA 3BS2A 4O4SA 2RQ0A 2CZTA 2YFRA 1VWBB 3OE3A 3BYNA 1S2PA 5L3YA 1TOWA 3BX7A 1SXXA 5HZQA 5BVQA 3WYQA 3PECA 1DFVA 2QO6A 3VG6A 2IZEB 1ML7A 4NV7A 3WPYA 1N9YA 1O1UA 4QNIA 1SWBA 1UV4A 3HTYA 1EUOA 2Y3EA 1RBPA 1W2TA 5HAEA 4MIRA 4Z2OA 1G5WA 4U6BA 2GC9A 3PP6A 2ADDA 4FBVA 2YFTA 3ZWEA 1LPJA 3UEVA 1U0XA 3RE6A 4GNYA 1IW2A 2N93A 1VWCB 3S60A 1G74A 2FLJA 1KZXA 2FR3A 1LFOA 4ES7A 1BSQA 3HWFA 1H91A 4GE1A 4OS0A 1UYOX 1ICMA 2B4WA 2LA7A 3BYKA 1VWNB 4OKAA 2KTDA 4UU3A 2Y32A 4ORWA 2DJFA 2X4MA 2X8TA 3FR2A 2A2UA 5HZ9A 3OBLA 3FIDA 2Z4IA 5EDBA 3LIHA 3VHHA 1A57A 2ACOA 5H8TA 3C7FA 2LB6A 2OYBO 2FS6A 5IRWA 1BWYA 2QO5A 3AKNA 1VYGA 1KQWA 4CPIA 2LBAA 3NQHA 4TKHA 5KIDA 1JJJA 4MLGA 2NNEA 3AUMO 1BM5A 3NP1A 5B6SA 1GT5A 2FWVA 4LKPA 4Z27A 4ZHDA 4B55A 3KFGA 5A8CA 2RTAA 4YCEA 4YGGA 3VG7A 4A60A 2IZLB 3C78X 3FW4A 1VWOB 4HPBA 1SWAA 4XMEA 1FDQA 3WJDA 1A2DA 1W5RA 3C7EA 2AKQA 2CZUA 1VYOA 1KT3A 2ZAIA 1SWUA 3ZW1B 1SWOA 2GTLM 5GLQA 1ZNEA 4CDCA 1O1VA 3APWA 1N43A 4BX5B 4ZR2A 1B8EA 4UDKE 3VHIA 1KT5A 2X8SA 1SWLA 3QEEA 1GGLA 2M4LA 4Y0SA 3ZUOA 2GJ5A 1DZPA 2WR6A 2AT0X 3WBGA 5JOXA 4XMHA 4Y0RA 3P6DA 2NP1A 2QM9A 3UEXA 1SWSA 4R0BA 2ANSA 2WQAE 1VWPB 3CR6A 4CPHA 4BX7B 1LIEA 3WJEA 1NP1A 2YFSA 2EU7X 3FEPA 2XQRA 4AK7A 5GLRA 1RXKA 2L68A 1E00A 1GYEB 3T6FA 3FW5A 4AYHA 3VE1A 3KZAA 2MF6A 5C0PA 3APUA 1YI7A 2KW1A 1MK5A 4BBOA 3NQ9A 3AEHA 3LHNA 2UYWA 1ERXA 5FKCA 2OY8A 3CWKA 4ML7B 4D47A 2OY7A 3NQ3A 3FELA 1MX8A 4CPFA 1N4JA 1UREA 1GKAA 3HK1A 3WMZA 1SREA 1HXLA 4DCBA 3RWXA 1JV4A 1STPA 3EBKA 2QQVA 1SXUA 3ZXKA 1DZMA 3PEDA 3EBWA 2QQUA 2PY1A 4NYRA 1YUPA 4CK4A 3KFIA 2O62A 3P2NA 4AK6A 1E5PA 4O3YA 3ZW1A 3NBXX 4XMGA 2IFBA 4O49A 4UU2A 1R0UA 4ID2A 4ORRA 1AQBA 1QY0A 2AVIA 3S5VA 2ZSCA 1SXYA 2OF8A 3UGFA 4HFOA 3C7GA 5HTEA 3RDSA 5F7GA 4KCAA 1SLFB 5HZ6A 3VG4A 1LIDA 4YDAA 2LFOA 4C5PA 5K68A 3I0AA 2LKKA 1EW3A 1NQNA 2BS6A 1NBXA 3EC5A 4YMYA 4IMNA 4IRWA 1WL7A 1L6MA 4YGZA 3BYJA 4NNTA 1RSUB 4GK9A 4ALBA 2ZAGA 3ZXJA 4JNJA 1GXAA 3SOTA 4TQ2A 1U18A 2EXJA 1SLEB 4UDJA 1VWLB 1E2TA 2X8FA 3HPEA 4MVIA 4ZFXA 1X8UA 3STKA 1NC9A 4INNA 3MBTA 4ZCBA 4XMDA 3I17A 5C0NA 2FS7A 1PEEA 2JGSA 2FHNX 2MO5A 1X8PA 3BLGA 3P6CA 1HBPA 5H9AA 3KQ0A 3P6FA 5GLKA 1KQXA 3PQSA 1VWMB 2OL7A 1JMZA 4BX6B 2AEYA 1X8OA 4GKCA 3B2JA 3WAUA 3ZXLA 1FELA 2JU8A 3QKGA 5CE4A 5D45A 2Q39A 5K06A 1W6FA 4O4OA 3RBYA 4OEMA 1FJ1E 1GX8A 5DPQA 4IB7A 4ALOA 4KIIA 1VWRB 4ONZA 4HPDA 4U8UM 1SWGA 1Y9MA 3EW2A 5EZ2A 1QWDA 3C76X 2I5VO 5CSEA 4LQZA 4N1IA 1Y4WA 1P6PA 3OM4A 4NNSA 3TF6A 3K3LA 4PJ2A 5L8OA 3C77X 1UZ2X 4QQ1A 1SRGA 3CKFA 1VWFB 4FGIB 4YH0A 2A2GA 3SC7X 3S5XA 3OD9A 3QEDA 2HKDA 4BVMA 1YWAA 3PK2A 1NQMA 5A7VB 5HCDC 1ZNHA 3F6ZB 3SZIA 4GGTA 1VWEB 5K67A 2A5CA 1X8NA 4AZNA 2KT4B 2GTFX 2WEXA 3NX2A 2OFRX 4Z2VA 5FAZA 4OELA 3K1UA 3GAQA 2A5BA 1YRZA 4I9SA 4IAWA 4QYNA 1AVDA 1T0VA 5AYCA 5HTDA 1VWGB 4BX6A 2KTSA 1SXWA 3TGBA 4WHIA 3D9WA 5IO6A 1JBHA 3LEMA 2RTKA 4ZJ0A 2CBRA 2HMBA 5LKFA 4I95A 3IFBA 2AEZA 3CBSA 4KCBA 2CM9A 5HA0A 1DC9A 5HZ5A 5F1EA 4ZHHA 3TAWA 5IO5A 1OPBA 2RCTA 4AZRA 1CRBA 1ZNLA 1LCVA 3DTQA 2XKLA 3PPTA 3PQUA 4BQUA 4RUUA 1X71A 4YDBA 5HZ8A 1BRQA 4YFQA 4GDZA 2UZ2A 3NR3A 4GGZA 1JIWI 4PSQA 3D97A 3QZ4A 4NP1A 3TZSA 1OEJA 1Y53X 3HOLA 1DV9A 2IZJA 3F9DA 5A7VA 1EPAA 3ZW0A 3VPJE 3RSWA 2W2AA 3O2YA 2EXHA 1KZWA 2QCBA 2BSZA 2MHDA 4N2ZA 4FQBB 3RDXA 2PI3O 3WN0A 1YIVA 2AT8X 1S44A 3BX8A 3P6GA 1CJ5A 3RY2A 3WATA 4N2RA 1ICNA 3G7XA 2RTOB 3FDCA 2F73A 4OMWA 5JD2A 3VT0A 3C2UA 2HLVA 1MX7A 4U9CA 1KL4A 3LFIA 2G5LA 4EKVA 2RTLA 3P24A 4CPEA 4MISA 4O9SA 2RTFB 2HYSA 2FKJA 1SWEA 2OVSA 3RDQA 5FMCA 4ZHFA 2F01A 4LZUA 1K3BA 4N7DA 1Y55X 1G7NA 3JS1A 1Z24A 1JQPA 5A8DA 4EQVA 5EDCA 1IKJA 2WWPA 3FR5A 5FMBA 1CBIA 1YP6A 2VFCA 3SZJA 1UYPA 2ASNX 1QY2A 3FA8A 4EXZA 3HOEA 1T8VA 1IKEA 1HXZA 3KFHA 4QZTA 1VKDA 2OF9A 1STSB 1BSYA 3U0DA 1NGLA 3LIGA 3FA9A 3R67A 2XSTA 1SWQA 1N7YA 4GJSA 3C7HA 4AW8A 5HA1A 1SRFA 4BCSA 4GNWA 3PH6A 4ZH6A 5GLLA 1CBQA 5FENA 3SLOA 1ZNKA 1OEKA 3ZW2A 5B5GA 4ARHA 3AKHA 1MUPA 5FIXA 1RAVA 2RA6A 4CSBA 2JU3A 3VE2A 2OFBA 5AJCA 1OBPA 2RTCB 2E4JA 1DZJA 1SWRA 3BU1A 4YGHA 5FKBA 3WOVA 1X8QA 1VYFA 5LJHA 2MM3A 3VT1A 4QAEA 3APXA 4WFVA 1YWDA 5IO7A 5JOZA 4YKMA 2WSJA 2OY5O 2FHLA 4I60A 4ODDA 2Q4NA 4TNNA 1I06A 3QEFA 1ADLA 3VG2A 1FE3A 1TOUA 2GH7A 4QZUA 5B3MO 1CBRA 3FENA 5H9KA 2QMIA 2QOMA 4WFUA 4YKOA 1OBQA 1EQDA 1VWHB 2RTEB 4M6SA 3HWEA 3WJFA 1QY1A 3D96A 3STMX 1TW4A 2WPUA 3WJGA 4FBOA 4BX5A 1O8VA 3WZQA 1KXOA 2Y3FA 1SY1A 5HBSA 3BDRA 2Q2MA 1SWNA 1GT1A 2A0AA 3V8UA 3B2IA 4O3WA 5FMDA 3BRNA 3FR4A 4BX7A 3FA7A 2RCQA 2EXKA 1ST8A 1OPAA 2AT5X 1MVGA 1BEBA 2BHVA 5D48A 1KL5A 1KOIA 1HBQA 4IB8A 5DG4A 1QABE 1KL3A 3U75A 1YP7A 1MM9A 4EFGA 3UGHA 3FMZA 3CBCA 2C1SA 4TKJA 4L3RA 2FT9A 1SWPA 1DF8A 2JMBA 4QRLA 2JW1A 2G7BA 3UGGA 3QQ2A 3CKGA 2WQ9A 4Y5DA 2Q9SA 4EQAC 2IZHB 3KF5A 4O8OA 4UDGA 3F8AA 3WJBA 4O3XB 2OL8O 1HMSA 3RZYA 4I6SA 1VWIB 4M7MA 1I78A 5JOWA 3VG3A 1AB0A 1NP4A 5D8JA 3WVMA 4TLJA 2HZQA 5B5FA 4HWMA 3LDRA 1GM6A 5ANNA 4O8NA 2RTMA 1BLRA 1QG5A 1YWBA 4FFGA 1KFFA 3JQOA 3U03A 4QGVA 5EPQA 4N4BA 4FFHA 3C7OA 1E06A 2IZIA 2FRSA 4IAXA 4ORYA 4ZHCA 3O22A 2RTRB 1KT6A 1AELA 2JN3A 1X89A 1SWTA 2CBSA 2VFBA 5AEOA 3FLLA 2Q2PA 1GX9A 3T2WA 1WBIA 2RTQB 1ACDA 1SLGB 3WZPA 4HPCA 5AY9A 1SA8A 1NDJA 4EEJA 1SRIA 2ACPX 4O4XA 3X00A 5CYBA 3SLTA 2DJGA 3D4RA 2IZAA 1VWQB 3U14A 1E02A 1DF3A 1A3YA 3B2LA 1Y52X 2A13A 3WZNA 3LF7A 1GT4A 3NX1A 3O19A 3VHMA 3AKFA 3D5ZA 5HCEC 1Y0GA 2F09A 2IZCB 3ELXA 1RXJA 2BLGA 2RTIB 2RTJA 4GUZA 3HWGA 3SZHA 1QFTA 3RDOA 1WUBA 4LZVA 5FFHA 1RSTB 4GJVA 2G8CO 3FIQA 2P8GA 5F6ZA 4ON1A 2HNXA 4NOVA 2AL0X 1PMPA 5FLWA 4ZH9A 5IRUA 3VGWA 5KICA 1LELA 1TVQA 5CHKA 4D6AA 5BVTA 5JR8A 2X45A 4O4UA 5FQ8E 2OXBA 5LJBA 1BRPA 4OMXA 1PM1X 4GD9A 2I5ZO 3BY0A 5L8NA 2GTLN 2X34A 5AQ6A 2AF5A 1HN2A 1ZNDA 2VDFA 1SWCA 5LJGA 4PVIA 2RN4A 3VSZA 3ZI8A 2X56A 1VWDB 5AYEA 4NLJA 3CQRA 4A1YA 3OJYC 1EXSA 5B29A 1AVEA 3WMYA 1ZNGA 1I9HA 2WEWA 1D2UA 1PTSA 2JOZA 4FBRA 3PIJA 1GX3A 5BYPA 1IFCA 4KC7A 1I04A 4BOEA 1LCWA 4L1NA 1N9MA 2IZFB 2X32A 4UDIA 4MVKA 4I3BA 4UDKA 4ZHGA 2AT3X 4D6BA 4JGLA 2RTBB 1PT2A 4XMCA 1SY0A 5AJBA 3EW1A 2W2FA 3P6EA 3Q6LA 2JU7A 4YBPA 1EIIA 5GLPA 2X46A 2OY1O 1SY3A 4K19A 1KT7A 3RY1A 3OM2A 2RTGB 3VSRA 4CPHB 5B27A 1HY2A 1YWCA 2QO4A 1B4MA 4TJZA 1LDQA 1W18A 3FA6A 4I9RA 4FFFA 3D61A 4GZVA 4GDAA 1ERBA 4Z2PA 1GYDB 3CU9A 3VSFA 4AZPA 5B6TA 4Z6JA 4AZQA 3WN2A 4COTA 3Q34A 4AZOA 3T2XA 1STRB 2RTDB 3SAOA 1SWKA 1SWDA 5GLMA 3WXQA 3P02A 2OVEA 4QYPA 5LJCA 3D60A 4NV8A 3LDKA 5JOYA 1JJUA 3RE5A 2C4IA 3OM6A 1GKAB 2BC3A 1IFBA 2QOSC 4CDDA 3DSZA 3D95A 1OBUA 2KD2A 4AK5A 2G78A 5D47A 5B2AO 3U9PC 3B2HA 5FK8A 1JYJA 3N91A 1SWFA 1U17A 4KH8A 2IZKA 4AZMA 4I3DA 1OYGA 4A1HA 3OM7A 2IZDB 1TXLA 4U8UO 3PIGA 2AH7X 3ZZVA 1SMPI 2QQWA 1BJ7A 1DZKA 2K62A 4OS8A 4QGXA 1PBYA 2CAMA 4MVEA 1FEMA 1VWJB 1Y9TA 3KSTA 3HWDA 1RLBE 2X55A 2FGSA 3R4ZA 4Y0PA 4O8PA 3WYPA 3H3IA 5B11O 2L67A 3ELZA 2R74A 2ADEA 2MWHA 3EMMA 5F2BA 2IZBA 1LIFA 2C1QA 1JJXA 3BYLA 1MEPA 4ORXA 2BT9A 5FQ6E 5H9NA 1K24A 4WBKA 5GLNA 2AMMX 4U46A 1LKEA 1BSOA 1SWHA 4YBUA 5IXGA 2EXIA 4FFIA 1G85A 1LUQA 3VT2A 1LICA 2G79A 3WPUA 3WN1A 3AKMA 4N7CA 3NPOA 2A8GA 1OEEA 2VDTA 3BU9A 3EM0A 3R4YA 1UYNX 3FEKA 3CMPA 2L5PA 2LBVA 5BVSA 1TL2A 4IABA 3WASA 1Y9GA 1B0OA 1VPRA 2YMSA 3WZOA 1AVGI 1LNMA 1JYDA 4ORUA 3LTWA 3ZUIA 1XKIA 1Y9LA 4CDEA 4U8UN 5H9LA 1KT4A 3AKGA 1HMRA 3SLJA 3APVA 1QQSA 4TKBA 2W2BA 4IMOA 4IB6A 5LJDA 4ZGFA 3KFFA 1PBOA 2DM5A 1EALA 5KHPA 5LJKA 3MX7A 2RD7C 5D4AA 3LV4A 2YG2A 1ZRYA 4NW4A 4PVAA 1MOYA 4GRJA 4BGFA 1B56A 1HQQA 4GU8A 3VSSA 2RTHB 3TGCA 2OL6O 4DQ4A 1A18A 1I05A 4QGWA 4I3CA 2RTPB 1KGLA 4Y59A 4IBAA 2FR2A 2FTBA 2BS5A 4JHQA 1EIOA 3D5YA 1HMTA 1QFVA 2OVAA 2POAA 2OVDA 1VWAB 3RWKX 4U3QA 3UEUA 3EYCA 2RTNB 5F6BA 5GLOA 1GYHA 3WPVA 2OFMX 1LCZA 5HWZA 4KT5A 3P6HA 1JMXA 1GT3A 3NQKA 3CQNA 4U6DA 1FTPA 1RXHA 3E3CA 1SLDB 3JSQA 1IJ8A 3MM0A 2HZRA
chains in the Genus database with same CATH topology
2MJIA 1SXUA 3BY0A 5L8IA 1IKJA 2K23A 4DQ3A 3ZXKA 3WPZA 5L8NA 2GTLN 2WWPA 1DZMA 3FR5A 3PEDA 1CBIA 2AC1A 5FMBA 3EBWA 3WJCA 2PY1A 2QQUA 4NYRA 1D3SA 5AQ6A 3QC2A 1YP6A 2NNDA 1UYPA 1YUPA 4CK4A 2A3FX 1HN2A 2ASNX 3KFIA 1QY2A 3FA8A 1ZNDA 2O62A 3P2NA 4HPAA 4AK6A 1S7DA 1E5PA 5LJGA 4EXZA 3HOEA 4EDEA 4PVIA 2GTLO 4YFPA 4O3YA 1T8VA 3ZW1A 3NBXX 1IKEA 2IFBA 2RN4A 3KFHA 4QZTA 4XMGA 4Y0QA 4O49A 3ZI8A 1VKDA 3VSZA 5AYEA 4NLJA 3BSZE 1BSYA 1LF7A 3ZQ3A 3CQRA 1T68X 4UU2A 4A1YA 1R0UA 4ID2A 4ORRA 1AQBA 1QY0A 4RUNA 3U0DA 3OJYC 1NGLA 1EXSA 3IA8A 5B29A 3UEWA 3LIGA 4OS3A 1CBSA 1ZNGA 3FA9A 3S5VA 3WMYA 3TGAA 1YIFA 2WEWA 1D2UA 3R67A 2JOZA 3GE2A 2XSTA 4FBRA 1SXYA 4NLIA 3PIJA 3C7HA 4AW8A 5HA1A 5BYPA 4YCHA 4GNWA 3PH6A 1IFCA 1XCAA 2AT6X 4HFOA 5EEEA 4ZH6A 3C7GA 1N0SA 3UGFA 5HTEA 4KC7A 5F7GA 1I04A 4KCAA 4BOEA 5GLLA 1CBQA 4KC8A 5FENA 4L1NA 5HZ6A 3VG4A 1LIDA 3AKIA 4YDAA 2LFOA 4UDIA 4MVKA 4I3BA 3I0AA 1ZNKA 4UDKA 1OEKA 4NYQA 2LKKA 4ZHGA 2AT3X 1EW3A 4MVLA 3ZW2A 4D6BA 4ARHA 4ZGUA 4KMIA 1I4UA 4JGLA 5EEDA 2WUTA 3AKHA 1MUPA 5FIXA 1BBPA 2RA6A 4CSBA 2OZQA 2BS6A 1PT2A 4LKTA 4XMCA 4CV7A 2JU3A 3NADA 1SY0A 3VE2A 5AJCA 1OBPA 5AJBA 4YMYA 2E4JA 4IMNA 1DZJA 3BU1A 4YGHA 2W2FA 3P6EA 4IB9A 1EPBA 3Q6LA 3VG5A 5LKEA 1L6MA 2JU7A 1WL7A 5FKBA 4YGZA 4GH7A 3WOVA 4YBPA 1EIIA 4QQSA 2X46A 5GLPA 3L4RA 5LJEA 1SY3A 1X8QA 4K19A 3BYJA 1VYFA 1KT7A 3OM2A 4NNTA 4O3ZA 4GK9A 1HQPA 5B27A 3VSRA 2ALLX 3T1DA 4ALBA 5LJHA 1YWCA 2MM3A 3VT1A 2QO4A 2ZAGA 1SY2A 4ORSA 4QAEA 4TJZA 5F58A 1B4MA 2R73A 3ZW0B 1W18A 3ZXJA 3APXA 4WFVA 2R56A 4YFRA 3FA6A 1ALBA 4A8ZA 1GXAA 4I9RA 3OM5A 3SOTA 4TQ2A 1U18A 2EXJA 4FFFA 4UDJA 3D61A 4GETA 4GZVA 1YWDA 5IO7A 5AYDA 1ERBA 5JOZA 4YKMA 2WSJA 3S26A 1GYDB 3CU9A 1EI5A 2X8FA 4MVIA 3VSFA 4AZPA 5B6TA 1LIBA 4ZFXA 1X8UA 1IIUA 4AZQA 3STKA 3WN2A 3PH5A 4INNA 3MBTA 4ZCBA 4COTA 4XMDA 4XMFA 4AZOA 3I17A 5FK7A 3MVFA 1FENA 3FYFA 5C0NA 1JZUA 4ODDA 3KF3A 2Q4NA 4TNNA 1I06A 3SAOA 1ADLA 2FS7A 1FE3A 1PEEA 3VG2A 3VU1A 3QEFA 5GLMA 3WXQA 1TOUA 4QZUA 2MO5A 1X8PA 3BLGA 3P02A 2OVEA 4QYPA 5LJCA 1Y7BA 1CBRA 3P6CA 3D60A 1HBPA 3B2KA 5H9AA 2NNQA 3KQ0A 3LDKA 3P6FA 5GLKA 5JOYA 2CM4A 1KQXA 3UAQA 3FENA 3PQSA 5H9KA 2QMIA 2L9CA 3STNA 4WFUA 4YKOA 1OBQA 2AEYA 3OM6A 1X8OA 1GKAB 1EQDA 5FQ7E 1IFBA 2QOSC 4GKCA 3RKGA 3DSZA 5HCCC 3D95A 3B2JA 3WAUA 1OBUA 3ZXLA 1MDCA 1FELA 2KD2A 4AK5A 2JU8A 3QKGA 2G78A 2Z4HA 3HWEA 4M6SA 3B2HA 5D45A 5D47A 3BS2A 3U9PC 5CE4A 5FK8A 1JYJA 4O4SA 3WJFA 2RQ0A 1QY1A 3N91A 3D96A 3STMX 1U17A 2CZTA 2YFRA 1TW4A 2Q39A 3OE3A 4KH8A 3BYNA 5K06A 3WJGA 1S2PA 4AZMA 4FBOA 4I3DA 4O4OA 1TOWA 1O8VA 3RBYA 3BX7A 1OYGA 1GX8A 5DPQA 1SXXA 5HZQA 4A1HA 5BVQA 4IB7A 3OM7A 1KXOA 3PECA 4ALOA 1SY1A 1TXLA 4U8UO 1DFVA 2QO6A 3VG6A 5HBSA 3BDRA 4KIIA 3PIGA 1ML7A 2AH7X 3ZZVA 1SMPI 2Q2MA 4ONZA 3WPYA 1GT1A 1O1UA 2A0AA 4HPDA 4QNIA 4U8UM 2QQWA 1BJ7A 1DZKA 2K62A 4OS8A 3V8UA 1Y9MA 4QGXA 5EZ2A 1UV4A 3B2IA 3HTYA 4O3WA 1EUOA 1QWDA 1RBPA 1W2TA 5FMDA 5HAEA 4MIRA 3C76X 1G5WA 3BRNA 4LQZA 4MVEA 1FEMA 4N1IA 4U6BA 2GC9A 1Y4WA 1Y9TA 3FR4A 1P6PA 3PP6A 3OM4A 4NNSA 2ADDA 3KSTA 4FBVA 3HWDA 1RLBE 3K3LA 4PJ2A 3TF6A 5L8OA 3C77X 3R4ZA 2YFTA 3FA7A 4Y0PA 4O8PA 2RCQA 2EXKA 1UZ2X 4QQ1A 3ZWEA 1LPJA 3H3IA 2L67A 4FGIB 3UEVA 1ST8A 1U0XA 3ELZA 2R74A 4GNYA 1IW2A 4YH0A 2ADEA 1OPAA 2AT5X 2MWHA 2N93A 2A2GA 3EMMA 3S60A 1LIFA 1G74A 1MVGA 3SC7X 1BEBA 2BHVA 2FLJA 1JJXA 5D48A 3BYLA 1KZXA 2FR3A 1KOIA 1LFOA 4ORXA 2BT9A 5FQ6E 3S5XA 3OD9A 5H9NA 4ES7A 4WBKA 1HBQA 1BSQA 3HWFA 4IB8A 5DG4A 3QEDA 5GLNA 4BVMA 2AMMX 1QABE 3U75A 1YP7A 1H91A 1LKEA 4GE1A 1YWAA 4EFGA 3UGHA 5A7VB 1BSOA 3FMZA 4OS0A 4YBUA 5HCDC 1ZNHA 3CBCA 1ICMA 3F6ZB 2B4WA 2LA7A 3BYKA 4TKJA 4L3RA 2FT9A 2EXIA 4FFIA 4UU3A 2KTDA 1G85A 3VT2A 1X8NA 4AZNA 1LICA 4ORWA 2G79A 2KT4B 2JMBA 4QRLA 3WPUA 2X8TA 2GTFX 3FR2A 2A2UA 3WN1A 5HZ9A 3OBLA 2WEXA 3NX2A 2JW1A 3AKMA 4N7CA 2OFRX 3NPOA 2G7BA 3UGGA 2Z4IA 5EDBA 1OEEA 2WQ9A 3LIHA 5FAZA 2Q9SA 1A57A 3K1UA 4EQAC 3GAQA 2VDTA 2ACOA 3BU9A 5H8TA 3EM0A 3C7FA 2LB6A 3KF5A 2FS6A 3R4YA 1YRZA 1BWYA 4O8OA 2QO5A 3AKNA 4I9SA 4IAWA 1VYGA 3F8AA 4QYNA 3WJBA 4UDGA 1KQWA 3FEKA 1T0VA 3CMPA 4O3XB 2LBAA 3NQHA 1HMSA 4TKHA 2L5PA 4I6SA 3RZYA 2LBVA 5BVSA 5HTDA 5AYCA 4IABA 3WASA 4M7MA 1Y9GA 1B0OA 5KIDA 2KTSA 1VPRA 1JJJA 1SXWA 4MLGA 2NNEA 3TGBA 2YMSA 1AVGI 1LNMA 1BM5A 5JOWA 4WHIA 1JYDA 5IO6A 1JBHA 3NP1A 4ORUA 3LEMA 5B6SA 1GT5A 4ZJ0A 3VG3A 2FWVA 2CBRA 2HMBA 3ZUIA 1XKIA 5LKFA 4I95A 4LKPA 1AB0A 1NP4A 5D8JA 1Y9LA 4TLJA 3WVMA 3IFBA 2AEZA 4ZHDA 4U8UN 3CBSA 5A8CA 3KFGA 4KCBA 2HZQA 5H9LA 4YCEA 4HWMA 4YGGA 1KT4A 3VG7A 4A60A 3AKGA 1HMRA 3LDRA 1GM6A 5ANNA 2CM9A 4O8NA 3APVA 5HA0A 1BLRA 1QQSA 1DC9A 1QG5A 1YWBA 3C78X 3FW4A 4FFGA 3JQOA 2W2BA 4QGVA 4TKBA 3U03A 4IMOA 4IB6A 4HPBA 5HZ5A 4XMEA 5EPQA 5LJDA 5F1EA 4N4BA 1FDQA 4ZHHA 4ZGFA 3WJDA 1A2DA 3TAWA 3C7EA 4FFHA 2AKQA 2CZUA 3KFFA 3C7OA 1KT3A 2ZAIA 1E06A 1PBOA 3ZW1B 2DM5A 1EALA 2GTLM 5IO5A 1OPBA 2FRSA 1ZNEA 5KHPA 3MX7A 4IAXA 5LJKA 5GLQA 1O1VA 4ORYA 2RD7C 3APWA 5D4AA 2RCTA 4AZRA 3O22A 4ZHCA 1CRBA 3LV4A 1KT6A 1ZNLA 1AELA 3DTQA 2YG2A 4ZR2A 1ZRYA 2XKLA 1B8EA 3PPTA 3PQUA 2JN3A 1X89A 4UDKE 4NW4A 2CBSA 1KT5A 2X8SA 4PVAA 5AEOA 3QEEA 4GRJA 4BQUA 1GGLA 2M4LA 3FLLA 4RUUA 1X71A 2Q2PA 1GX9A 4YDBA 4Y0SA 5HZ8A 3ZUOA 2GJ5A 1B56A 1BRQA 1DZPA 4YFQA 1ACDA 2WR6A 2AT0X 4GDZA 3WBGA 4GU8A 3NR3A 3VSSA 5JOXA 1JIWI 4HPCA 4XMHA 3TGCA 4PSQA 5AY9A 3D97A 1SA8A 4Y0RA 3P6DA 2NP1A 2QM9A 4EEJA 3QZ4A 4NP1A 3TZSA 2ACPX 3UEXA 4O4XA 4R0BA 4DQ4A 1A18A 1OEJA 2ANSA 2WQAE 1I05A 3CR6A 3HOLA 4QGWA 5CYBA 1DV9A 3D4RA 4I3CA 3F9DA 5A7VA 1EPAA 1E02A 3ZW0A 1KGLA 3U14A 1LIEA 3WJEA 1DF3A 1NP1A 3VPJE 2YFSA 3RSWA 2W2AA 3O2YA 2EU7X 4IBAA 1KZWA 2EXHA 1A3YA 3B2LA 3FEPA 2A13A 2FR2A 2XQRA 3LF7A 1GT4A 2FTBA 3NX1A 2BS5A 2MHDA 3O19A 4N2ZA 4AK7A 4FQBB 1EIOA 3D5YA 3WN0A 1YIVA 1HMTA 5GLRA 2L68A 2AT8X 3AKFA 1E00A 3D5ZA 1QFVA 1GYEB 5HCEC 3FW5A 2F09A 2OVAA 3VE1A 4AYHA 2POAA 1S44A 3BX8A 3P6GA 1CJ5A 3ELXA 2OVDA 3KZAA 3WATA 5C0PA 3APUA 2BLGA 1YI7A 2KW1A 4N2RA 1ICNA 3RWKX 4U3QA 3G7XA 3NQ9A 3UEUA 3EYCA 2F73A 3HWGA 4OMWA 1QFTA 3LHNA 3VT0A 1ERXA 4LZVA 2HLVA 5FFHA 1MX7A 5F6BA 3C2UA 5FKCA 5GLOA 3CWKA 4U9CA 1GYHA 3WPVA 4ML7B 3LFIA 4D47A 3FIQA 2P8GA 3NQ3A 5F6ZA 2OFMX 3FELA 1MX8A 5HWZA 4KT5A 4ON1A 3P6HA 2HNXA 1GT3A 3P24A 1UREA 4MISA 1GKAA 3NQKA 3CQNA 4O9SA 2HYSA 4NOVA 2AL0X 3HK1A 2OVSA 1PMPA 5FLWA 5FMCA 4ZH9A 4ZHFA 4U6DA 3WMZA 1FTPA 3E3CA 4LZUA 4N7DA 5KICA 1TVQA 3RWXA 4D6AA 5BVTA 5JR8A 1G7NA 2X45A 1JV4A 1Z24A 3JS1A 4O4UA 5FQ8E 3EBKA 2OXBA 5A8DA 2QQVA 5LJBA 1BRPA 3JSQA 4OMXA 1PM1X 2HZRA 4EQVA 5EDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CU9 A;  3SC7 X;  2X8F A;  3VSF A;  3ZXK A;  3WPZ A;  5B6T A;  3BYL A;  3LV4 A;  2AC1 A;  5FMB A;  3WN2 A;  2QQU A;  4COT A;  3QC2 A;  4UDK E;  5GLN A;  5FK7 A;  1UYP A;  3QED A;  3KF3 A;  2X8S A;  4PVA A;  3U75 A;  3P2N A;  3QEE A;  4AK6 A;  3QEF A;  3UGH A;  5A7V B;  5GLM A;  4PVI A;  2B4W A;  3BYK A;  2EXI A;  4FFI A;  2RN4 A;  1Y7B A;  3VSZ A;  1VKD A;  3D60 A;  3VSS A;  3VT2 A;  5JOX A;  5AYE A;  1JIW I;  3LDK A;  5AY9 A;  5GLK A;  3WPU A;  5JOY A;  2X8T A;  3QZ4 A;  3WN1 A;  3OM6 A;  2AEY A;  3LIG A;  3WMY A;  3UGG A;  1YIF A;  3WAU A;  3LIH A;  3R67 A;  5A7V A;  3U14 A;  3K1U A;  3ZXL A;  3PIJ A;  2VDT A;  2YFS A;  3C7H A;  4AK5 A;  2EXH A;  3C7F A;  3KF5 A;  3R4Y A;  1YRZ A;  4O8O A;  5FK8 A;  2XQR A;  3LF7 A;  3UGF A;  4UDG A;  3C7G A;  4KC7 A;  4N2Z A;  2YFR A;  4KCA A;  5GLL A;  3D5Y A;  4KC8 A;  3NQH A;  4AK7 A;  3WN0 A;  3BYN A;  5AYC A;  3AKI A;  5GLR A;  3AKF A;  3D5Z A;  1GYE B;  4UDI A;  3WAS A;  1Y9G A;  4UDK A;  3WAT A;  1OYG A;  4MLG A;  1YI7 A;  5C0P A;  4N2R A;  3RWK X;  3OM7 A;  4KMI A;  5JOW A;  3AKH A;  5FIX A;  3LEM A;  5B6S A;  3PIG A;  1PT2 A;  1SMP I;  3VT0 A;  4ONZ A;  3WPY A;  2QQW A;  3C2U A;  5FKC A;  5GLO A;  1Y9M A;  1GYH A;  2AEZ A;  1UV4 A;  3WPV A;  3LFI A;  4D47 A;  5A8C A;  4KCB A;  1W2T A;  5FMD A;  1WL7 A;  3AKG A;  5FKB A;  3LDR A;  4N1I A;  5ANN A;  4O8N A;  4U6B A;  4QQS A;  5GLP A;  3BYJ A;  1Y4W A;  4FFG A;  3OM4 A;  3OM2 A;  4NOV A;  2ADD A;  3KST A;  3VSR A;  5FLW A;  5FMC A;  4U6D A;  3WMZ A;  3R4Z A;  2YFT A;  3VT1 A;  1W18 A;  3ZXJ A;  4N4B A;  4O8P A;  2EXK A;  3TAW A;  3C7E A;  4FFH A;  3OM5 A;  3C7O A;  1ST8 A;  2EXJ A;  4FFF A;  4UDJ A;  3D61 A;  2OXB A;  5A8D A;  2QQV A;  5AYD A;  5JOZ A;  2ADE A;  5GLQ A;  4EQV A;  1GYD B; 
#chains in the Genus database with same CATH topology
 2MJI A;  3PDF A;  5L8I A;  2K23 A;  4DQ3 A;  3WPZ A;  3MG5 A;  2AC1 A;  3WJC A;  1D3S A;  3QC2 A;  2NND A;  2A3F X;  1SRJ A;  4HPA A;  1W4T A;  1S7D A;  4EDE A;  2GTL O;  4YFP A;  4Y0Q A;  3T6L A;  3BSZ E;  1LF7 A;  4MEE A;  3ZQ3 A;  2OFA A;  1T68 X;  4RUN A;  3RDU A;  3IA8 A;  3UEW A;  4OS3 A;  1CBS A;  3TGA A;  4DNE A;  1YIF A;  3GE2 A;  4NLI A;  3RDM A;  4YCH A;  1XCA A;  2AT6 X;  5EEE A;  1N0S A;  4KC8 A;  4BJ8 A;  4JO6 A;  3AKI A;  4Z28 A;  4NYQ A;  4MVL A;  4KMI A;  4ZGU A;  5C2M A;  1I4U A;  5EED A;  2WUT A;  1BBP A;  2OZQ A;  4LKT A;  4CV7 A;  1LDO A;  3NAD A;  5IRA A;  1VWK B;  4IB9 A;  1EPB A;  3VG5 A;  5LKE A;  4GH7 A;  4QQS A;  3L4R A;  5LJE A;  5B10 O;  4O3Z A;  1HQP A;  2ALL X;  3T1D A;  1OSP O;  4ORS A;  1SY2 A;  5F58 A;  2R73 A;  3ZW0 B;  2R56 A;  4YFR A;  4YVB A;  1ALB A;  4A8Z A;  3OM5 A;  3KVN A;  4GET A;  5AYD A;  2FKG A;  3S26 A;  1EI5 A;  1LIB A;  1IIU A;  3PH5 A;  4XMF A;  5FK7 A;  3MVF A;  1FEN A;  3FYF A;  1JZU A;  3KF3 A;  3VU1 A;  1SWJ A;  4CDF A;  1SRH A;  1Y7B A;  3B2K A;  2NNQ A;  2CM4 A;  3UAQ A;  2L9C A;  3STN A;  5FQ7 E;  5HCC C;  3RKG A;  2IZG B;  4GGR A;  1MDC A;  2Z4H A;  3BS2 A;  4O4S A;  2RQ0 A;  2CZT A;  2YFR A;  1VWB B;  3OE3 A;  3BYN A;  1S2P A;  5L3Y A;  1TOW A;  3BX7 A;  1SXX A;  5HZQ A;  5BVQ A;  3WYQ A;  3PEC A;  1DFV A;  2QO6 A;  3VG6 A;  2IZE B;  1ML7 A;  4NV7 A;  3WPY A;  1N9Y A;  1O1U A;  4QNI A;  1SWB A;  1UV4 A;  3HTY A;  1EUO A;  2Y3E A;  1RBP A;  1W2T A;  5HAE A;  4MIR A;  4Z2O A;  1G5W A;  4U6B A;  2GC9 A;  3PP6 A;  2ADD A;  4FBV A;  2YFT A;  3ZWE A;  1LPJ A;  3UEV A;  1U0X A;  3RE6 A;  4GNY A;  1IW2 A;  2N93 A;  1VWC B;  3S60 A;  1G74 A;  2FLJ A;  1KZX A;  2FR3 A;  1LFO A;  4ES7 A;  1BSQ A;  3HWF A;  1H91 A;  4GE1 A;  4OS0 A;  1UYO X;  1ICM A;  2B4W A;  2LA7 A;  3BYK A;  1VWN B;  4OKA A;  2KTD A;  4UU3 A;  2Y32 A;  4ORW A;  2DJF A;  2X4M A;  2X8T A;  3FR2 A;  2A2U A;  5HZ9 A;  3OBL A;  3FID A;  2Z4I A;  5EDB A;  3LIH A;  3VHH A;  1A57 A;  2ACO A;  5H8T A;  3C7F A;  2LB6 A;  2OYB O;  2FS6 A;  5IRW A;  1BWY A;  2QO5 A;  3AKN A;  1VYG A;  1KQW A;  4CPI A;  2LBA A;  3NQH A;  4TKH A;  5KID A;  1JJJ A;  4MLG A;  2NNE A;  3AUM O;  1BM5 A;  3NP1 A;  5B6S A;  1GT5 A;  2FWV A;  4LKP A;  4Z27 A;  4ZHD A;  4B55 A;  3KFG A;  5A8C A;  2RTA A;  4YCE A;  4YGG A;  3VG7 A;  4A60 A;  2IZL B;  3C78 X;  3FW4 A;  1VWO B;  4HPB A;  1SWA A;  4XME A;  1FDQ A;  3WJD A;  1A2D A;  1W5R A;  3C7E A;  2AKQ A;  2CZU A;  1VYO A;  1KT3 A;  2ZAI A;  1SWU A;  3ZW1 B;  1SWO A;  2GTL M;  5GLQ A;  1ZNE A;  4CDC A;  1O1V A;  3APW A;  1N43 A;  4BX5 B;  4ZR2 A;  1B8E A;  4UDK E;  3VHI A;  1KT5 A;  2X8S A;  1SWL A;  3QEE A;  1GGL A;  2M4L A;  4Y0S A;  3ZUO A;  2GJ5 A;  1DZP A;  2WR6 A;  2AT0 X;  3WBG A;  5JOX A;  4XMH A;  4Y0R A;  3P6D A;  2NP1 A;  2QM9 A;  3UEX A;  1SWS A;  4R0B A;  2ANS A;  2WQA E;  1VWP B;  3CR6 A;  4CPH A;  4BX7 B;  1LIE A;  3WJE A;  1NP1 A;  2YFS A;  2EU7 X;  3FEP A;  2XQR A;  4AK7 A;  5GLR A;  1RXK A;  2L68 A;  1E00 A;  1GYE B;  3T6F A;  3FW5 A;  4AYH A;  3VE1 A;  3KZA A;  2MF6 A;  5C0P A;  3APU A;  1YI7 A;  2KW1 A;  1MK5 A;  4BBO A;  3NQ9 A;  3AEH A;  3LHN A;  2UYW A;  1ERX A;  5FKC A;  2OY8 A;  3CWK A;  4ML7 B;  4D47 A;  2OY7 A;  3NQ3 A;  3FEL A;  1MX8 A;  4CPF A;  1N4J A;  1URE A;  1GKA A;  3HK1 A;  3WMZ A;  1SRE A;  1HXL A;  4DCB A;  3RWX A;  1JV4 A;  1STP A;  3EBK A;  2QQV A;  1SXU A;  3ZXK A;  1DZM A;  3PED A;  3EBW A;  2QQU A;  2PY1 A;  4NYR A;  1YUP A;  4CK4 A;  3KFI A;  2O62 A;  3P2N A;  4AK6 A;  1E5P A;  4O3Y A;  3ZW1 A;  3NBX X;  4XMG A;  2IFB A;  4O49 A;  4UU2 A;  1R0U A;  4ID2 A;  4ORR A;  1AQB A;  1QY0 A;  2AVI A;  3S5V A;  2ZSC A;  1SXY A;  2OF8 A;  3UGF A;  4HFO A;  3C7G A;  5HTE A;  3RDS A;  5F7G A;  4KCA A;  1SLF B;  5HZ6 A;  3VG4 A;  1LID A;  4YDA A;  2LFO A;  4C5P A;  5K68 A;  3I0A A;  2LKK A;  1EW3 A;  1NQN A;  2BS6 A;  1NBX A;  3EC5 A;  4YMY A;  4IMN A;  4IRW A;  1WL7 A;  1L6M A;  4YGZ A;  3BYJ A;  4NNT A;  1RSU B;  4GK9 A;  4ALB A;  2ZAG A;  3ZXJ A;  4JNJ A;  1GXA A;  3SOT A;  4TQ2 A;  1U18 A;  2EXJ A;  1SLE B;  4UDJ A;  1VWL B;  1E2T A;  2X8F A;  3HPE A;  4MVI A;  4ZFX A;  1X8U A;  3STK A;  1NC9 A;  4INN A;  3MBT A;  4ZCB A;  4XMD A;  3I17 A;  5C0N A;  2FS7 A;  1PEE A;  2JGS A;  2FHN X;  2MO5 A;  1X8P A;  3BLG A;  3P6C A;  1HBP A;  5H9A A;  3KQ0 A;  3P6F A;  5GLK A;  1KQX A;  3PQS A;  1VWM B;  2OL7 A;  1JMZ A;  4BX6 B;  2AEY A;  1X8O A;  4GKC A;  3B2J A;  3WAU A;  3ZXL A;  1FEL A;  2JU8 A;  3QKG A;  5CE4 A;  5D45 A;  2Q39 A;  5K06 A;  1W6F A;  4O4O A;  3RBY A;  4OEM A;  1FJ1 E;  1GX8 A;  5DPQ A;  4IB7 A;  4ALO A;  4KII A;  1VWR B;  4ONZ A;  4HPD A;  4U8U M;  1SWG A;  1Y9M A;  3EW2 A;  5EZ2 A;  1QWD A;  3C76 X;  2I5V O;  5CSE A;  4LQZ A;  4N1I A;  1Y4W A;  1P6P A;  3OM4 A;  4NNS A;  3TF6 A;  3K3L A;  4PJ2 A;  5L8O A;  3C77 X;  1UZ2 X;  4QQ1 A;  1SRG A;  3CKF A;  1VWF B;  4FGI B;  4YH0 A;  2A2G A;  3SC7 X;  3S5X A;  3OD9 A;  3QED A;  2HKD A;  4BVM A;  1YWA A;  3PK2 A;  1NQM A;  5A7V B;  5HCD C;  1ZNH A;  3F6Z B;  3SZI A;  4GGT A;  1VWE B;  5K67 A;  2A5C A;  1X8N A;  4AZN A;  2KT4 B;  2GTF X;  2WEX A;  3NX2 A;  2OFR X;  4Z2V A;  5FAZ A;  4OEL A;  3K1U A;  3GAQ A;  2A5B A;  1YRZ A;  4I9S A;  4IAW A;  4QYN A;  1AVD A;  1T0V A;  5AYC A;  5HTD A;  1VWG B;  4BX6 A;  2KTS A;  1SXW A;  3TGB A;  4WHI A;  3D9W A;  5IO6 A;  1JBH A;  3LEM A;  2RTK A;  4ZJ0 A;  2CBR A;  2HMB A;  5LKF A;  4I95 A;  3IFB A;  2AEZ A;  3CBS A;  4KCB A;  2CM9 A;  5HA0 A;  1DC9 A;  5HZ5 A;  5F1E A;  4ZHH A;  3TAW A;  5IO5 A;  1OPB A;  2RCT A;  4AZR A;  1CRB A;  1ZNL A;  1LCV A;  3DTQ A;  2XKL A;  3PPT A;  3PQU A;  4BQU A;  4RUU A;  1X71 A;  4YDB A;  5HZ8 A;  1BRQ A;  4YFQ A;  4GDZ A;  2UZ2 A;  3NR3 A;  4GGZ A;  1JIW I;  4PSQ A;  3D97 A;  3QZ4 A;  4NP1 A;  3TZS A;  1OEJ A;  1Y53 X;  3HOL A;  1DV9 A;  2IZJ A;  3F9D A;  5A7V A;  1EPA A;  3ZW0 A;  3VPJ E;  3RSW A;  2W2A A;  3O2Y A;  2EXH A;  1KZW A;  2QCB A;  2BSZ A;  2MHD A;  4N2Z A;  4FQB B;  3RDX A;  2PI3 O;  3WN0 A;  1YIV A;  2AT8 X;  1S44 A;  3BX8 A;  3P6G A;  1CJ5 A;  3RY2 A;  3WAT A;  4N2R A;  1ICN A;  3G7X A;  2RTO B;  3FDC A;  2F73 A;  4OMW A;  5JD2 A;  3VT0 A;  3C2U A;  2HLV A;  1MX7 A;  4U9C A;  1KL4 A;  3LFI A;  2G5L A;  4EKV A;  2RTL A;  3P24 A;  4CPE A;  4MIS A;  4O9S A;  2RTF B;  2HYS A;  2FKJ A;  1SWE A;  2OVS A;  3RDQ A;  5FMC A;  4ZHF A;  2F01 A;  4LZU A;  1K3B A;  4N7D A;  1Y55 X;  1G7N A;  3JS1 A;  1Z24 A;  1JQP A;  5A8D A;  4EQV A;  5EDC A;  1IKJ A;  2WWP A;  3FR5 A;  5FMB A;  1CBI A;  1YP6 A;  2VFC A;  3SZJ A;  1UYP A;  2ASN X;  1QY2 A;  3FA8 A;  4EXZ A;  3HOE A;  1T8V A;  1IKE A;  1HXZ A;  3KFH A;  4QZT A;  1VKD A;  2OF9 A;  1STS B;  1BSY A;  3U0D A;  1NGL A;  3LIG A;  3FA9 A;  3R67 A;  2XST A;  1SWQ A;  1N7Y A;  4GJS A;  3C7H A;  4AW8 A;  5HA1 A;  1SRF A;  4BCS A;  4GNW A;  3PH6 A;  4ZH6 A;  5GLL A;  1CBQ A;  5FEN A;  3SLO A;  1ZNK A;  1OEK A;  3ZW2 A;  5B5G A;  4ARH A;  3AKH A;  1MUP A;  5FIX A;  1RAV A;  2RA6 A;  4CSB A;  2JU3 A;  3VE2 A;  2OFB A;  5AJC A;  1OBP A;  2RTC B;  2E4J A;  1DZJ A;  1SWR A;  3BU1 A;  4YGH A;  5FKB A;  3WOV A;  1X8Q A;  1VYF A;  5LJH A;  2MM3 A;  3VT1 A;  4QAE A;  3APX A;  4WFV A;  1YWD A;  5IO7 A;  5JOZ A;  4YKM A;  2WSJ A;  2OY5 O;  2FHL A;  4I60 A;  4ODD A;  2Q4N A;  4TNN A;  1I06 A;  3QEF A;  1ADL A;  3VG2 A;  1FE3 A;  1TOU A;  2GH7 A;  4QZU A;  5B3M O;  1CBR A;  3FEN A;  5H9K A;  2QMI A;  2QOM A;  4WFU A;  4YKO A;  1OBQ A;  1EQD A;  1VWH B;  2RTE B;  4M6S A;  3HWE A;  3WJF A;  1QY1 A;  3D96 A;  3STM X;  1TW4 A;  2WPU A;  3WJG A;  4FBO A;  4BX5 A;  1O8V A;  3WZQ A;  1KXO A;  2Y3F A;  1SY1 A;  5HBS A;  3BDR A;  2Q2M A;  1SWN A;  1GT1 A;  2A0A A;  3V8U A;  3B2I A;  4O3W A;  5FMD A;  3BRN A;  3FR4 A;  4BX7 A;  3FA7 A;  2RCQ A;  2EXK A;  1ST8 A;  1OPA A;  2AT5 X;  1MVG A;  1BEB A;  2BHV A;  5D48 A;  1KL5 A;  1KOI A;  1HBQ A;  4IB8 A;  5DG4 A;  1QAB E;  1KL3 A;  3U75 A;  1YP7 A;  1MM9 A;  4EFG A;  3UGH A;  3FMZ A;  3CBC A;  2C1S A;  4TKJ A;  4L3R A;  2FT9 A;  1SWP A;  1DF8 A;  2JMB A;  4QRL A;  2JW1 A;  2G7B A;  3UGG A;  3QQ2 A;  3CKG A;  2WQ9 A;  4Y5D A;  2Q9S A;  4EQA C;  2IZH B;  3KF5 A;  4O8O A;  4UDG A;  3F8A A;  3WJB A;  4O3X B;  2OL8 O;  1HMS A;  3RZY A;  4I6S A;  1VWI B;  4M7M A;  1I78 A;  5JOW A;  3VG3 A;  1AB0 A;  1NP4 A;  5D8J A;  3WVM A;  4TLJ A;  2HZQ A;  5B5F A;  4HWM A;  3LDR A;  1GM6 A;  5ANN A;  4O8N A;  2RTM A;  1BLR A;  1QG5 A;  1YWB A;  4FFG A;  1KFF A;  3JQO A;  3U03 A;  4QGV A;  5EPQ A;  4N4B A;  4FFH A;  3C7O A;  1E06 A;  2IZI A;  2FRS A;  4IAX A;  4ORY A;  4ZHC A;  3O22 A;  2RTR B;  1KT6 A;  1AEL A;  2JN3 A;  1X89 A;  1SWT A;  2CBS A;  2VFB A;  5AEO A;  3FLL A;  2Q2P A;  1GX9 A;  3T2W A;  1WBI A;  2RTQ B;  1ACD A;  1SLG B;  3WZP A;  4HPC A;  5AY9 A;  1SA8 A;  1NDJ A;  4EEJ A;  1SRI A;  2ACP X;  4O4X A;  3X00 A;  5CYB A;  3SLT A;  2DJG A;  3D4R A;  2IZA A;  1VWQ B;  3U14 A;  1E02 A;  1DF3 A;  1A3Y A;  3B2L A;  1Y52 X;  2A13 A;  3WZN A;  3LF7 A;  1GT4 A;  3NX1 A;  3O19 A;  3VHM A;  3AKF A;  3D5Z A;  5HCE C;  1Y0G A;  2F09 A;  2IZC B;  3ELX A;  1RXJ A;  2BLG A;  2RTI B;  2RTJ A;  4GUZ A;  3HWG A;  3SZH A;  1QFT A;  3RDO A;  1WUB A;  4LZV A;  5FFH A;  1RST B;  4GJV A;  2G8C O;  3FIQ A;  2P8G A;  5F6Z A;  4ON1 A;  2HNX A;  4NOV A;  2AL0 X;  1PMP A;  5FLW A;  4ZH9 A;  5IRU A;  3VGW A;  5KIC A;  1LEL A;  1TVQ A;  5CHK A;  4D6A A;  5BVT A;  5JR8 A;  2X45 A;  4O4U A;  5FQ8 E;  2OXB A;  5LJB A;  1BRP A;  4OMX A;  1PM1 X;  4GD9 A;  2I5Z O;  3BY0 A;  5L8N A;  2GTL N;  2X34 A;  5AQ6 A;  2AF5 A;  1HN2 A;  1ZND A;  2VDF A;  1SWC A;  5LJG A;  4PVI A;  2RN4 A;  3VSZ A;  3ZI8 A;  2X56 A;  1VWD B;  5AYE A;  4NLJ A;  3CQR A;  4A1Y A;  3OJY C;  1EXS A;  5B29 A;  1AVE A;  3WMY A;  1ZNG A;  1I9H A;  2WEW A;  1D2U A;  1PTS A;  2JOZ A;  4FBR A;  3PIJ A;  1GX3 A;  5BYP A;  1IFC A;  4KC7 A;  1I04 A;  4BOE A;  1LCW A;  4L1N A;  1N9M A;  2IZF B;  2X32 A;  4UDI A;  4MVK A;  4I3B A;  4UDK A;  4ZHG A;  2AT3 X;  4D6B A;  4JGL A;  2RTB B;  1PT2 A;  4XMC A;  1SY0 A;  5AJB A;  3EW1 A;  2W2F A;  3P6E A;  3Q6L A;  2JU7 A;  4YBP A;  1EII A;  5GLP A;  2X46 A;  2OY1 O;  1SY3 A;  4K19 A;  1KT7 A;  3RY1 A;  3OM2 A;  2RTG B;  3VSR A;  4CPH B;  5B27 A;  1HY2 A;  1YWC A;  2QO4 A;  1B4M A;  4TJZ A;  1LDQ A;  1W18 A;  3FA6 A;  4I9R A;  4FFF A;  3D61 A;  4GZV A;  4GDA A;  1ERB A;  4Z2P A;  1GYD B;  3CU9 A;  3VSF A;  4AZP A;  5B6T A;  4Z6J A;  4AZQ A;  3WN2 A;  4COT A;  3Q34 A;  4AZO A;  3T2X A;  1STR B;  2RTD B;  3SAO A;  1SWK A;  1SWD A;  5GLM A;  3WXQ A;  3P02 A;  2OVE A;  4QYP A;  5LJC A;  3D60 A;  4NV8 A;  3LDK A;  5JOY A;  1JJU A;  3RE5 A;  2C4I A;  3OM6 A;  1GKA B;  2BC3 A;  1IFB A;  2QOS C;  4CDD A;  3DSZ A;  3D95 A;  1OBU A;  2KD2 A;  4AK5 A;  2G78 A;  5D47 A;  5B2A O;  3U9P C;  3B2H A;  5FK8 A;  1JYJ A;  3N91 A;  1SWF A;  1U17 A;  4KH8 A;  2IZK A;  4AZM A;  4I3D A;  1OYG A;  4A1H A;  3OM7 A;  2IZD B;  1TXL A;  4U8U O;  3PIG A;  2AH7 X;  3ZZV A;  1SMP I;  2QQW A;  1BJ7 A;  1DZK A;  2K62 A;  4OS8 A;  4QGX A;  1PBY A;  2CAM A;  4MVE A;  1FEM A;  1VWJ B;  1Y9T A;  3KST A;  3HWD A;  1RLB E;  2X55 A;  2FGS A;  3R4Z A;  4Y0P A;  4O8P A;  3WYP A;  3H3I A;  5B11 O;  2L67 A;  3ELZ A;  2R74 A;  2ADE A;  2MWH A;  3EMM A;  5F2B A;  2IZB A;  1LIF A;  2C1Q A;  1JJX A;  3BYL A;  1MEP A;  4ORX A;  2BT9 A;  5FQ6 E;  5H9N A;  1K24 A;  4WBK A;  5GLN A;  2AMM X;  4U46 A;  1LKE A;  1BSO A;  1SWH A;  4YBU A;  5IXG A;  2EXI A;  4FFI A;  1G85 A;  1LUQ A;  3VT2 A;  1LIC A;  2G79 A;  3WPU A;  3WN1 A;  3AKM A;  4N7C A;  3NPO A;  2A8G A;  1OEE A;  2VDT A;  3BU9 A;  3EM0 A;  3R4Y A;  1UYN X;  3FEK A;  3CMP A;  2L5P A;  2LBV A;  5BVS A;  1TL2 A;  4IAB A;  3WAS A;  1Y9G A;  1B0O A;  1VPR A;  2YMS A;  3WZO A;  1AVG I;  1LNM A;  1JYD A;  4ORU A;  3LTW A;  3ZUI A;  1XKI A;  1Y9L A;  4CDE A;  4U8U N;  5H9L A;  1KT4 A;  3AKG A;  1HMR A;  3SLJ A;  3APV A;  1QQS A;  4TKB A;  2W2B A;  4IMO A;  4IB6 A;  5LJD A;  4ZGF A;  3KFF A;  1PBO A;  2DM5 A;  1EAL A;  5KHP A;  5LJK A;  3MX7 A;  2RD7 C;  5D4A A;  3LV4 A;  2YG2 A;  1ZRY A;  4NW4 A;  4PVA A;  1MOY A;  4GRJ A;  4BGF A;  1B56 A;  1HQQ A;  4GU8 A;  3VSS A;  2RTH B;  3TGC A;  2OL6 O;  4DQ4 A;  1A18 A;  1I05 A;  4QGW A;  4I3C A;  2RTP B;  1KGL A;  4Y59 A;  4IBA A;  2FR2 A;  2FTB A;  2BS5 A;  4JHQ A;  1EIO A;  3D5Y A;  1HMT A;  1QFV A;  2OVA A;  2POA A;  2OVD A;  1VWA B;  3RWK X;  4U3Q A;  3UEU A;  3EYC A;  2RTN B;  5F6B A;  5GLO A;  1GYH A;  3WPV A;  2OFM X;  1LCZ A;  5HWZ A;  4KT5 A;  3P6H A;  1JMX A;  1GT3 A;  3NQK A;  3CQN A;  4U6D A;  1FTP A;  1RXH A;  3E3C A;  1SLD B;  3JSQ A;  1IJ8 A;  3MM0 A;  2HZR A; 
#chains in the Genus database with same CATH homology
 2MJI A;  1SXU A;  3BY0 A;  5L8I A;  1IKJ A;  2K23 A;  4DQ3 A;  3ZXK A;  3WPZ A;  5L8N A;  2GTL N;  2WWP A;  1DZM A;  3FR5 A;  3PED A;  1CBI A;  2AC1 A;  5FMB A;  3EBW A;  3WJC A;  2PY1 A;  2QQU A;  4NYR A;  1D3S A;  5AQ6 A;  3QC2 A;  1YP6 A;  2NND A;  1UYP A;  1YUP A;  4CK4 A;  2A3F X;  1HN2 A;  2ASN X;  3KFI A;  1QY2 A;  3FA8 A;  1ZND A;  2O62 A;  3P2N A;  4HPA A;  4AK6 A;  1S7D A;  1E5P A;  5LJG A;  4EXZ A;  3HOE A;  4EDE A;  4PVI A;  2GTL O;  4YFP A;  4O3Y A;  1T8V A;  3ZW1 A;  3NBX X;  1IKE A;  2IFB A;  2RN4 A;  3KFH A;  4QZT A;  4XMG A;  4Y0Q A;  4O49 A;  3ZI8 A;  1VKD A;  3VSZ A;  5AYE A;  4NLJ A;  3BSZ E;  1BSY A;  1LF7 A;  3ZQ3 A;  3CQR A;  1T68 X;  4UU2 A;  4A1Y A;  1R0U A;  4ID2 A;  4ORR A;  1AQB A;  1QY0 A;  4RUN A;  3U0D A;  3OJY C;  1NGL A;  1EXS A;  3IA8 A;  5B29 A;  3UEW A;  3LIG A;  4OS3 A;  1CBS A;  1ZNG A;  3FA9 A;  3S5V A;  3WMY A;  3TGA A;  1YIF A;  2WEW A;  1D2U A;  3R67 A;  2JOZ A;  3GE2 A;  2XST A;  4FBR A;  1SXY A;  4NLI A;  3PIJ A;  3C7H A;  4AW8 A;  5HA1 A;  5BYP A;  4YCH A;  4GNW A;  3PH6 A;  1IFC A;  1XCA A;  2AT6 X;  4HFO A;  5EEE A;  4ZH6 A;  3C7G A;  1N0S A;  3UGF A;  5HTE A;  4KC7 A;  5F7G A;  1I04 A;  4KCA A;  4BOE A;  5GLL A;  1CBQ A;  4KC8 A;  5FEN A;  4L1N A;  5HZ6 A;  3VG4 A;  1LID A;  3AKI A;  4YDA A;  2LFO A;  4UDI A;  4MVK A;  4I3B A;  3I0A A;  1ZNK A;  4UDK A;  1OEK A;  4NYQ A;  2LKK A;  4ZHG A;  2AT3 X;  1EW3 A;  4MVL A;  3ZW2 A;  4D6B A;  4ARH A;  4ZGU A;  4KMI A;  1I4U A;  4JGL A;  5EED A;  2WUT A;  3AKH A;  1MUP A;  5FIX A;  1BBP A;  2RA6 A;  4CSB A;  2OZQ A;  2BS6 A;  1PT2 A;  4LKT A;  4XMC A;  4CV7 A;  2JU3 A;  3NAD A;  1SY0 A;  3VE2 A;  5AJC A;  1OBP A;  5AJB A;  4YMY A;  2E4J A;  4IMN A;  1DZJ A;  3BU1 A;  4YGH A;  2W2F A;  3P6E A;  4IB9 A;  1EPB A;  3Q6L A;  3VG5 A;  5LKE A;  1L6M A;  2JU7 A;  1WL7 A;  5FKB A;  4YGZ A;  4GH7 A;  3WOV A;  4YBP A;  1EII A;  4QQS A;  2X46 A;  5GLP A;  3L4R A;  5LJE A;  1SY3 A;  1X8Q A;  4K19 A;  3BYJ A;  1VYF A;  1KT7 A;  3OM2 A;  4NNT A;  4O3Z A;  4GK9 A;  1HQP A;  5B27 A;  3VSR A;  2ALL X;  3T1D A;  4ALB A;  5LJH A;  1YWC A;  2MM3 A;  3VT1 A;  2QO4 A;  2ZAG A;  1SY2 A;  4ORS A;  4QAE A;  4TJZ A;  5F58 A;  1B4M A;  2R73 A;  3ZW0 B;  1W18 A;  3ZXJ A;  3APX A;  4WFV A;  2R56 A;  4YFR A;  3FA6 A;  1ALB A;  4A8Z A;  1GXA A;  4I9R A;  3OM5 A;  3SOT A;  4TQ2 A;  1U18 A;  2EXJ A;  4FFF A;  4UDJ A;  3D61 A;  4GET A;  4GZV A;  1YWD A;  5IO7 A;  5AYD A;  1ERB A;  5JOZ A;  4YKM A;  2WSJ A;  3S26 A;  1GYD B;  3CU9 A;  1EI5 A;  2X8F A;  4MVI A;  3VSF A;  4AZP A;  5B6T A;  1LIB A;  4ZFX A;  1X8U A;  1IIU A;  4AZQ A;  3STK A;  3WN2 A;  3PH5 A;  4INN A;  3MBT A;  4ZCB A;  4COT A;  4XMD A;  4XMF A;  4AZO A;  3I17 A;  5FK7 A;  3MVF A;  1FEN A;  3FYF A;  5C0N A;  1JZU A;  4ODD A;  3KF3 A;  2Q4N A;  4TNN A;  1I06 A;  3SAO A;  1ADL A;  2FS7 A;  1FE3 A;  1PEE A;  3VG2 A;  3VU1 A;  3QEF A;  5GLM A;  3WXQ A;  1TOU A;  4QZU A;  2MO5 A;  1X8P A;  3BLG A;  3P02 A;  2OVE A;  4QYP A;  5LJC A;  1Y7B A;  1CBR A;  3P6C A;  3D60 A;  1HBP A;  3B2K A;  5H9A A;  2NNQ A;  3KQ0 A;  3LDK A;  3P6F A;  5GLK A;  5JOY A;  2CM4 A;  1KQX A;  3UAQ A;  3FEN A;  3PQS A;  5H9K A;  2QMI A;  2L9C A;  3STN A;  4WFU A;  4YKO A;  1OBQ A;  2AEY A;  3OM6 A;  1X8O A;  1GKA B;  1EQD A;  5FQ7 E;  1IFB A;  2QOS C;  4GKC A;  3RKG A;  3DSZ A;  5HCC C;  3D95 A;  3B2J A;  3WAU A;  1OBU A;  3ZXL A;  1MDC A;  1FEL A;  2KD2 A;  4AK5 A;  2JU8 A;  3QKG A;  2G78 A;  2Z4H A;  3HWE A;  4M6S A;  3B2H A;  5D45 A;  5D47 A;  3BS2 A;  3U9P C;  5CE4 A;  5FK8 A;  1JYJ A;  4O4S A;  3WJF A;  2RQ0 A;  1QY1 A;  3N91 A;  3D96 A;  3STM X;  1U17 A;  2CZT A;  2YFR A;  1TW4 A;  2Q39 A;  3OE3 A;  4KH8 A;  3BYN A;  5K06 A;  3WJG A;  1S2P A;  4AZM A;  4FBO A;  4I3D A;  4O4O A;  1TOW A;  1O8V A;  3RBY A;  3BX7 A;  1OYG A;  1GX8 A;  5DPQ A;  1SXX A;  5HZQ A;  4A1H A;  5BVQ A;  4IB7 A;  3OM7 A;  1KXO A;  3PEC A;  4ALO A;  1SY1 A;  1TXL A;  4U8U O;  1DFV A;  2QO6 A;  3VG6 A;  5HBS A;  3BDR A;  4KII A;  3PIG A;  1ML7 A;  2AH7 X;  3ZZV A;  1SMP I;  2Q2M A;  4ONZ A;  3WPY A;  1GT1 A;  1O1U A;  2A0A A;  4HPD A;  4QNI A;  4U8U M;  2QQW A;  1BJ7 A;  1DZK A;  2K62 A;  4OS8 A;  3V8U A;  1Y9M A;  4QGX A;  5EZ2 A;  1UV4 A;  3B2I A;  3HTY A;  4O3W A;  1EUO A;  1QWD A;  1RBP A;  1W2T A;  5FMD A;  5HAE A;  4MIR A;  3C76 X;  1G5W A;  3BRN A;  4LQZ A;  4MVE A;  1FEM A;  4N1I A;  4U6B A;  2GC9 A;  1Y4W A;  1Y9T A;  3FR4 A;  1P6P A;  3PP6 A;  3OM4 A;  4NNS A;  2ADD A;  3KST A;  4FBV A;  3HWD A;  1RLB E;  3K3L A;  4PJ2 A;  3TF6 A;  5L8O A;  3C77 X;  3R4Z A;  2YFT A;  3FA7 A;  4Y0P A;  4O8P A;  2RCQ A;  2EXK A;  1UZ2 X;  4QQ1 A;  3ZWE A;  1LPJ A;  3H3I A;  2L67 A;  4FGI B;  3UEV A;  1ST8 A;  1U0X A;  3ELZ A;  2R74 A;  4GNY A;  1IW2 A;  4YH0 A;  2ADE A;  1OPA A;  2AT5 X;  2MWH A;  2N93 A;  2A2G A;  3EMM A;  3S60 A;  1LIF A;  1G74 A;  1MVG A;  3SC7 X;  1BEB A;  2BHV A;  2FLJ A;  1JJX A;  5D48 A;  3BYL A;  1KZX A;  2FR3 A;  1KOI A;  1LFO A;  4ORX A;  2BT9 A;  5FQ6 E;  3S5X A;  3OD9 A;  5H9N A;  4ES7 A;  4WBK A;  1HBQ A;  1BSQ A;  3HWF A;  4IB8 A;  5DG4 A;  3QED A;  5GLN A;  4BVM A;  2AMM X;  1QAB E;  3U75 A;  1YP7 A;  1H91 A;  1LKE A;  4GE1 A;  1YWA A;  4EFG A;  3UGH A;  5A7V B;  1BSO A;  3FMZ A;  4OS0 A;  4YBU A;  5HCD C;  1ZNH A;  3CBC A;  1ICM A;  3F6Z B;  2B4W A;  2LA7 A;  3BYK A;  4TKJ A;  4L3R A;  2FT9 A;  2EXI A;  4FFI A;  4UU3 A;  2KTD A;  1G85 A;  3VT2 A;  1X8N A;  4AZN A;  1LIC A;  4ORW A;  2G79 A;  2KT4 B;  2JMB A;  4QRL A;  3WPU A;  2X8T A;  2GTF X;  3FR2 A;  2A2U A;  3WN1 A;  5HZ9 A;  3OBL A;  2WEX A;  3NX2 A;  2JW1 A;  3AKM A;  4N7C A;  2OFR X;  3NPO A;  2G7B A;  3UGG A;  2Z4I A;  5EDB A;  1OEE A;  2WQ9 A;  3LIH A;  5FAZ A;  2Q9S A;  1A57 A;  3K1U A;  4EQA C;  3GAQ A;  2VDT A;  2ACO A;  3BU9 A;  5H8T A;  3EM0 A;  3C7F A;  2LB6 A;  3KF5 A;  2FS6 A;  3R4Y A;  1YRZ A;  1BWY A;  4O8O A;  2QO5 A;  3AKN A;  4I9S A;  4IAW A;  1VYG A;  3F8A A;  4QYN A;  3WJB A;  4UDG A;  1KQW A;  3FEK A;  1T0V A;  3CMP A;  4O3X B;  2LBA A;  3NQH A;  1HMS A;  4TKH A;  2L5P A;  4I6S A;  3RZY A;  2LBV A;  5BVS A;  5HTD A;  5AYC A;  4IAB A;  3WAS A;  4M7M A;  1Y9G A;  1B0O A;  5KID A;  2KTS A;  1VPR A;  1JJJ A;  1SXW A;  4MLG A;  2NNE A;  3TGB A;  2YMS A;  1AVG I;  1LNM A;  1BM5 A;  5JOW A;  4WHI A;  1JYD A;  5IO6 A;  1JBH A;  3NP1 A;  4ORU A;  3LEM A;  5B6S A;  1GT5 A;  4ZJ0 A;  3VG3 A;  2FWV A;  2CBR A;  2HMB A;  3ZUI A;  1XKI A;  5LKF A;  4I95 A;  4LKP A;  1AB0 A;  1NP4 A;  5D8J A;  1Y9L A;  4TLJ A;  3WVM A;  3IFB A;  2AEZ A;  4ZHD A;  4U8U N;  3CBS A;  5A8C A;  3KFG A;  4KCB A;  2HZQ A;  5H9L A;  4YCE A;  4HWM A;  4YGG A;  1KT4 A;  3VG7 A;  4A60 A;  3AKG A;  1HMR A;  3LDR A;  1GM6 A;  5ANN A;  2CM9 A;  4O8N A;  3APV A;  5HA0 A;  1BLR A;  1QQS A;  1DC9 A;  1QG5 A;  1YWB A;  3C78 X;  3FW4 A;  4FFG A;  3JQO A;  2W2B A;  4QGV A;  4TKB A;  3U03 A;  4IMO A;  4IB6 A;  4HPB A;  5HZ5 A;  4XME A;  5EPQ A;  5LJD A;  5F1E A;  4N4B A;  1FDQ A;  4ZHH A;  4ZGF A;  3WJD A;  1A2D A;  3TAW A;  3C7E A;  4FFH A;  2AKQ A;  2CZU A;  3KFF A;  3C7O A;  1KT3 A;  2ZAI A;  1E06 A;  1PBO A;  3ZW1 B;  2DM5 A;  1EAL A;  2GTL M;  5IO5 A;  1OPB A;  2FRS A;  1ZNE A;  5KHP A;  3MX7 A;  4IAX A;  5LJK A;  5GLQ A;  1O1V A;  4ORY A;  2RD7 C;  3APW A;  5D4A A;  2RCT A;  4AZR A;  3O22 A;  4ZHC A;  1CRB A;  3LV4 A;  1KT6 A;  1ZNL A;  1AEL A;  3DTQ A;  2YG2 A;  4ZR2 A;  1ZRY A;  2XKL A;  1B8E A;  3PPT A;  3PQU A;  2JN3 A;  1X89 A;  4UDK E;  4NW4 A;  2CBS A;  1KT5 A;  2X8S A;  4PVA A;  5AEO A;  3QEE A;  4GRJ A;  4BQU A;  1GGL A;  2M4L A;  3FLL A;  4RUU A;  1X71 A;  2Q2P A;  1GX9 A;  4YDB A;  4Y0S A;  5HZ8 A;  3ZUO A;  2GJ5 A;  1B56 A;  1BRQ A;  1DZP A;  4YFQ A;  1ACD A;  2WR6 A;  2AT0 X;  4GDZ A;  3WBG A;  4GU8 A;  3NR3 A;  3VSS A;  5JOX A;  1JIW I;  4HPC A;  4XMH A;  3TGC A;  4PSQ A;  5AY9 A;  3D97 A;  1SA8 A;  4Y0R A;  3P6D A;  2NP1 A;  2QM9 A;  4EEJ A;  3QZ4 A;  4NP1 A;  3TZS A;  2ACP X;  3UEX A;  4O4X A;  4R0B A;  4DQ4 A;  1A18 A;  1OEJ A;  2ANS A;  2WQA E;  1I05 A;  3CR6 A;  3HOL A;  4QGW A;  5CYB A;  1DV9 A;  3D4R A;  4I3C A;  3F9D A;  5A7V A;  1EPA A;  1E02 A;  3ZW0 A;  1KGL A;  3U14 A;  1LIE A;  3WJE A;  1DF3 A;  1NP1 A;  3VPJ E;  2YFS A;  3RSW A;  2W2A A;  3O2Y A;  2EU7 X;  4IBA A;  1KZW A;  2EXH A;  1A3Y A;  3B2L A;  3FEP A;  2A13 A;  2FR2 A;  2XQR A;  3LF7 A;  1GT4 A;  2FTB A;  3NX1 A;  2BS5 A;  2MHD A;  3O19 A;  4N2Z A;  4AK7 A;  4FQB B;  1EIO A;  3D5Y A;  3WN0 A;  1YIV A;  1HMT A;  5GLR A;  2L68 A;  2AT8 X;  3AKF A;  1E00 A;  3D5Z A;  1QFV A;  1GYE B;  5HCE C;  3FW5 A;  2F09 A;  2OVA A;  3VE1 A;  4AYH A;  2POA A;  1S44 A;  3BX8 A;  3P6G A;  1CJ5 A;  3ELX A;  2OVD A;  3KZA A;  3WAT A;  5C0P A;  3APU A;  2BLG A;  1YI7 A;  2KW1 A;  4N2R A;  1ICN A;  3RWK X;  4U3Q A;  3G7X A;  3NQ9 A;  3UEU A;  3EYC A;  2F73 A;  3HWG A;  4OMW A;  1QFT A;  3LHN A;  3VT0 A;  1ERX A;  4LZV A;  2HLV A;  5FFH A;  1MX7 A;  5F6B A;  3C2U A;  5FKC A;  5GLO A;  3CWK A;  4U9C A;  1GYH A;  3WPV A;  4ML7 B;  3LFI A;  4D47 A;  3FIQ A;  2P8G A;  3NQ3 A;  5F6Z A;  2OFM X;  3FEL A;  1MX8 A;  5HWZ A;  4KT5 A;  4ON1 A;  3P6H A;  2HNX A;  1GT3 A;  3P24 A;  1URE A;  4MIS A;  1GKA A;  3NQK A;  3CQN A;  4O9S A;  2HYS A;  4NOV A;  2AL0 X;  3HK1 A;  2OVS A;  1PMP A;  5FLW A;  5FMC A;  4ZH9 A;  4ZHF A;  4U6D A;  3WMZ A;  1FTP A;  3E3C A;  4LZU A;  4N7D A;  5KIC A;  1TVQ A;  3RWX A;  4D6A A;  5BVT A;  5JR8 A;  1G7N A;  2X45 A;  1JV4 A;  1Z24 A;  3JS1 A;  4O4U A;  5FQ8 E;  3EBK A;  2OXB A;  5A8D A;  2QQV A;  5LJB A;  1BRP A;  3JSQ A;  4OMX A;  1PM1 X;  2HZR A;  4EQV A;  5EDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...