2X8SA

Crystal structure of the abn2 d171a mutant in complex with arabinotriose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
443
structure length
443
Chain Sequence
KPIFKEVSVHDPSIIETNGTFYVFGSHLASAKSNDLMQWQQLTTSVSNDNPLIPNVYEELKETFEWAQSDTLWAADVTQLADGKYYMYYNACRGDSPRSAMGVAVADNIEGPYKNKGIFLKSGMEGTSSDGTPYDATKHPNVVAPHTFFDKDGKLWMVYGSYSGGIFILEMNPKTGFPLPGQGYGKKLLGGNHSRIEGPYVLYNPDTQYYYLYLSYGGLDATGGYNIRVARSKKPDGPYYDAEGNPMLDVRGKGGTFFDDRSIEPYGVKLMGSYTFETENEKGTGYVSPGHNSAYYDEKTGRSYLIFHTRFPGRGEEHEVRVHQLFMNKDGWPVAAPYRYAGETLKEVKQKDITGTYKLIQHGKDISADIKQTINIQLNKNHTISGEMTGTWRKTGKNTADITLAGKKYNGVFLRQWDSVREKNVMTFSVLNTSGEAVWGSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ENDO-ALPHA-1,5-L-ARABINANASE
publication title New Evidence for the Role of Calcium in the Glycosidase Reaction of Gh43 Arabinanases.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 131
structure length 443
sequence length 443
chains with identical sequence B
ec nomenclature ec 3.2.1.99: Arabinan endo-1,5-alpha-L-arabinosidase.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF16369 GH43_C C-terminal lipocalin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.10 Mainly Beta Beta Barrel Lipocalin Lipocalin 2x8sA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2x8sA01
1GYEB 1JIWI 3LDRA 3KSTA 4UDGA 2AC1A 4N2RA 3OM6A 3QZ4A 3BYLA 1PT2A 3P2NA 1YRZA 3QEEA 4PVIA 5FMCA 3VT1A 5A8CA 3PIJA 5A7VA 2XQRA 3WPUA 1W2TA 1YI7A 4O8OA 4N1IA 3C7OA 3WASA 5GLKA 3KF3A 5ANNA 5GLOA 3UGGA 3AKGA 2YFSA 5FMDA 1Y9MA 3OM4A 3QEDA 1ST8A 3WAUA 3WMYA 3TAWA 3LIGA 3R67A 3OM7A 5GLQA 3UGFA 3KF5A 5FK8A 3D61A 4QQSA 3RWKX 3K1UA 1WL7A 3AKIA 5JOWA 3U75A 2EXJA 5A7VB 2OXBA 3CU9A 2X8TA 2QQVA 3OM2A 3VT2A 5AYEA 3PIGA 1Y9GA 1SMPI 2QQUA 3VSFA 3WATA 4KCBA 2VDTA 5GLLA 3AKHA 3R4YA 3ZXLA 5JOZA 2B4WA 1GYHA 4D47A 3C2UA 1Y4WA 5FLWA 4O8PA 3VSZA 5AYDA 1UV4A 3D5YA 4AK7A 2ADDA 5AYCA 4COTA 4N4BA 5FK7A 5FKBA 2AEZA 3UGHA 4KC7A 4KCAA 3LEMA 3R4ZA 3WN2A 2YFTA 2EXKA 4O8NA 4UDJA 1YIFA 5FIXA 4FFFA 3C7EA 4KC8A 4AK5A 1VKDA 4NOVA 4ONZA 3VSSA 2ADEA 4EQVA 3C7FA 3LDKA 5JOXA 5AY9A 3LV4A 4UDKA 2AEYA 3ZXJA 3BYJA 3WPYA 3BYNA 4AK6A 4KMIA 1W18A 3SC7X 3WMZA 2EXHA 3C7GA 3LF7A 1OYGA 3C7HA 4PVAA 3LIHA 5FKCA 2X8SA 2RN4A 3VT0A 5FMBA 5GLMA 5GLRA 4U6DA 3NQHA 2QQWA 5GLNA 3QEFA 3D60A 2X8FA 3D5ZA 1Y7BA 3AKFA 3WN1A 5GLPA 3BYKA 5A8DA 2EXIA 5JOYA 2YFRA 1UYPA 4UDKE 3WPZA 5B6SA 3OM5A 4FFIA 3U14A 4FFHA 3VSRA 4UDIA 3WN0A 5C0PA 3WPVA 4FFGA 1GYDB 4U6BA 4MLGA 3ZXKA 4N2ZA 3QC2A 3LFIA 5B6TA
chains in the Genus database with same CATH superfamily
3L4RA 2X56A 4UDGA 1SRFA 4ZJ0A 1IW2A 3F6ZB 4TKBA 1JBHA 1DZPA 5LKFA 3KFIA 4LQZA 5GLKA 1HMTA 4GJSA 2IZGB 4U46A 3CKFA 4I9RA 4XMCA 2X32A 2HZRA 1XCAA 2A3FX 3NPOA 2RTLA 1LIFA 3FA7A 2FWVA 1LUQA 4A60A 2AH7X 2K62A 1SRJA 2C1SA 3K3LA 5JOZA 1T8VA 1GYHA 4D47A 1U17A 3VE1A 1I9HA 2IZDB 5HA1A 1UYNX 2A13A 1KT4A 4N4BA 3WVMA 5HCDC 3RBYA 4KC7A 1NC9A 1CJ5A 2EXKA 1EIIA 1ZNGA 2G5LA 4OMXA 4ON1A 4MVEA 3FA6A 4NOVA 1GX8A 3CQNA 3CBCA 2C1QA 4CV7A 1LPJA 3FMZA 1O1VA 1DF8A 1S44A 4ODDA 5FMBA 4AZNA 2RTOB 5GLMA 1ACDA 2RCTA 3D5ZA 1Y7BA 5HZQA 1EI5A 1JV4A 3SLTA 2EXIA 2FGSA 4GGRA 2YFRA 1SWAA 4FFIA 2RTPB 2WEWA 4FFHA 5C0PA 5IRAA 2AT8X 3H3IA 1VWMB 1OEJA 4IB7A 1G7NA 3ZXKA 1SWCA 2R74A 1SWJA 2OY7A 5B5FA 3WYQA 3VT1A 3DSZA 5IO5A 2JN3A 1OBPA 1SRIA 5FMDA 3P02A 1CBIA 1SA8A 1SRHA 2OY1O 3ZUIA 4D6AA 5HZ9A 3F9DA 4EDEA 1LNMA 1SWLA 1K24A 1GT5A 3O2YA 2LA7A 1B4MA 4O3XB 2QQVA 1SXXA 2LKKA 1LDOA 3PQSA 2OL8O 3KZAA 3T1DA 4CPHA 1GKAB 2XSTA 5CSEA 2BSZA 5FLWA 2MHDA 1E2TA 5AYDA 1R0UA 2IZIA 1ALBA 3U0DA 3JS1A 1I06A 4A8ZA 1CRBA 2RTIB 2AL0X 1KQWA 1LCWA 3HPEA 3RE6A 3C7EA 2A5CA 4GRJA 3B2LA 3WZQA 4C5PA 2QO4A 2IZCB 3ZXJA 4IABA 4ZHGA 3QQ2A 4GNWA 3D9WA 4I3DA 3LF7A 4NV8A 3B2JA 3HOEA 4U6DA 2FR3A 5LJHA 1E00A 4BGFA 1AELA 4ORUA 1IKJA 2WQAE 4FFGA 1AB0A 5FQ7E 1I78A 3QC2A 2LBVA 1JJJA 5AEOA 1QY1A 1VWLB 3PDFA 1SWKA 1YRZA 1JMXA 1KGLA 4ALOA 1VWGB 1SLGB 1JJUA 2G78A 3ZWEA 1SY2A 2YFSA 3MX7A 2DJGA 4EXZA 3UGFA 2JW1A 1STSB 1RAVA 4BX7A 1YP7A 4JHQA 4K19A 4OEMA 2GTFX 4ARHA 1ADLA 1ZNKA 1HQPA 4AW8A 4AZPA 2QQUA 1Y9LA 2WWPA 3VSFA 1W6FA 1SWHA 5HWZA 5KHPA 3MG5A 2BS5A 1LIBA 5D8JA 1SWGA 1IKEA 2DJFA 5D47A 2OL6O 4ZGFA 1VWHB 3F8AA 1N43A 2VFBA 2POAA 4KH8A 4KC8A 4O9SA 2CM9A 4L3RA 4NNTA 1DC9A 1X71A 3LTWA 1BM5A 4UU3A 2EXHA 5LJDA 5AJCA 1ERXA 3BX7A 3HWFA 3BLGA 1OEEA 3S26A 5JOYA 1NQMA 5LJEA 3HWEA 1SRGA 4N7CA 3U14A 2X55A 2O62A 4MVKA 3FR4A 1MX7A 1VWFB 4DCBA 2MJIA 3I0AA 2OVDA 4YBUA 3OM6A 3P2NA 3PIJA 1SWDA 2XQRA 4O8OA 1QABE 2FT9A 3JSQA 4I95A 4YH0A 1G5WA 3WAUA 4QGXA 1MUPA 1JQPA 4GGTA 1KZWA 4QQ1A 1SXYA 5A7VB 2OXBA 4Z27A 5EZ2A 4ZCBA 3HTYA 3B2KA 3ZW2A 3SAOA 3OD9A 4YCHA 4ORWA 4DQ4A 4I3BA 4D6BA 4A1YA 4QGWA 4M6SA 4QYPA 4EFGA 3P6DA 1SLEB 1YIVA 5HZ5A 3P6HA 5H8TA 4EQVA 3LDKA 3T2WA 2JU3A 3DTQA 3D95A 4KMIA 3FIDA 2FHNX 3HWGA 1VWEB 4QZTA 2GTLO 1OEKA 3FW4A 3WJFA 1CBSA 2AT5X 4FGIB 2QO5A 4KT5A 4Y0QA 1UZ2X 1ZNLA 3IFBA 4IB6A 3AKMA 1AVEA 4CPFA 3RDUA 1TVQA 3WPUA 1W2TA 3U03A 1YI7A 2GC9A 4M7MA 1LCZA 1KXOA 1SWOA 3TZSA 2Z4HA 2X4MA 2KTDA 2IZKA 2BT9A 1HBQA 3PK2A 3D97A 3NR3A 1X8OA 2B4WA 4NP1A 4PSQA 3BU9A 2ANSA 5B29A 4B55A 3FEKA 4AZMA 1DF3A 1NGLA 1SWUA 4GZVA 4NW4A 3AEHA 1UYOX 2HLVA 1S2PA 4XMHA 1EXSA 2OF8A 1GT4A 2I5ZO 3KFHA 4ORRA 5K67A 2HNXA 5KICA 3VT0A 1LCVA 1TW4A 1A2DA 4Z2VA 3ZW1A 3APWA 4INNA 4BQUA 1BRPA 1SY0A 4GETA 2G79A 2CAMA 1OSPO 1EW3A 4BVMA 5FQ6E 4U9CA 1AVGI 4HPAA 1JYDA 5FAZA 4KIIA 2G8CO 4ML7B 4Z2PA 1ZNHA 4MVLA 1Y9MA 3FYFA 1RXHA 4FQBB 4AYHA 1BSQA 3VG6A 1D2UA 2WQ9A 1YWCA 1SWRA 4RUUA 2ACOA 4ZR2A 4IAWA 3CU9A 3VT2A 5AYEA 5AJBA 3NQKA 5HTEA 1BLRA 1KT6A 3KQ0A 5JD2A 2BC3A 1MEPA 5FK7A 3VPJE 3D96A 3EW1A 1XKIA 3BYNA 1STRB 4AZOA 4I60A 4GGZA 1W18A 3FELA 1QWDA 5GLRA 3SZJA 3FIQA 1O8VA 3G7XA 1RSTB 3MBTA 5EDCA 4YMYA 1VWPB 2Q4NA 2WUTA 2IZJA 3SZIA 1U0XA 5B5GA 1BWYA 3CWKA 2RA6A 4N2ZA 2YMSA 5B6TA 4QRLA 5IO7A 3KSTA 5H9AA 4FBOA 4Z2OA 2L9CA 4OKAA 1OPBA 3VHIA 1VPRA 5HZ6A 3UGGA 1FTPA 4MISA 2HKDA 4JGLA 4U3QA 2RTAA 1Y52X 3UEUA 1A18A 5D45A 1GXAA 2OVAA 1HQQA 1Y55X 2Y32A 4CSBA 2AT3X 1KL3A 3SOTA 3R4YA 4GKCA 2FR2A 2KTSA 1VWNB 4IB8A 1DZJA 1SY3A 1QY0A 5H9KA 3EYCA 2YFTA 4O8NA 1I05A 1SWNA 4AK5A 3JQOA 3RWXA 2VFCA 2FKJA 2W2FA 4R0BA 1N0SA 1SLDB 3RDOA 3WJGA 4BX6A 2OFRX 3OBLA 3BDRA 1FJ1E 2RN4A 3CKGA 3D60A 3WN1A 3BYKA 2K23A 1QFVA 1IIUA 1HMRA 4Z6JA 5L8OA 1ICNA 1QFTA 4QGVA 2OVEA 4ZFXA 3APUA 4ZH9A 3BU1A 1JMZA 4EKVA 3QEEA 2ZAIA 2QOMA 2P8GA 2Y3FA 1KZXA 3U9PC 4CDEA 5L3YA 5D4AA 1I4UA 4ORXA 2CZTA 5FK8A 1HXLA 4ZHDA 2EXJA 3APXA 4YBPA 3OM2A 2FKGA 2A8GA 2Q39A 2HYSA 3WATA 5BVSA 4YKMA 2A5BA 4BX5B 1N7YA 3PH6A 4OS8A 2ADDA 4COTA 3O19A 2RQ0A 1QG5A 2RTHB 4O3YA 2FHLA 4CDCA 3ZW0B 3VSSA 5JOXA 4O3ZA 4OS0A 3BYJA 4AK6A 3FR5A 4MIRA 2JMBA 1HY2A 3FENA 1OYGA 4RUNA 3OJYC 3HOLA 2JOZA 1SXUA 3WJEA 2OYBO 4XMDA 1T68X 3PQUA 3VSRA 4ID2A 2GTLM 5H9LA 3HK1A 5KIDA 4U6BA 5B27A 3VG5A 5A8CA 5F58A 5FMCA 1EPAA 2OFMX 2OZQA 1HBPA 1ICMA 1JYJA 4GD9A 2YG2A 4WFUA 4BJ8A 3AKGA 5K68A 2HZQA 4HFOA 3QEDA 1GKAA 1DZMA 2ASNX 4QAEA 4I6SA 1SREA 3AKIA 4NNSA 4L1NA 2OY5O 2N93A 2QO6A 3STKA 3WOVA 4ZHHA 3IA8A 3AKHA 3LHNA 1T0VA 4JNJA 3NADA 3NBXX 3TGCA 5AQ6A 1KT3A 1VYGA 1GX9A 4GUZA 1UV4A 3D5YA 3RDMA 5FENA 1X8UA 3AKNA 3WN2A 2GTLN 1JJXA 2EU7X 4FFFA 4YVBA 2BHVA 4TJZA 4JO6A 1KFFA 3STMX 3WPYA 1O1UA 1A3YA 2PY1A 2W2BA 1LKEA 1TL2A 2RTDB 2QQWA 2IZFB 4Y0PA 1YP6A 2MM3A 3BS2A 1SWTA 1E5PA 3OE3A 2GH7A 2RTNB 5DG4A 4TKHA 1HN2A 1GYDB 4GDAA 3LFIA 1EALA 4EEJA 1NBXA 2AC1A 1YWBA 3BRNA 3P24A 3QZ4A 3TGBA 5EPQA 4QNIA 4Y5DA 5L8NA 1HXZA 3T6FA 1NQNA 1B56A 2X45A 4TLJA 3PEDA 1NDJA 2L5PA 4NLIA 4O4SA 1X8PA 2KT4B 5GLQA 4TNNA 1EPBA 3ELZA 2A2GA 2RD7C 3ZZVA 3PIGA 2FS7A 1Y9GA 3P6GA 4WHIA 2VDTA 2RTRB 5CHKA 3PH5A 1VWCB 2WEXA 5C0NA 3UAQA 3LEMA 4YGZA 1OBQA 2MWHA 4GK9A 3VE2A 3C7FA 3WMZA 3LIHA 2Y3EA 3NQHA 4O4OA 4CPIA 3S60A 1N4JA 3VG2A 3ZQ3A 4XMGA 2R56A 5IO6A 2FS6A 3RZYA 4O4UA 3RSWA 4CPEA 1KT5A 4WFVA 3VGWA 2M4LA 1AQBA 4N2RA 1LFOA 3X00A 5A7VA 3RKGA 5B3MO 3GAQA 3UEVA 2QCBA 4OMWA 3I17A 3RY1A 3UEWA 1ST8A 1BJ7A 3TAWA 2FTBA 3KF5A 4QQSA 1BRQA 1CBQA 5DPQA 2ZSCA 3Q34A 1G74A 3U75A 2ACPX 2X8TA 4IMNA 3CBSA 3CQRA 2F01A 2LFOA 4KCBA 1MOYA 1NP4A 1W5RA 3CMPA 1SXWA 1Y0GA 4NLJA 1CBRA 1VWOB 1BSYA 1MM9A 3PECA 2PI3O 3FR2A 1RXKA 5HA0A 5AYCA 3MM0A 4Y0SA 3WZOA 1H91A 3UGHA 3R4ZA 4TQ2A 1YIFA 3MVFA 1VKDA 1HMSA 4CPHB 3LV4A 2IZHB 2RTGB 5LJCA 2CM4A 1DZKA 2X34A 1Z24A 1P6PA 1G85A 1IFBA 3PP6A 3QEFA 4MVIA 3SLOA 3BY0A 3SLJA 4XMFA 5LJKA 4YGHA 3AUMO 1MVGA 2F09A 2OVSA 5C2MA 3VHMA 3WXQA 3WN0A 3P6EA 5K06A 1Y53X 3WPVA 1GX3A 1KT7A 3RDXA 1PTSA 3RE5A 4U8UO 3WJBA 4PVIA 3FA8A 4ZGUA 3B2IA 3UEXA 4N1IA 4CK4A 3KF3A 5B10O 5GLOA 2ALLX 1VYOA 1X8NA 1WBIA 2F73A 3EC5A 3FLLA 2Q2PA 1WL7A 5LJGA 4ZHFA 2RTCB 1ZNDA 1SWQA 4AZRA 1GT1A 4Y0RA 3VG3A 2IZBA 1DFVA 3Q6LA 1STPA 2R73A 4BX7B 3V8UA 4GE1A 4AK7A 4FBRA 5HBSA 5F6ZA 2OY8A 2WPUA 5FKBA 3O22A 3NP1A 3BX8A 3P6FA 1PEEA 5AY9A 2KD2A 4ALBA 3P6CA 1UREA 4TKJA 1X89A 2RTEB 1SLFB 4Y59A 5HTDA 3EW2A 1RXJA 2X8FA 2L67A 3WPZA 4ORYA 4YDBA 2LBAA 2KW1A 4UDIA 4IBAA 1PMPA 1VWAB 2MF6A 2NNQA 5CE4A 3HWDA 3SZHA 1A57A 4MLGA 1E02A 1PM1X 2I5VO 1VWJB 5B2AO 1KL5A 3EM0A 5IXGA 2JU7A 3C7OA 4HPCA 4YFRA 4EQAC 3RY2A 3ELXA 3WMYA 1N9MA 4HPDA 2RTMA 2WR6A 3NQ3A 2UYWA 5JOWA 4IAXA 2RTFB 2RTBB 2IFBA 3C76X 3WJCA 1SY1A 3ZXLA 2JGSA 3C2UA 4MEEA 1GM6A 3VSZA 1TOUA 2RCQA 1SWEA 2AKQA 1I04A 2A0AA 2NNEA 5FIXA 5BVQA 1LICA 4DNEA 1LF7A 4ONZA 2ADEA 3VHHA 3S5XA 1PBYA 3C78X 4ZH6A 4PVAA 2RTKA 3VG4A 5F2BA 1LELA 3C77X 3WZNA 1WUBA 1MX8A 4HWMA 5GLNA 3RDQA 2AT0X 1EIOA 1KL4A 1KOIA 1SWFA 2A2UA 2CZUA 3EBWA 3KFFA 3QKGA 1MDCA 5F6BA 4N7DA 3BYLA 1PT2A 3APVA 5CYBA 5HCCC 1KQXA 1TOWA 5F7GA 1FELA 5ANNA 4O49A 3NX2A 4DQ3A 2AVIA 1FDQA 4I9SA 3FW5A 3R67A 1PBOA 1GGLA 2JU8A 3D61A 3RWKX 2G7BA 1SWPA 4CDDA 2AF5A 3S5VA 5HCEC 4UU2A 4YCEA 1Y4WA 5FFHA 2RTJA 5LJBA 1SWBA 2AMMX 5JR8A 2GJ5A 4QZUA 2XKLA 1YWDA 4YDAA 1IJ8A 3E3CA 1BEBA 3BSZE 3STNA 2OFAA 3SC7X 3C7GA 2X8SA 2C4IA 4ORSA 5BVTA 4OELA 1YWAA 1RLBE 2FLJA 2QM9A 5GLPA 4ZHCA 1ZRYA 4GH7A 1QQSA 2BS6A 5D48A 4I3CA 4GDZA 4O3WA 5BYPA 1FEMA 1NP1A 3GE2A 4IB9A 2CBRA 1VYFA 1ERBA 1GYEB 4PJ2A 1JIWI 4LZVA 2OL7A 2Q9SA 3ZW1B 1SWSA 1B0OA 3B2HA 1DV9A 4HPBA 2AT6X 4XMEA 4BX5A 3OM7A 1LIEA 4BBOA 4YGGA 3K1UA 1VWQB 1LIDA 2W2AA 2IZLB 1MK5A 1B8EA 3FA9A 1SMPI 3ZW0A 2QOSC 4GNYA 1RSUB 4Z28A 4CDFA 3VG7A 2CBSA 2NP1A 4IMOA 1EQDA 3FDCA 1VWBB 3KVNA 3FEPA 2Z4IA 2BLGA 5EEDA 1IFCA 4KCAA 1BBPA 3ZUOA 4NV7A 4UDJA 1QY2A 4GU8A 3T2XA 4UDKA 2L68A 2MO5A 3T6LA 4YKOA 4O4XA 2VDFA 3PPTA 5F1EA 5FKCA 2OFBA 3KFGA 3NQ9A 3RDSA 4NYRA 2WSJA 1FENA 4QYNA 3ZI8A 1UYPA 4UDKE 5B6SA 3OM5A 1OPAA 1GT3A 5IRUA 2IZEB 4LKPA 4BCSA 2NNDA 4LZUA 3LDRA 1VWRB 2IZAA 2DM5A 1N9YA 2Q2MA 5L8IA 2RTQB 2QMIA 3WBGA 3D4RA 5FQ8E 3WASA 1LDQA 4U8UM 3WYPA 1X8QA 1JZUA 3OM4A 3CR6A 4GJVA 3LIGA 1AVDA 5HZ8A 3N91A 1U18A 3TF6A 4BOEA 2HMBA 5B11O 4FBVA 2E4JA 2UZ2A 3EMMA 5GLLA 5EDBA 1K3BA 4WBKA 2ZAGA 4NYQA 4LKTA 5EEEA 4O8PA 3NX1A 4OS3A 5H9NA 1EUOA 1L6MA 4YFPA 3WJDA 2AEZA 1Y9TA 2FRSA 5HAEA 1VWKB 4ES7A 1VWIB 2AEYA 4A1HA 5LKEA 1RBPA 3TGAA 3C7HA 5IRWA 3WZPA 1YUPA 4IRWA 1BSOA 1FE3A 1OBUA 1ML7A 3AKFA 3EBKA 1E06A 1W4TA 2X46A 4U8UN 5A8DA 1VWDB 1S7DA 2OF9A 3VU1A 1ZNEA 4YFQA 1TXLA 4BX6B 4AZQA 2LB6A 1D3SA
chains in the Genus database with same CATH topology
1E02A 3L4RA 1PM1X 5B27A 4UDGA 3VG5A 5A8CA 5F58A 5FMCA 4ZJ0A 1IW2A 3F6ZB 4TKBA 3VU1A 1JBHA 3EM0A 1EPAA 2OFMX 1TVQA 2JU7A 3WPUA 1DZPA 2OZQA 3U03A 1W2TA 5LKFA 1HBPA 3KFIA 1YI7A 3C7OA 4HPCA 1ICMA 2GC9A 1JYJA 4LQZA 4YFRA 5GLKA 2YG2A 4WFUA 1HMTA 4M7MA 4EQAC 3AKGA 3ELXA 1KXOA 2HZQA 4HFOA 4I9RA 3QEDA 3WMYA 3TZSA 2Z4HA 4XMCA 1GKAA 1DZMA 2HZRA 2ASNX 2KTDA 4HPDA 4QAEA 1XCAA 2WR6A 2A3FX 3NPOA 4I6SA 3NQ3A 2BT9A 3AKIA 4NNSA 1LIFA 4L1NA 5JOWA 3FA7A 4IAXA 2FWVA 2N93A 2IFBA 2AH7X 4A60A 1HBQA 2K62A 3D97A 2QO6A 3STKA 3WOVA 4ZHHA 3C76X 3WJCA 3K3LA 3IA8A 3NR3A 3AKHA 1SY1A 1X8OA 3LHNA 3ZXLA 5JOZA 1T0VA 2B4WA 4NP1A 1T8VA 1GYHA 4PSQA 3C2UA 3BU9A 4D47A 2ANSA 1U17A 5B29A 3NADA 3NBXX 3VE1A 5AQ6A 3TGCA 1GM6A 5HA1A 1KT3A 1VYGA 1GX9A 3VSZA 2A13A 3FEKA 1CJ5A 1KT4A 1TOUA 4AZMA 1DF3A 1NGLA 1UV4A 2EXKA 3D5YA 4IB6A 4GZVA 4NW4A 4N4BA 3WVMA 5HCDC 2RCQA 5FENA 1X8UA 3RBYA 3AKNA 4KC7A 3WN2A 2AKQA 2GTLN 2HLVA 1S2PA 1I04A 2A0AA 2NNEA 1ZNGA 2EU7X 4OMXA 4ON1A 4XMHA 5BVQA 1EXSA 1LICA 4FFFA 1GT4A 2BHVA 3KFHA 3FA6A 4MVEA 4ORRA 1LF7A 4NOVA 4ONZA 1GX8A 2HNXA 3CQNA 4TJZA 2ADEA 3CBCA 3STMX 4CV7A 3WPYA 1O1UA 3S5XA 1LPJA 1A3YA 2PY1A 2W2BA 3C78X 3FMZA 4ZH6A 5KICA 3VSRA 1O1VA 1S44A 4PVAA 1LKEA 4ODDA 3VG4A 3VT0A 5FMBA 4AZNA 3C77X 5GLMA 1TW4A 1ACDA 2QQWA 1MX8A 4HWMA 5GLNA 4Y0PA 1YP6A 2MM3A 2RCTA 3BS2A 3D5ZA 1Y7BA 5HZQA 1EI5A 1JV4A 2EXIA 1A2DA 2AT0X 2YFRA 3ZW1A 1EIOA 3APWA 4FFIA 1E5PA 2WEWA 4FFHA 5C0PA 3OE3A 1KOIA 2A2UA 4INNA 2AT8X 3H3IA 4BQUA 1BRPA 2CZUA 5DG4A 4TKHA 1HN2A 1GYDB 1SY0A 1OEJA 4GETA 3EBWA 4IB7A 2G79A 1G7NA 3ZXKA 2R74A 3KFFA 3LFIA 1EW3A 4BVMA 1EALA 3QKGA 5FQ6E 1MDCA 4EEJA 5F6BA 4N7DA 2AC1A 1YWBA 3BRNA 3P24A 3QZ4A 4U9CA 1PT2A 3BYLA 3VT1A 3APVA 5CYBA 3TGBA 5EPQA 3DSZA 4QNIA 1AVGI 5L8NA 5HCCC 1KQXA 1TOWA 5F7GA 1FELA 5IO5A 4HPAA 5ANNA 1JYDA 5FAZA 2JN3A 4KIIA 4O49A 1OBPA 3NX2A 1B56A 4DQ3A 4ML7B 5FMDA 3P02A 1ZNHA 2X45A 4MVLA 1CBIA 3FYFA 3PEDA 4TLJA 1SA8A 4FQBB 1Y9MA 2L5PA 4AYHA 1BSQA 1FDQA 4NLIA 3VG6A 1D2UA 4I9SA 2WQ9A 3FW5A 4O4SA 3ZUIA 3R67A 1X8PA 2KT4B 4D6AA 5HZ9A 1PBOA 3F9DA 5GLQA 1YWCA 1GGLA 1LNMA 2JU8A 4EDEA 4TNNA 1EPBA 3D61A 3RWKX 3ELZA 4RUUA 2ACOA 4ZR2A 2A2GA 1GT5A 3O2YA 2LA7A 2RD7C 4IAWA 3ZZVA 1B4MA 3CU9A 4O3XB 2QQVA 3VT2A 5AYEA 1SXXA 3PIGA 2G7BA 2FS7A 2LKKA 3PQSA 5AJBA 1Y9GA 3KZAA 3P6GA 3NQKA 3T1DA 5HTEA 4WHIA 3S5VA 1BLRA 2VDTA 1KT6A 3KQ0A 5HCEC 4UU2A 1GKAB 2XSTA 4YCEA 1Y4WA 5FLWA 3PH5A 5FFHA 2MHDA 2WEXA 5AYDA 5LJBA 1R0UA 5C0NA 3UAQA 1ALBA 3U0DA 3JS1A 1I06A 4A8ZA 5FK7A 2AMMX 5JR8A 1CRBA 2AL0X 2GJ5A 4YGZA 3LEMA 4QZUA 1KQWA 3VPJE 2XKLA 1YWDA 1OBQA 3C7EA 2MWHA 4YDAA 4GRJA 4GK9A 3B2LA 3VE2A 3D96A 3C7FA 2QO4A 3E3CA 1BEBA 1XKIA 3ZXJA 3BSZE 4IABA 3STNA 4AZOA 4ZHGA 3BYNA 1W18A 3SC7X 3WMZA 3FELA 4GNWA 4I3DA 3C7GA 3LF7A 3LIHA 3B2JA 2X8SA 1JJXA 3HOEA 4ORSA 1QWDA 5BVTA 5GLRA 4U6DA 3FIQA 3NQHA 4O4OA 1O8VA 1YWAA 3G7XA 1RLBE 2FR3A 2FLJA 5LJHA 1E00A 3S60A 2QM9A 3VG2A 5GLPA 4ZHCA 1ZRYA 3MBTA 3ZQ3A 4XMGA 4GH7A 5EDCA 4YMYA 1QQSA 2BS6A 2R56A 2FS6A 5D48A 5IO6A 1AELA 4ORUA 3RZYA 4I3CA 2Q4NA 2WUTA 4GDZA 4O4UA 4O3WA 3RSWA 5BYPA 1FEMA 1U0XA 1NP1A 1IKJA 1KT5A 3GE2A 4WFVA 1BWYA 4IB9A 2WQAE 2CBRA 1AB0A 5FQ7E 4FFGA 3CWKA 2RA6A 4N2ZA 2M4LA 2LBVA 1JJJA 2YMSA 1VYFA 1ERBA 3QC2A 1GYEB 5B6TA 5AEOA 4PJ2A 1AQBA 1JIWI 4QRLA 1QY1A 5IO7A 3KSTA 4N2RA 4LZVA 5H9AA 4FBOA 1LFOA 1YRZA 2L9CA 5A7VA 1KGLA 4ALOA 3RKGA 2Q9SA 1OPBA 3ZW1B 2G78A 1VPRA 3GAQA 3UEVA 5HZ6A 1B0OA 3B2HA 1DV9A 3ZWEA 4HPBA 3UGGA 1SY2A 2AT6X 2YFSA 4XMEA 4OMWA 3I17A 3MX7A 3UEWA 1ST8A 1BJ7A 3TAWA 1FTPA 2FTBA 4EXZA 4MISA 3OM7A 3UGFA 1LIEA 2JW1A 3KF5A 4JGLA 4U3QA 3UGHA 1YP7A 4QQSA 1BRQA 4YGGA 3K1UA 3UEUA 1CBQA 5DPQA 1A18A 1LIDA 2W2AA 1G74A 5D45A 3U75A 2ACPX 4K19A 1GXAA 2GTFX 2X8TA 2OVAA 4IMNA 4ARHA 1ADLA 1ZNKA 1HQPA 1B8EA 3CBSA 3CQRA 4AZPA 3FA9A 4AW8A 1SMPI 1Y9LA 2LFOA 2WWPA 4CSBA 2QQUA 3VSFA 2AT3X 4KCBA 1NP4A 3SOTA 2QOSC 3ZW0A 3CMPA 1SXWA 3R4YA 4GNYA 4NLJA 1CBRA 5HWZA 5KHPA 2BS5A 4GKCA 2FR2A 3VG7A 2CBSA 1BSYA 2NP1A 1LIBA 2KTSA 4IMOA 3PECA 1EQDA 5D8JA 4IB8A 3FR2A 1IKEA 1DZJA 3FEPA 1SY3A 2Z4IA 1QY0A 5HA0A 5H9KA 2BLGA 5AYCA 5D47A 4Y0SA 4ZGFA 5EEDA 3F8AA 1H91A 1IFCA 2POAA 3EYCA 4KCAA 3R4ZA 2YFTA 1BBPA 4KH8A 3ZUOA 4O8NA 4UDJA 1QY2A 1I05A 4GU8A 4TQ2A 1YIFA 4KC8A 4AK5A 3MVFA 4O9SA 2CM9A 3JQOA 1VKDA 4L3RA 4NNTA 1HMSA 3RWXA 2W2FA 3LV4A 4R0BA 4UDKA 1DC9A 1N0SA 1X71A 2L68A 2MO5A 3WJGA 2OFRX 4YKOA 4O4XA 1BM5A 3OBLA 5LJCA 4UU3A 2EXHA 2CM4A 3BDRA 1DZKA 5LJDA 3PPTA 5F1EA 5AJCA 2RN4A 5FKCA 1ERXA 3BX7A 1Z24A 3HWFA 1P6PA 1G85A 1IFBA 3BLGA 3KFGA 3NQ9A 3PP6A 3QEFA 1OEEA 4MVIA 3D60A 3BY0A 2WSJA 4NYRA 3S26A 3WN1A 3BYKA 2K23A 1FENA 4XMFA 5JOYA 5LJKA 4QYNA 4YGHA 3ZI8A 1MVGA 2F09A 2OVSA 5LJEA 1UYPA 4UDKE 5B6SA 3OM5A 1OPAA 1QFVA 3HWEA 1IIUA 1HMRA 4N7CA 3WXQA 3U14A 5L8OA 1ICNA 1GT3A 1QFTA 3WN0A 3P6EA 2O62A 5K06A 4QGVA 4LKPA 4MVKA 3FR4A 1MX7A 3WPVA 2OVEA 1KT7A 2MJIA 4ZFXA 3I0AA 2NNDA 3APUA 2OVDA 4LZUA 4YBUA 4ZH9A 3LDRA 3BU1A 4U8UO 3WJBA 3OM6A 3P2NA 3QEEA 4PVIA 2DM5A 2ZAIA 3FA8A 4ZGUA 3B2IA 3PIJA 2Q2MA 2XQRA 2P8GA 3UEXA 5L8IA 4O8OA 4N1IA 4CK4A 1KZXA 2QMIA 3WBGA 1QABE 3D4RA 5FQ8E 3WASA 3KF3A 3U9PC 5GLOA 2ALLX 4U8UM 2FT9A 1X8QA 5D4AA 1I4UA 4ORXA 1JZUA 3JSQA 4I95A 4YH0A 3CR6A 2CZTA 1G5WA 4QGXA 3OM4A 3WAUA 1MUPA 3LIGA 1X8NA 2F73A 3FLLA 5HZ8A 5FK8A 2Q2PA 3N91A 4ZHDA 1KZWA 1WL7A 4QQ1A 5LJGA 1U18A 4ZHFA 2EXJA 3APXA 1SXYA 5A7VB 2OXBA 3TF6A 4YBPA 4BOEA 1ZNDA 3OM2A 4AZRA 5EZ2A 1GT1A 2HMBA 4ZCBA 2Q39A 3WATA 2HYSA 3HTYA 3B2KA 5BVSA 4FBVA 2E4JA 3EMMA 4YKMA 4Y0RA 3OD9A 3SAOA 3ZW2A 4YCHA 5GLLA 5EDBA 3VG3A 4WBKA 2ZAGA 4NYQA 5FIXA 1DFVA 3Q6LA 4LKTA 4ORWA 2R73A 5EEEA 3PH6A 4OS8A 4DQ4A 4O8PA 3NX1A 4I3BA 4D6BA 4A1YA 3V8UA 4GE1A 4OS3A 5H9NA 4AK7A 4QGWA 2ADDA 1EUOA 1L6MA 4M6SA 4QYPA 4YFPA 5F6ZA 5HBSA 3WJDA 4COTA 4FBRA 1EIIA 3O19A 4EFGA 5FKBA 3O22A 2AEZA 1Y9TA 2FRSA 3NP1A 5HAEA 3P6DA 3BX8A 2RQ0A 1QG5A 1YIVA 4O3YA 5HZ5A 3P6HA 3ZW0B 3P6FA 5H8TA 3VSSA 4EQVA 5JOXA 4O3ZA 1PEEA 4ES7A 3LDKA 2KD2A 5AY9A 4OS0A 2AEYA 2JU3A 3DTQA 4A1HA 4ALBA 3P6CA 3BYJA 3D95A 3FR5A 4MIRA 4KMIA 4AK6A 1UREA 5LKEA 2JMBA 3HWGA 4TKJA 1RBPA 1X89A 3FENA 3TGAA 1OYGA 4RUNA 4QZTA 3C7HA 3OJYC 3HOLA 2JOZA 1YUPA 2GTLO 5HTDA 1OEKA 1SXUA 1BSOA 1FE3A 1OBUA 1ML7A 3FW4A 3WJFA 2X8FA 3AKFA 3EBKA 1CBSA 2L67A 1E06A 2AT5X 2X46A 4U8UN 5A8DA 4FGIB 2QO5A 3WPZA 4KT5A 4Y0QA 4ORYA 1UZ2X 4YDBA 1S7DA 3WJEA 4XMDA 1T68X 2LBAA 2KW1A 3PQUA 4ID2A 4UDIA 1ZNEA 1PMPA 2GTLM 1TXLA 4IBAA 4YFQA 1ZNLA 2NNQA 3HK1A 5H9LA 5CE4A 5KIDA 3HWDA 4AZQA 1A57A 4U6BA 2LB6A 4MLGA 3IFBA 1D3SA 3AKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GYE B;  1JIW I;  3LDR A;  3KST A;  4UDG A;  2AC1 A;  4N2R A;  3OM6 A;  3QZ4 A;  3BYL A;  1PT2 A;  3P2N A;  1YRZ A;  3QEE A;  4PVI A;  5FMC A;  3VT1 A;  5A8C A;  3PIJ A;  5A7V A;  2XQR A;  3WPU A;  1W2T A;  1YI7 A;  4O8O A;  4N1I A;  3C7O A;  3WAS A;  5GLK A;  3KF3 A;  5ANN A;  5GLO A;  3UGG A;  3AKG A;  2YFS A;  5FMD A;  1Y9M A;  3OM4 A;  3QED A;  1ST8 A;  3WAU A;  3WMY A;  3TAW A;  3LIG A;  3R67 A;  3OM7 A;  5GLQ A;  3UGF A;  3KF5 A;  5FK8 A;  3D61 A;  4QQS A;  3RWK X;  3K1U A;  1WL7 A;  3AKI A;  5JOW A;  3U75 A;  2EXJ A;  5A7V B;  2OXB A;  3CU9 A;  2X8T A;  2QQV A;  3OM2 A;  3VT2 A;  5AYE A;  3PIG A;  1Y9G A;  1SMP I;  2QQU A;  3VSF A;  3WAT A;  4KCB A;  2VDT A;  5GLL A;  3AKH A;  3R4Y A;  3ZXL A;  5JOZ A;  2B4W A;  1GYH A;  4D47 A;  3C2U A;  1Y4W A;  5FLW A;  4O8P A;  3VSZ A;  5AYD A;  1UV4 A;  3D5Y A;  4AK7 A;  2ADD A;  5AYC A;  4COT A;  4N4B A;  5FK7 A;  5FKB A;  2AEZ A;  3UGH A;  4KC7 A;  4KCA A;  3LEM A;  3R4Z A;  3WN2 A;  2YFT A;  2EXK A;  4O8N A;  4UDJ A;  1YIF A;  5FIX A;  4FFF A;  3C7E A;  4KC8 A;  4AK5 A;  1VKD A;  4NOV A;  4ONZ A;  3VSS A;  2ADE A;  4EQV A;  3C7F A;  3LDK A;  5JOX A;  5AY9 A;  3LV4 A;  4UDK A;  2AEY A;  3ZXJ A;  3BYJ A;  3WPY A;  3BYN A;  4AK6 A;  4KMI A;  1W18 A;  3SC7 X;  3WMZ A;  2EXH A;  3C7G A;  3LF7 A;  1OYG A;  3C7H A;  4PVA A;  3LIH A;  5FKC A;  2X8S A;  2RN4 A;  3VT0 A;  5FMB A;  5GLM A;  5GLR A;  4U6D A;  3NQH A;  2QQW A;  5GLN A;  3QEF A;  3D60 A;  2X8F A;  3D5Z A;  1Y7B A;  3AKF A;  3WN1 A;  5GLP A;  3BYK A;  5A8D A;  2EXI A;  5JOY A;  2YFR A;  1UYP A;  4UDK E;  3WPZ A;  5B6S A;  3OM5 A;  4FFI A;  3U14 A;  4FFH A;  3VSR A;  4UDI A;  3WN0 A;  5C0P A;  3WPV A;  4FFG A;  1GYD B;  4U6B A;  4MLG A;  3ZXK A;  4N2Z A;  3QC2 A;  3LFI A;  5B6T A; 
#chains in the Genus database with same CATH topology
 3L4R A;  2X56 A;  4UDG A;  1SRF A;  4ZJ0 A;  1IW2 A;  3F6Z B;  4TKB A;  1JBH A;  1DZP A;  5LKF A;  3KFI A;  4LQZ A;  5GLK A;  1HMT A;  4GJS A;  2IZG B;  4U46 A;  3CKF A;  4I9R A;  4XMC A;  2X32 A;  2HZR A;  1XCA A;  2A3F X;  3NPO A;  2RTL A;  1LIF A;  3FA7 A;  2FWV A;  1LUQ A;  4A60 A;  2AH7 X;  2K62 A;  1SRJ A;  2C1S A;  3K3L A;  5JOZ A;  1T8V A;  1GYH A;  4D47 A;  1U17 A;  3VE1 A;  1I9H A;  2IZD B;  5HA1 A;  1UYN X;  2A13 A;  1KT4 A;  4N4B A;  3WVM A;  5HCD C;  3RBY A;  4KC7 A;  1NC9 A;  1CJ5 A;  2EXK A;  1EII A;  1ZNG A;  2G5L A;  4OMX A;  4ON1 A;  4MVE A;  3FA6 A;  4NOV A;  1GX8 A;  3CQN A;  3CBC A;  2C1Q A;  4CV7 A;  1LPJ A;  3FMZ A;  1O1V A;  1DF8 A;  1S44 A;  4ODD A;  5FMB A;  4AZN A;  2RTO B;  5GLM A;  1ACD A;  2RCT A;  3D5Z A;  1Y7B A;  5HZQ A;  1EI5 A;  1JV4 A;  3SLT A;  2EXI A;  2FGS A;  4GGR A;  2YFR A;  1SWA A;  4FFI A;  2RTP B;  2WEW A;  4FFH A;  5C0P A;  5IRA A;  2AT8 X;  3H3I A;  1VWM B;  1OEJ A;  4IB7 A;  1G7N A;  3ZXK A;  1SWC A;  2R74 A;  1SWJ A;  2OY7 A;  5B5F A;  3WYQ A;  3VT1 A;  3DSZ A;  5IO5 A;  2JN3 A;  1OBP A;  1SRI A;  5FMD A;  3P02 A;  1CBI A;  1SA8 A;  1SRH A;  2OY1 O;  3ZUI A;  4D6A A;  5HZ9 A;  3F9D A;  4EDE A;  1LNM A;  1SWL A;  1K24 A;  1GT5 A;  3O2Y A;  2LA7 A;  1B4M A;  4O3X B;  2QQV A;  1SXX A;  2LKK A;  1LDO A;  3PQS A;  2OL8 O;  3KZA A;  3T1D A;  4CPH A;  1GKA B;  2XST A;  5CSE A;  2BSZ A;  5FLW A;  2MHD A;  1E2T A;  5AYD A;  1R0U A;  2IZI A;  1ALB A;  3U0D A;  3JS1 A;  1I06 A;  4A8Z A;  1CRB A;  2RTI B;  2AL0 X;  1KQW A;  1LCW A;  3HPE A;  3RE6 A;  3C7E A;  2A5C A;  4GRJ A;  3B2L A;  3WZQ A;  4C5P A;  2QO4 A;  2IZC B;  3ZXJ A;  4IAB A;  4ZHG A;  3QQ2 A;  4GNW A;  3D9W A;  4I3D A;  3LF7 A;  4NV8 A;  3B2J A;  3HOE A;  4U6D A;  2FR3 A;  5LJH A;  1E00 A;  4BGF A;  1AEL A;  4ORU A;  1IKJ A;  2WQA E;  4FFG A;  1AB0 A;  5FQ7 E;  1I78 A;  3QC2 A;  2LBV A;  1JJJ A;  5AEO A;  1QY1 A;  1VWL B;  3PDF A;  1SWK A;  1YRZ A;  1JMX A;  1KGL A;  4ALO A;  1VWG B;  1SLG B;  1JJU A;  2G78 A;  3ZWE A;  1SY2 A;  2YFS A;  3MX7 A;  2DJG A;  4EXZ A;  3UGF A;  2JW1 A;  1STS B;  1RAV A;  4BX7 A;  1YP7 A;  4JHQ A;  4K19 A;  4OEM A;  2GTF X;  4ARH A;  1ADL A;  1ZNK A;  1HQP A;  4AW8 A;  4AZP A;  2QQU A;  1Y9L A;  2WWP A;  3VSF A;  1W6F A;  1SWH A;  5HWZ A;  5KHP A;  3MG5 A;  2BS5 A;  1LIB A;  5D8J A;  1SWG A;  1IKE A;  2DJF A;  5D47 A;  2OL6 O;  4ZGF A;  1VWH B;  3F8A A;  1N43 A;  2VFB A;  2POA A;  4KH8 A;  4KC8 A;  4O9S A;  2CM9 A;  4L3R A;  4NNT A;  1DC9 A;  1X71 A;  3LTW A;  1BM5 A;  4UU3 A;  2EXH A;  5LJD A;  5AJC A;  1ERX A;  3BX7 A;  3HWF A;  3BLG A;  1OEE A;  3S26 A;  5JOY A;  1NQM A;  5LJE A;  3HWE A;  1SRG A;  4N7C A;  3U14 A;  2X55 A;  2O62 A;  4MVK A;  3FR4 A;  1MX7 A;  1VWF B;  4DCB A;  2MJI A;  3I0A A;  2OVD A;  4YBU A;  3OM6 A;  3P2N A;  3PIJ A;  1SWD A;  2XQR A;  4O8O A;  1QAB E;  2FT9 A;  3JSQ A;  4I95 A;  4YH0 A;  1G5W A;  3WAU A;  4QGX A;  1MUP A;  1JQP A;  4GGT A;  1KZW A;  4QQ1 A;  1SXY A;  5A7V B;  2OXB A;  4Z27 A;  5EZ2 A;  4ZCB A;  3HTY A;  3B2K A;  3ZW2 A;  3SAO A;  3OD9 A;  4YCH A;  4ORW A;  4DQ4 A;  4I3B A;  4D6B A;  4A1Y A;  4QGW A;  4M6S A;  4QYP A;  4EFG A;  3P6D A;  1SLE B;  1YIV A;  5HZ5 A;  3P6H A;  5H8T A;  4EQV A;  3LDK A;  3T2W A;  2JU3 A;  3DTQ A;  3D95 A;  4KMI A;  3FID A;  2FHN X;  3HWG A;  1VWE B;  4QZT A;  2GTL O;  1OEK A;  3FW4 A;  3WJF A;  1CBS A;  2AT5 X;  4FGI B;  2QO5 A;  4KT5 A;  4Y0Q A;  1UZ2 X;  1ZNL A;  3IFB A;  4IB6 A;  3AKM A;  1AVE A;  4CPF A;  3RDU A;  1TVQ A;  3WPU A;  1W2T A;  3U03 A;  1YI7 A;  2GC9 A;  4M7M A;  1LCZ A;  1KXO A;  1SWO A;  3TZS A;  2Z4H A;  2X4M A;  2KTD A;  2IZK A;  2BT9 A;  1HBQ A;  3PK2 A;  3D97 A;  3NR3 A;  1X8O A;  2B4W A;  4NP1 A;  4PSQ A;  3BU9 A;  2ANS A;  5B29 A;  4B55 A;  3FEK A;  4AZM A;  1DF3 A;  1NGL A;  1SWU A;  4GZV A;  4NW4 A;  3AEH A;  1UYO X;  2HLV A;  1S2P A;  4XMH A;  1EXS A;  2OF8 A;  1GT4 A;  2I5Z O;  3KFH A;  4ORR A;  5K67 A;  2HNX A;  5KIC A;  3VT0 A;  1LCV A;  1TW4 A;  1A2D A;  4Z2V A;  3ZW1 A;  3APW A;  4INN A;  4BQU A;  1BRP A;  1SY0 A;  4GET A;  2G79 A;  2CAM A;  1OSP O;  1EW3 A;  4BVM A;  5FQ6 E;  4U9C A;  1AVG I;  4HPA A;  1JYD A;  5FAZ A;  4KII A;  2G8C O;  4ML7 B;  4Z2P A;  1ZNH A;  4MVL A;  1Y9M A;  3FYF A;  1RXH A;  4FQB B;  4AYH A;  1BSQ A;  3VG6 A;  1D2U A;  2WQ9 A;  1YWC A;  1SWR A;  4RUU A;  2ACO A;  4ZR2 A;  4IAW A;  3CU9 A;  3VT2 A;  5AYE A;  5AJB A;  3NQK A;  5HTE A;  1BLR A;  1KT6 A;  3KQ0 A;  5JD2 A;  2BC3 A;  1MEP A;  5FK7 A;  3VPJ E;  3D96 A;  3EW1 A;  1XKI A;  3BYN A;  1STR B;  4AZO A;  4I60 A;  4GGZ A;  1W18 A;  3FEL A;  1QWD A;  5GLR A;  3SZJ A;  3FIQ A;  1O8V A;  3G7X A;  1RST B;  3MBT A;  5EDC A;  4YMY A;  1VWP B;  2Q4N A;  2WUT A;  2IZJ A;  3SZI A;  1U0X A;  5B5G A;  1BWY A;  3CWK A;  2RA6 A;  4N2Z A;  2YMS A;  5B6T A;  4QRL A;  5IO7 A;  3KST A;  5H9A A;  4FBO A;  4Z2O A;  2L9C A;  4OKA A;  1OPB A;  3VHI A;  1VPR A;  5HZ6 A;  3UGG A;  1FTP A;  4MIS A;  2HKD A;  4JGL A;  4U3Q A;  2RTA A;  1Y52 X;  3UEU A;  1A18 A;  5D45 A;  1GXA A;  2OVA A;  1HQQ A;  1Y55 X;  2Y32 A;  4CSB A;  2AT3 X;  1KL3 A;  3SOT A;  3R4Y A;  4GKC A;  2FR2 A;  2KTS A;  1VWN B;  4IB8 A;  1DZJ A;  1SY3 A;  1QY0 A;  5H9K A;  3EYC A;  2YFT A;  4O8N A;  1I05 A;  1SWN A;  4AK5 A;  3JQO A;  3RWX A;  2VFC A;  2FKJ A;  2W2F A;  4R0B A;  1N0S A;  1SLD B;  3RDO A;  3WJG A;  4BX6 A;  2OFR X;  3OBL A;  3BDR A;  1FJ1 E;  2RN4 A;  3CKG A;  3D60 A;  3WN1 A;  3BYK A;  2K23 A;  1QFV A;  1IIU A;  1HMR A;  4Z6J A;  5L8O A;  1ICN A;  1QFT A;  4QGV A;  2OVE A;  4ZFX A;  3APU A;  4ZH9 A;  3BU1 A;  1JMZ A;  4EKV A;  3QEE A;  2ZAI A;  2QOM A;  2P8G A;  2Y3F A;  1KZX A;  3U9P C;  4CDE A;  5L3Y A;  5D4A A;  1I4U A;  4ORX A;  2CZT A;  5FK8 A;  1HXL A;  4ZHD A;  2EXJ A;  3APX A;  4YBP A;  3OM2 A;  2FKG A;  2A8G A;  2Q39 A;  2HYS A;  3WAT A;  5BVS A;  4YKM A;  2A5B A;  4BX5 B;  1N7Y A;  3PH6 A;  4OS8 A;  2ADD A;  4COT A;  3O19 A;  2RQ0 A;  1QG5 A;  2RTH B;  4O3Y A;  2FHL A;  4CDC A;  3ZW0 B;  3VSS A;  5JOX A;  4O3Z A;  4OS0 A;  3BYJ A;  4AK6 A;  3FR5 A;  4MIR A;  2JMB A;  1HY2 A;  3FEN A;  1OYG A;  4RUN A;  3OJY C;  3HOL A;  2JOZ A;  1SXU A;  3WJE A;  2OYB O;  4XMD A;  1T68 X;  3PQU A;  3VSR A;  4ID2 A;  2GTL M;  5H9L A;  3HK1 A;  5KID A;  4U6B A;  5B27 A;  3VG5 A;  5A8C A;  5F58 A;  5FMC A;  1EPA A;  2OFM X;  2OZQ A;  1HBP A;  1ICM A;  1JYJ A;  4GD9 A;  2YG2 A;  4WFU A;  4BJ8 A;  3AKG A;  5K68 A;  2HZQ A;  4HFO A;  3QED A;  1GKA A;  1DZM A;  2ASN X;  4QAE A;  4I6S A;  1SRE A;  3AKI A;  4NNS A;  4L1N A;  2OY5 O;  2N93 A;  2QO6 A;  3STK A;  3WOV A;  4ZHH A;  3IA8 A;  3AKH A;  3LHN A;  1T0V A;  4JNJ A;  3NAD A;  3NBX X;  3TGC A;  5AQ6 A;  1KT3 A;  1VYG A;  1GX9 A;  4GUZ A;  1UV4 A;  3D5Y A;  3RDM A;  5FEN A;  1X8U A;  3AKN A;  3WN2 A;  2GTL N;  1JJX A;  2EU7 X;  4FFF A;  4YVB A;  2BHV A;  4TJZ A;  4JO6 A;  1KFF A;  3STM X;  3WPY A;  1O1U A;  1A3Y A;  2PY1 A;  2W2B A;  1LKE A;  1TL2 A;  2RTD B;  2QQW A;  2IZF B;  4Y0P A;  1YP6 A;  2MM3 A;  3BS2 A;  1SWT A;  1E5P A;  3OE3 A;  2GH7 A;  2RTN B;  5DG4 A;  4TKH A;  1HN2 A;  1GYD B;  4GDA A;  3LFI A;  1EAL A;  4EEJ A;  1NBX A;  2AC1 A;  1YWB A;  3BRN A;  3P24 A;  3QZ4 A;  3TGB A;  5EPQ A;  4QNI A;  4Y5D A;  5L8N A;  1HXZ A;  3T6F A;  1NQN A;  1B56 A;  2X45 A;  4TLJ A;  3PED A;  1NDJ A;  2L5P A;  4NLI A;  4O4S A;  1X8P A;  2KT4 B;  5GLQ A;  4TNN A;  1EPB A;  3ELZ A;  2A2G A;  2RD7 C;  3ZZV A;  3PIG A;  2FS7 A;  1Y9G A;  3P6G A;  4WHI A;  2VDT A;  2RTR B;  5CHK A;  3PH5 A;  1VWC B;  2WEX A;  5C0N A;  3UAQ A;  3LEM A;  4YGZ A;  1OBQ A;  2MWH A;  4GK9 A;  3VE2 A;  3C7F A;  3WMZ A;  3LIH A;  2Y3E A;  3NQH A;  4O4O A;  4CPI A;  3S60 A;  1N4J A;  3VG2 A;  3ZQ3 A;  4XMG A;  2R56 A;  5IO6 A;  2FS6 A;  3RZY A;  4O4U A;  3RSW A;  4CPE A;  1KT5 A;  4WFV A;  3VGW A;  2M4L A;  1AQB A;  4N2R A;  1LFO A;  3X00 A;  5A7V A;  3RKG A;  5B3M O;  3GAQ A;  3UEV A;  2QCB A;  4OMW A;  3I17 A;  3RY1 A;  3UEW A;  1ST8 A;  1BJ7 A;  3TAW A;  2FTB A;  3KF5 A;  4QQS A;  1BRQ A;  1CBQ A;  5DPQ A;  2ZSC A;  3Q34 A;  1G74 A;  3U75 A;  2ACP X;  2X8T A;  4IMN A;  3CBS A;  3CQR A;  2F01 A;  2LFO A;  4KCB A;  1MOY A;  1NP4 A;  1W5R A;  3CMP A;  1SXW A;  1Y0G A;  4NLJ A;  1CBR A;  1VWO B;  1BSY A;  1MM9 A;  3PEC A;  2PI3 O;  3FR2 A;  1RXK A;  5HA0 A;  5AYC A;  3MM0 A;  4Y0S A;  3WZO A;  1H91 A;  3UGH A;  3R4Z A;  4TQ2 A;  1YIF A;  3MVF A;  1VKD A;  1HMS A;  4CPH B;  3LV4 A;  2IZH B;  2RTG B;  5LJC A;  2CM4 A;  1DZK A;  2X34 A;  1Z24 A;  1P6P A;  1G85 A;  1IFB A;  3PP6 A;  3QEF A;  4MVI A;  3SLO A;  3BY0 A;  3SLJ A;  4XMF A;  5LJK A;  4YGH A;  3AUM O;  1MVG A;  2F09 A;  2OVS A;  5C2M A;  3VHM A;  3WXQ A;  3WN0 A;  3P6E A;  5K06 A;  1Y53 X;  3WPV A;  1GX3 A;  1KT7 A;  3RDX A;  1PTS A;  3RE5 A;  4U8U O;  3WJB A;  4PVI A;  3FA8 A;  4ZGU A;  3B2I A;  3UEX A;  4N1I A;  4CK4 A;  3KF3 A;  5B10 O;  5GLO A;  2ALL X;  1VYO A;  1X8N A;  1WBI A;  2F73 A;  3EC5 A;  3FLL A;  2Q2P A;  1WL7 A;  5LJG A;  4ZHF A;  2RTC B;  1ZND A;  1SWQ A;  4AZR A;  1GT1 A;  4Y0R A;  3VG3 A;  2IZB A;  1DFV A;  3Q6L A;  1STP A;  2R73 A;  4BX7 B;  3V8U A;  4GE1 A;  4AK7 A;  4FBR A;  5HBS A;  5F6Z A;  2OY8 A;  2WPU A;  5FKB A;  3O22 A;  3NP1 A;  3BX8 A;  3P6F A;  1PEE A;  5AY9 A;  2KD2 A;  4ALB A;  3P6C A;  1URE A;  4TKJ A;  1X89 A;  2RTE B;  1SLF B;  4Y59 A;  5HTD A;  3EW2 A;  1RXJ A;  2X8F A;  2L67 A;  3WPZ A;  4ORY A;  4YDB A;  2LBA A;  2KW1 A;  4UDI A;  4IBA A;  1PMP A;  1VWA B;  2MF6 A;  2NNQ A;  5CE4 A;  3HWD A;  3SZH A;  1A57 A;  4MLG A;  1E02 A;  1PM1 X;  2I5V O;  1VWJ B;  5B2A O;  1KL5 A;  3EM0 A;  5IXG A;  2JU7 A;  3C7O A;  4HPC A;  4YFR A;  4EQA C;  3RY2 A;  3ELX A;  3WMY A;  1N9M A;  4HPD A;  2RTM A;  2WR6 A;  3NQ3 A;  2UYW A;  5JOW A;  4IAX A;  2RTF B;  2RTB B;  2IFB A;  3C76 X;  3WJC A;  1SY1 A;  3ZXL A;  2JGS A;  3C2U A;  4MEE A;  1GM6 A;  3VSZ A;  1TOU A;  2RCQ A;  1SWE A;  2AKQ A;  1I04 A;  2A0A A;  2NNE A;  5FIX A;  5BVQ A;  1LIC A;  4DNE A;  1LF7 A;  4ONZ A;  2ADE A;  3VHH A;  3S5X A;  1PBY A;  3C78 X;  4ZH6 A;  4PVA A;  2RTK A;  3VG4 A;  5F2B A;  1LEL A;  3C77 X;  3WZN A;  1WUB A;  1MX8 A;  4HWM A;  5GLN A;  3RDQ A;  2AT0 X;  1EIO A;  1KL4 A;  1KOI A;  1SWF A;  2A2U A;  2CZU A;  3EBW A;  3KFF A;  3QKG A;  1MDC A;  5F6B A;  4N7D A;  3BYL A;  1PT2 A;  3APV A;  5CYB A;  5HCC C;  1KQX A;  1TOW A;  5F7G A;  1FEL A;  5ANN A;  4O49 A;  3NX2 A;  4DQ3 A;  2AVI A;  1FDQ A;  4I9S A;  3FW5 A;  3R67 A;  1PBO A;  1GGL A;  2JU8 A;  3D61 A;  3RWK X;  2G7B A;  1SWP A;  4CDD A;  2AF5 A;  3S5V A;  5HCE C;  4UU2 A;  4YCE A;  1Y4W A;  5FFH A;  2RTJ A;  5LJB A;  1SWB A;  2AMM X;  5JR8 A;  2GJ5 A;  4QZU A;  2XKL A;  1YWD A;  4YDA A;  1IJ8 A;  3E3C A;  1BEB A;  3BSZ E;  3STN A;  2OFA A;  3SC7 X;  3C7G A;  2X8S A;  2C4I A;  4ORS A;  5BVT A;  4OEL A;  1YWA A;  1RLB E;  2FLJ A;  2QM9 A;  5GLP A;  4ZHC A;  1ZRY A;  4GH7 A;  1QQS A;  2BS6 A;  5D48 A;  4I3C A;  4GDZ A;  4O3W A;  5BYP A;  1FEM A;  1NP1 A;  3GE2 A;  4IB9 A;  2CBR A;  1VYF A;  1ERB A;  1GYE B;  4PJ2 A;  1JIW I;  4LZV A;  2OL7 A;  2Q9S A;  3ZW1 B;  1SWS A;  1B0O A;  3B2H A;  1DV9 A;  4HPB A;  2AT6 X;  4XME A;  4BX5 A;  3OM7 A;  1LIE A;  4BBO A;  4YGG A;  3K1U A;  1VWQ B;  1LID A;  2W2A A;  2IZL B;  1MK5 A;  1B8E A;  3FA9 A;  1SMP I;  3ZW0 A;  2QOS C;  4GNY A;  1RSU B;  4Z28 A;  4CDF A;  3VG7 A;  2CBS A;  2NP1 A;  4IMO A;  1EQD A;  3FDC A;  1VWB B;  3KVN A;  3FEP A;  2Z4I A;  2BLG A;  5EED A;  1IFC A;  4KCA A;  1BBP A;  3ZUO A;  4NV7 A;  4UDJ A;  1QY2 A;  4GU8 A;  3T2X A;  4UDK A;  2L68 A;  2MO5 A;  3T6L A;  4YKO A;  4O4X A;  2VDF A;  3PPT A;  5F1E A;  5FKC A;  2OFB A;  3KFG A;  3NQ9 A;  3RDS A;  4NYR A;  2WSJ A;  1FEN A;  4QYN A;  3ZI8 A;  1UYP A;  4UDK E;  5B6S A;  3OM5 A;  1OPA A;  1GT3 A;  5IRU A;  2IZE B;  4LKP A;  4BCS A;  2NND A;  4LZU A;  3LDR A;  1VWR B;  2IZA A;  2DM5 A;  1N9Y A;  2Q2M A;  5L8I A;  2RTQ B;  2QMI A;  3WBG A;  3D4R A;  5FQ8 E;  3WAS A;  1LDQ A;  4U8U M;  3WYP A;  1X8Q A;  1JZU A;  3OM4 A;  3CR6 A;  4GJV A;  3LIG A;  1AVD A;  5HZ8 A;  3N91 A;  1U18 A;  3TF6 A;  4BOE A;  2HMB A;  5B11 O;  4FBV A;  2E4J A;  2UZ2 A;  3EMM A;  5GLL A;  5EDB A;  1K3B A;  4WBK A;  2ZAG A;  4NYQ A;  4LKT A;  5EEE A;  4O8P A;  3NX1 A;  4OS3 A;  5H9N A;  1EUO A;  1L6M A;  4YFP A;  3WJD A;  2AEZ A;  1Y9T A;  2FRS A;  5HAE A;  1VWK B;  4ES7 A;  1VWI B;  2AEY A;  4A1H A;  5LKE A;  1RBP A;  3TGA A;  3C7H A;  5IRW A;  3WZP A;  1YUP A;  4IRW A;  1BSO A;  1FE3 A;  1OBU A;  1ML7 A;  3AKF A;  3EBK A;  1E06 A;  1W4T A;  2X46 A;  4U8U N;  5A8D A;  1VWD B;  1S7D A;  2OF9 A;  3VU1 A;  1ZNE A;  4YFQ A;  1TXL A;  4BX6 B;  4AZQ A;  2LB6 A;  1D3S A; 
#chains in the Genus database with same CATH homology
 1E02 A;  3L4R A;  1PM1 X;  5B27 A;  4UDG A;  3VG5 A;  5A8C A;  5F58 A;  5FMC A;  4ZJ0 A;  1IW2 A;  3F6Z B;  4TKB A;  3VU1 A;  1JBH A;  3EM0 A;  1EPA A;  2OFM X;  1TVQ A;  2JU7 A;  3WPU A;  1DZP A;  2OZQ A;  3U03 A;  1W2T A;  5LKF A;  1HBP A;  3KFI A;  1YI7 A;  3C7O A;  4HPC A;  1ICM A;  2GC9 A;  1JYJ A;  4LQZ A;  4YFR A;  5GLK A;  2YG2 A;  4WFU A;  1HMT A;  4M7M A;  4EQA C;  3AKG A;  3ELX A;  1KXO A;  2HZQ A;  4HFO A;  4I9R A;  3QED A;  3WMY A;  3TZS A;  2Z4H A;  4XMC A;  1GKA A;  1DZM A;  2HZR A;  2ASN X;  2KTD A;  4HPD A;  4QAE A;  1XCA A;  2WR6 A;  2A3F X;  3NPO A;  4I6S A;  3NQ3 A;  2BT9 A;  3AKI A;  4NNS A;  1LIF A;  4L1N A;  5JOW A;  3FA7 A;  4IAX A;  2FWV A;  2N93 A;  2IFB A;  2AH7 X;  4A60 A;  1HBQ A;  2K62 A;  3D97 A;  2QO6 A;  3STK A;  3WOV A;  4ZHH A;  3C76 X;  3WJC A;  3K3L A;  3IA8 A;  3NR3 A;  3AKH A;  1SY1 A;  1X8O A;  3LHN A;  3ZXL A;  5JOZ A;  1T0V A;  2B4W A;  4NP1 A;  1T8V A;  1GYH A;  4PSQ A;  3C2U A;  3BU9 A;  4D47 A;  2ANS A;  1U17 A;  5B29 A;  3NAD A;  3NBX X;  3VE1 A;  5AQ6 A;  3TGC A;  1GM6 A;  5HA1 A;  1KT3 A;  1VYG A;  1GX9 A;  3VSZ A;  2A13 A;  3FEK A;  1CJ5 A;  1KT4 A;  1TOU A;  4AZM A;  1DF3 A;  1NGL A;  1UV4 A;  2EXK A;  3D5Y A;  4IB6 A;  4GZV A;  4NW4 A;  4N4B A;  3WVM A;  5HCD C;  2RCQ A;  5FEN A;  1X8U A;  3RBY A;  3AKN A;  4KC7 A;  3WN2 A;  2AKQ A;  2GTL N;  2HLV A;  1S2P A;  1I04 A;  2A0A A;  2NNE A;  1ZNG A;  2EU7 X;  4OMX A;  4ON1 A;  4XMH A;  5BVQ A;  1EXS A;  1LIC A;  4FFF A;  1GT4 A;  2BHV A;  3KFH A;  3FA6 A;  4MVE A;  4ORR A;  1LF7 A;  4NOV A;  4ONZ A;  1GX8 A;  2HNX A;  3CQN A;  4TJZ A;  2ADE A;  3CBC A;  3STM X;  4CV7 A;  3WPY A;  1O1U A;  3S5X A;  1LPJ A;  1A3Y A;  2PY1 A;  2W2B A;  3C78 X;  3FMZ A;  4ZH6 A;  5KIC A;  3VSR A;  1O1V A;  1S44 A;  4PVA A;  1LKE A;  4ODD A;  3VG4 A;  3VT0 A;  5FMB A;  4AZN A;  3C77 X;  5GLM A;  1TW4 A;  1ACD A;  2QQW A;  1MX8 A;  4HWM A;  5GLN A;  4Y0P A;  1YP6 A;  2MM3 A;  2RCT A;  3BS2 A;  3D5Z A;  1Y7B A;  5HZQ A;  1EI5 A;  1JV4 A;  2EXI A;  1A2D A;  2AT0 X;  2YFR A;  3ZW1 A;  1EIO A;  3APW A;  4FFI A;  1E5P A;  2WEW A;  4FFH A;  5C0P A;  3OE3 A;  1KOI A;  2A2U A;  4INN A;  2AT8 X;  3H3I A;  4BQU A;  1BRP A;  2CZU A;  5DG4 A;  4TKH A;  1HN2 A;  1GYD B;  1SY0 A;  1OEJ A;  4GET A;  3EBW A;  4IB7 A;  2G79 A;  1G7N A;  3ZXK A;  2R74 A;  3KFF A;  3LFI A;  1EW3 A;  4BVM A;  1EAL A;  3QKG A;  5FQ6 E;  1MDC A;  4EEJ A;  5F6B A;  4N7D A;  2AC1 A;  1YWB A;  3BRN A;  3P24 A;  3QZ4 A;  4U9C A;  1PT2 A;  3BYL A;  3VT1 A;  3APV A;  5CYB A;  3TGB A;  5EPQ A;  3DSZ A;  4QNI A;  1AVG I;  5L8N A;  5HCC C;  1KQX A;  1TOW A;  5F7G A;  1FEL A;  5IO5 A;  4HPA A;  5ANN A;  1JYD A;  5FAZ A;  2JN3 A;  4KII A;  4O49 A;  1OBP A;  3NX2 A;  1B56 A;  4DQ3 A;  4ML7 B;  5FMD A;  3P02 A;  1ZNH A;  2X45 A;  4MVL A;  1CBI A;  3FYF A;  3PED A;  4TLJ A;  1SA8 A;  4FQB B;  1Y9M A;  2L5P A;  4AYH A;  1BSQ A;  1FDQ A;  4NLI A;  3VG6 A;  1D2U A;  4I9S A;  2WQ9 A;  3FW5 A;  4O4S A;  3ZUI A;  3R67 A;  1X8P A;  2KT4 B;  4D6A A;  5HZ9 A;  1PBO A;  3F9D A;  5GLQ A;  1YWC A;  1GGL A;  1LNM A;  2JU8 A;  4EDE A;  4TNN A;  1EPB A;  3D61 A;  3RWK X;  3ELZ A;  4RUU A;  2ACO A;  4ZR2 A;  2A2G A;  1GT5 A;  3O2Y A;  2LA7 A;  2RD7 C;  4IAW A;  3ZZV A;  1B4M A;  3CU9 A;  4O3X B;  2QQV A;  3VT2 A;  5AYE A;  1SXX A;  3PIG A;  2G7B A;  2FS7 A;  2LKK A;  3PQS A;  5AJB A;  1Y9G A;  3KZA A;  3P6G A;  3NQK A;  3T1D A;  5HTE A;  4WHI A;  3S5V A;  1BLR A;  2VDT A;  1KT6 A;  3KQ0 A;  5HCE C;  4UU2 A;  1GKA B;  2XST A;  4YCE A;  1Y4W A;  5FLW A;  3PH5 A;  5FFH A;  2MHD A;  2WEX A;  5AYD A;  5LJB A;  1R0U A;  5C0N A;  3UAQ A;  1ALB A;  3U0D A;  3JS1 A;  1I06 A;  4A8Z A;  5FK7 A;  2AMM X;  5JR8 A;  1CRB A;  2AL0 X;  2GJ5 A;  4YGZ A;  3LEM A;  4QZU A;  1KQW A;  3VPJ E;  2XKL A;  1YWD A;  1OBQ A;  3C7E A;  2MWH A;  4YDA A;  4GRJ A;  4GK9 A;  3B2L A;  3VE2 A;  3D96 A;  3C7F A;  2QO4 A;  3E3C A;  1BEB A;  1XKI A;  3ZXJ A;  3BSZ E;  4IAB A;  3STN A;  4AZO A;  4ZHG A;  3BYN A;  1W18 A;  3SC7 X;  3WMZ A;  3FEL A;  4GNW A;  4I3D A;  3C7G A;  3LF7 A;  3LIH A;  3B2J A;  2X8S A;  1JJX A;  3HOE A;  4ORS A;  1QWD A;  5BVT A;  5GLR A;  4U6D A;  3FIQ A;  3NQH A;  4O4O A;  1O8V A;  1YWA A;  3G7X A;  1RLB E;  2FR3 A;  2FLJ A;  5LJH A;  1E00 A;  3S60 A;  2QM9 A;  3VG2 A;  5GLP A;  4ZHC A;  1ZRY A;  3MBT A;  3ZQ3 A;  4XMG A;  4GH7 A;  5EDC A;  4YMY A;  1QQS A;  2BS6 A;  2R56 A;  2FS6 A;  5D48 A;  5IO6 A;  1AEL A;  4ORU A;  3RZY A;  4I3C A;  2Q4N A;  2WUT A;  4GDZ A;  4O4U A;  4O3W A;  3RSW A;  5BYP A;  1FEM A;  1U0X A;  1NP1 A;  1IKJ A;  1KT5 A;  3GE2 A;  4WFV A;  1BWY A;  4IB9 A;  2WQA E;  2CBR A;  1AB0 A;  5FQ7 E;  4FFG A;  3CWK A;  2RA6 A;  4N2Z A;  2M4L A;  2LBV A;  1JJJ A;  2YMS A;  1VYF A;  1ERB A;  3QC2 A;  1GYE B;  5B6T A;  5AEO A;  4PJ2 A;  1AQB A;  1JIW I;  4QRL A;  1QY1 A;  5IO7 A;  3KST A;  4N2R A;  4LZV A;  5H9A A;  4FBO A;  1LFO A;  1YRZ A;  2L9C A;  5A7V A;  1KGL A;  4ALO A;  3RKG A;  2Q9S A;  1OPB A;  3ZW1 B;  2G78 A;  1VPR A;  3GAQ A;  3UEV A;  5HZ6 A;  1B0O A;  3B2H A;  1DV9 A;  3ZWE A;  4HPB A;  3UGG A;  1SY2 A;  2AT6 X;  2YFS A;  4XME A;  4OMW A;  3I17 A;  3MX7 A;  3UEW A;  1ST8 A;  1BJ7 A;  3TAW A;  1FTP A;  2FTB A;  4EXZ A;  4MIS A;  3OM7 A;  3UGF A;  1LIE A;  2JW1 A;  3KF5 A;  4JGL A;  4U3Q A;  3UGH A;  1YP7 A;  4QQS A;  1BRQ A;  4YGG A;  3K1U A;  3UEU A;  1CBQ A;  5DPQ A;  1A18 A;  1LID A;  2W2A A;  1G74 A;  5D45 A;  3U75 A;  2ACP X;  4K19 A;  1GXA A;  2GTF X;  2X8T A;  2OVA A;  4IMN A;  4ARH A;  1ADL A;  1ZNK A;  1HQP A;  1B8E A;  3CBS A;  3CQR A;  4AZP A;  3FA9 A;  4AW8 A;  1SMP I;  1Y9L A;  2LFO A;  2WWP A;  4CSB A;  2QQU A;  3VSF A;  2AT3 X;  4KCB A;  1NP4 A;  3SOT A;  2QOS C;  3ZW0 A;  3CMP A;  1SXW A;  3R4Y A;  4GNY A;  4NLJ A;  1CBR A;  5HWZ A;  5KHP A;  2BS5 A;  4GKC A;  2FR2 A;  3VG7 A;  2CBS A;  1BSY A;  2NP1 A;  1LIB A;  2KTS A;  4IMO A;  3PEC A;  1EQD A;  5D8J A;  4IB8 A;  3FR2 A;  1IKE A;  1DZJ A;  3FEP A;  1SY3 A;  2Z4I A;  1QY0 A;  5HA0 A;  5H9K A;  2BLG A;  5AYC A;  5D47 A;  4Y0S A;  4ZGF A;  5EED A;  3F8A A;  1H91 A;  1IFC A;  2POA A;  3EYC A;  4KCA A;  3R4Z A;  2YFT A;  1BBP A;  4KH8 A;  3ZUO A;  4O8N A;  4UDJ A;  1QY2 A;  1I05 A;  4GU8 A;  4TQ2 A;  1YIF A;  4KC8 A;  4AK5 A;  3MVF A;  4O9S A;  2CM9 A;  3JQO A;  1VKD A;  4L3R A;  4NNT A;  1HMS A;  3RWX A;  2W2F A;  3LV4 A;  4R0B A;  4UDK A;  1DC9 A;  1N0S A;  1X71 A;  2L68 A;  2MO5 A;  3WJG A;  2OFR X;  4YKO A;  4O4X A;  1BM5 A;  3OBL A;  5LJC A;  4UU3 A;  2EXH A;  2CM4 A;  3BDR A;  1DZK A;  5LJD A;  3PPT A;  5F1E A;  5AJC A;  2RN4 A;  5FKC A;  1ERX A;  3BX7 A;  1Z24 A;  3HWF A;  1P6P A;  1G85 A;  1IFB A;  3BLG A;  3KFG A;  3NQ9 A;  3PP6 A;  3QEF A;  1OEE A;  4MVI A;  3D60 A;  3BY0 A;  2WSJ A;  4NYR A;  3S26 A;  3WN1 A;  3BYK A;  2K23 A;  1FEN A;  4XMF A;  5JOY A;  5LJK A;  4QYN A;  4YGH A;  3ZI8 A;  1MVG A;  2F09 A;  2OVS A;  5LJE A;  1UYP A;  4UDK E;  5B6S A;  3OM5 A;  1OPA A;  1QFV A;  3HWE A;  1IIU A;  1HMR A;  4N7C A;  3WXQ A;  3U14 A;  5L8O A;  1ICN A;  1GT3 A;  1QFT A;  3WN0 A;  3P6E A;  2O62 A;  5K06 A;  4QGV A;  4LKP A;  4MVK A;  3FR4 A;  1MX7 A;  3WPV A;  2OVE A;  1KT7 A;  2MJI A;  4ZFX A;  3I0A A;  2NND A;  3APU A;  2OVD A;  4LZU A;  4YBU A;  4ZH9 A;  3LDR A;  3BU1 A;  4U8U O;  3WJB A;  3OM6 A;  3P2N A;  3QEE A;  4PVI A;  2DM5 A;  2ZAI A;  3FA8 A;  4ZGU A;  3B2I A;  3PIJ A;  2Q2M A;  2XQR A;  2P8G A;  3UEX A;  5L8I A;  4O8O A;  4N1I A;  4CK4 A;  1KZX A;  2QMI A;  3WBG A;  1QAB E;  3D4R A;  5FQ8 E;  3WAS A;  3KF3 A;  3U9P C;  5GLO A;  2ALL X;  4U8U M;  2FT9 A;  1X8Q A;  5D4A A;  1I4U A;  4ORX A;  1JZU A;  3JSQ A;  4I95 A;  4YH0 A;  3CR6 A;  2CZT A;  1G5W A;  4QGX A;  3OM4 A;  3WAU A;  1MUP A;  3LIG A;  1X8N A;  2F73 A;  3FLL A;  5HZ8 A;  5FK8 A;  2Q2P A;  3N91 A;  4ZHD A;  1KZW A;  1WL7 A;  4QQ1 A;  5LJG A;  1U18 A;  4ZHF A;  2EXJ A;  3APX A;  1SXY A;  5A7V B;  2OXB A;  3TF6 A;  4YBP A;  4BOE A;  1ZND A;  3OM2 A;  4AZR A;  5EZ2 A;  1GT1 A;  2HMB A;  4ZCB A;  2Q39 A;  3WAT A;  2HYS A;  3HTY A;  3B2K A;  5BVS A;  4FBV A;  2E4J A;  3EMM A;  4YKM A;  4Y0R A;  3OD9 A;  3SAO A;  3ZW2 A;  4YCH A;  5GLL A;  5EDB A;  3VG3 A;  4WBK A;  2ZAG A;  4NYQ A;  5FIX A;  1DFV A;  3Q6L A;  4LKT A;  4ORW A;  2R73 A;  5EEE A;  3PH6 A;  4OS8 A;  4DQ4 A;  4O8P A;  3NX1 A;  4I3B A;  4D6B A;  4A1Y A;  3V8U A;  4GE1 A;  4OS3 A;  5H9N A;  4AK7 A;  4QGW A;  2ADD A;  1EUO A;  1L6M A;  4M6S A;  4QYP A;  4YFP A;  5F6Z A;  5HBS A;  3WJD A;  4COT A;  4FBR A;  1EII A;  3O19 A;  4EFG A;  5FKB A;  3O22 A;  2AEZ A;  1Y9T A;  2FRS A;  3NP1 A;  5HAE A;  3P6D A;  3BX8 A;  2RQ0 A;  1QG5 A;  1YIV A;  4O3Y A;  5HZ5 A;  3P6H A;  3ZW0 B;  3P6F A;  5H8T A;  3VSS A;  4EQV A;  5JOX A;  4O3Z A;  1PEE A;  4ES7 A;  3LDK A;  2KD2 A;  5AY9 A;  4OS0 A;  2AEY A;  2JU3 A;  3DTQ A;  4A1H A;  4ALB A;  3P6C A;  3BYJ A;  3D95 A;  3FR5 A;  4MIR A;  4KMI A;  4AK6 A;  1URE A;  5LKE A;  2JMB A;  3HWG A;  4TKJ A;  1RBP A;  1X89 A;  3FEN A;  3TGA A;  1OYG A;  4RUN A;  4QZT A;  3C7H A;  3OJY C;  3HOL A;  2JOZ A;  1YUP A;  2GTL O;  5HTD A;  1OEK A;  1SXU A;  1BSO A;  1FE3 A;  1OBU A;  1ML7 A;  3FW4 A;  3WJF A;  2X8F A;  3AKF A;  3EBK A;  1CBS A;  2L67 A;  1E06 A;  2AT5 X;  2X46 A;  4U8U N;  5A8D A;  4FGI B;  2QO5 A;  3WPZ A;  4KT5 A;  4Y0Q A;  4ORY A;  1UZ2 X;  4YDB A;  1S7D A;  3WJE A;  4XMD A;  1T68 X;  2LBA A;  2KW1 A;  3PQU A;  4ID2 A;  4UDI A;  1ZNE A;  1PMP A;  2GTL M;  1TXL A;  4IBA A;  4YFQ A;  1ZNL A;  2NNQ A;  3HK1 A;  5H9L A;  5CE4 A;  5KID A;  3HWD A;  4AZQ A;  1A57 A;  4U6B A;  2LB6 A;  4MLG A;  3IFB A;  1D3S A;  3AKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...