2X8SA

Crystal structure of the abn2 d171a mutant in complex with arabinotriose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
443
structure length
443
Chain Sequence
b'KPIFKEVSVHDPSIIETNGTFYVFGSHLASAKSNDLMQWQQLTTSVSNDNPLIPNVYEELKETFEWAQSDTLWAADVTQLADGKYYMYYNACRGDSPRSAMGVAVADNIEGPYKNKGIFLKSGMEGTSSDGTPYDATKHPNVVAPHTFFDKDGKLWMVYGSYSGGIFILEMNPKTGFPLPGQGYGKKLLGGNHSRIEGPYVLYNPDTQYYYLYLSYGGLDATGGYNIRVARSKKPDGPYYDAEGNPMLDVRGKGGTFFDDRSIEPYGVKLMGSYTFETENEKGTGYVSPGHNSAYYDEKTGRSYLIFHTRFPGRGEEHEVRVHQLFMNKDGWPVAAPYRYAGETLKEVKQKDITGTYKLIQHGKDISADIKQTINIQLNKNHTISGEMTGTWRKTGKNTADITLAGKKYNGVFLRQWDSVREKNVMTFSVLNTSGEAVWGSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDO-ALPHA-1,5-L-ARABINANASE
publication title New Evidence for the Role of Calcium in the Glycosidase Reaction of Gh43 Arabinanases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 131
structure length 443
sequence length 443
chains with identical sequence B
ec nomenclature ec 3.2.1.99: Arabinan endo-1,5-alpha-L-arabinosidase.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF16369 GH43_C C-terminal lipocalin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.10 Mainly Beta Beta Barrel Lipocalin Lipocalin 2x8sA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2x8sA01
3WAUA 4KCAA 4N2RA 3LIHA 2EXKA 3QEFA 5GLMA 3R4YA 4N1IA 4FFFA 3U14A 5FIXA 3D5YA 4PVIA 4UDKE 3WATA 3KSTA 3VT2A 1Y9GA 3CU9A 1W18A 4FFHA 3K1UA 3VSFA 3BYKA 3SC7X 4ONZA 5JOWA 4EQVA 5GLNA 2RN4A 5GLQA 1ST8A 1YI7A 3OM5A 1Y4WA 5FK8A 1Y7BA 3D60A 2ADEA 5JOZA 3PIGA 5AY9A 3NQHA 3AKIA 3D61A 3C7EA 3ZXJA 4KC8A 4AK5A 3P2NA 3QEEA 3C2UA 5GLRA 1YRZA 3U75A 3LIGA 3VT1A 2ADDA 2EXJA 5A8DA 3WN2A 3AKFA 5A7VA 4O8PA 3C7OA 3WN0A 3WPZA 3QEDA 4UDKA 5AYCA 1SMPI 2YFTA 3LFIA 3WPYA 5C0PA 3LF7A 3AKGA 3BYNA 3C7HA 5FK7A 3OM6A 3LDKA 1GYEB 3VSZA 4COTA 5JOYA 3ZXKA 4UDGA 3WMYA 5A8CA 4UDIA 3LEMA 3BYLA 3R67A 1GYHA 1GYDB 3C7GA 2OXBA 5FMBA 2EXHA 3ZXLA 3BYJA 2B4WA 5ANNA 4U6BA 3OM2A 5AYEA 4PVAA 1W2TA 3OM4A 3PIJA 5GLOA 4U6DA 3WMZA 3WASA 5FKCA 4KMIA 2YFRA 4NOVA 4KC7A 2VDTA 3UGFA 3QC2A 3AKHA 5B6SA 2QQWA 4FFIA 5FKBA 3TAWA 3LDRA 2X8SA 1WL7A 3VSSA 2X8TA 1UV4A 4O8OA 2QQVA 3RWKX 3LV4A 3UGGA 3WPVA 4FFGA 1Y9MA 2X8FA 2XQRA 1OYGA 2AEYA 3KF3A 1YIFA 3OM7A 3D5ZA 4N4BA 5GLLA 1VKDA 3WN1A 1UYPA 2AEZA 2YFSA 1PT2A 3QZ4A 5FLWA 3UGHA 4AK6A 4QQSA 5B6TA 4AK7A 1JIWI 3WPUA 5AYDA 2AC1A 3KF5A 5A7VB 5FMCA 4KCBA 4MLGA 3VT0A 4O8NA 4N2ZA 5JOXA 4UDJA 5GLPA 2EXIA 5FMDA 4D47A 5GLKA 2QQUA 3VSRA 3C7FA 3R4ZA
chains in the Genus database with same CATH superfamily
1JJUA 4U3QA 3VG5A 4N2RA 3EYCA 1RSTB 5FIXA 2VFBA 4PVIA 1RLBE 3P6DA 2GTLN 4CPIA 2F73A 1HQPA 4FFHA 3NR3A 2GC9A 2K23A 1IFBA 3O19A 3HOEA 3CBCA 1LCZA 1D3SA 1X8NA 3PIGA 4ZHHA 4Z27A 2L9CA 1G5WA 3UEXA 3OE3A 4PSQA 3BRNA 1X8UA 2HZRA 1SMPI 4L1NA 3JSQA 1B56A 1X8PA 5HZQA 5B2AO 5C0PA 1GT3A 3LF7A 2AT3X 5LJHA 4RUUA 3OBLA 1G7NA 1GYDB 3PK2A 1AVEA 1TL2A 1HN2A 1MX7A 1Z24A 3RBYA 1SA8A 4YGGA 1I04A 1N43A 2GTLO 3WMZA 1I05A 1YWAA 1QY1A 2OL8O 4NYRA 1Y52X 4TKJA 3AKHA 2X8SA 3WXQA 5KICA 2OVEA 3VSSA 3U0DA 4Y59A 5HZ6A 4M6SA 1UREA 4GGZA 4EDEA 4FGIB 4QRLA 3WJEA 5GLLA 1EPAA 3N91A 4RUNA 2CBRA 2RTQB 2RTBB 2UZ2A 1MM9A 3WZQA 4LQZA 2F09A 1BM5A 1U18A 4A1HA 3KF5A 4QYPA 2X4MA 1KOIA 2GJ5A 1SRHA 3MX7A 4Y0SA 4QQ1A 2IFBA 5IRWA 3WBGA 4TLJA 1NDJA 2DM5A 1ZNHA 2RD7C 5D4AA 1SRJA 5JOWA 1AQBA 4ZCBA 2ZSCA 2LA7A 1Y9LA 1OPAA 1D2UA 3D60A 2G78A 1STPA 3SZHA 4GGRA 4O4UA 1HXZA 1VYFA 4CPFA 1U17A 4O3XB 3VT1A 2WR6A 1TW4A 4UDKA 5AYCA 1SRGA 3P6CA 4WFVA 4O3ZA 5B27A 1VWKB 2RTFB 3LEMA 4MVKA 5BVTA 4AZRA 2A2GA 1I06A 4KT5A 5B3MO 5HCDC 3WZOA 2NNEA 1SWAA 4YGZA 2CAMA 1Y55X 1Y53X 3P6GA 2BS5A 5FFHA 2RCQA 5B29A 5EDBA 1SWSA 5EEEA 4IAXA 3SLTA 1BSOA 3ZZVA 1Y0GA 4R0BA 4QAEA 2FKGA 3VG6A 3FELA 1FDQA 1SLGB 1SWLA 1JQPA 3VPJE 1ADLA 4KCAA 2N93A 2EXKA 3R4YA 1PTSA 2Q39A 3SOTA 1GX9A 1T68X 5H9AA 2KT4B 2BHVA 3CWKA 2ZAGA 2HMBA 1CJ5A 1KL3A 4YMYA 3MM0A 5D47A 3FA6A 4NLIA 2M4LA 3WJDA 2RTNB 1LPJA 1YRZA 3LIGA 2EXJA 1MDCA 3I0AA 4BCSA 4TKHA 4O3WA 1ZNGA 5IO7A 4Y0PA 3CBSA 3RDOA 3WJBA 2X55A 1U0XA 3VSZA 1QY0A 4NP1A 2WQ9A 1UYOX 1VWAB 1YWCA 4KH8A 3ZQ3A 4CK4A 1JMXA 4QNIA 1QY2A 5D8JA 5ANNA 4YCHA 3AKNA 1W2TA 3WASA 3ZW0B 2RTKA 4A1YA 4ZHCA 2FKJA 4FFIA 3LDRA 3WYPA 1UV4A 3RWKX 3APVA 4GZVA 2OFBA 4ZHDA 5KIDA 1VKDA 1DZJA 3EW2A 1PT2A 3T1DA 3S26A 1FE3A 5AYDA 5FMDA 4YGHA 5GLKA 4ZGFA 3FR5A 2OY5O 3NADA 3SAOA 4QGWA 4UDKE 1GGLA 2KTDA 3K1UA 2ACPX 2IZLB 1BRQA 5GLNA 4FBRA 5JOZA 1PMPA 2OY7A 2AMMX 1DV9A 3NQHA 3C7EA 3QQ2A 4IB7A 3Q34A 3ZW0A 5GLRA 4AZMA 3CKGA 5D45A 1VPRA 1HY2A 5IO6A 4LZUA 1RBPA 1TOWA 3RY1A 2WSJA 2A3FX 1LIBA 3ZWEA 3STMX 4Y0RA 4JGLA 3ZXLA 4U8UM 4BX6B 1A57A 2LB6A 1RXHA 4DNEA 1CRBA 3QKGA 3UGFA 5FKBA 1XCAA 1JZUA 2KTSA 2X8TA 3WPVA 1SWDA 1NQMA 2F01A 2NNDA 3RSWA 5L8IA 4O4XA 2MHDA 3FDCA 3P6HA 2AT0X 2Q4NA 1N0SA 4Z2VA 3EC5A 4I3CA 4XMGA 1KZWA 3VG3A 2OZQA 5F6BA 1ALBA 3EMMA 4ORYA 2QQUA 3LIHA 4A8ZA 1HMSA 3D5YA 1ZNLA 3KSTA 3VT2A 2ASNX 5LJEA 5B5FA 4MISA 3VHHA 5FQ8E 3ZI8A 3IFBA 1IW2A 1K24A 3X00A 4L3RA 4Y5DA 4BX6A 3AKIA 1VWPB 4NLJA 5L3YA 2FHNX 3IA8A 2QOMA 1W6FA 1SY1A 3WPZA 3RDXA 1X89A 3RZYA 1LNMA 3F8AA 3WYQA 3BYNA 4TQ2A 5FK7A 2JOZA 2FS6A 2OFMX 1SWEA 2A5BA 5A8CA 3BYLA 3RKGA 1NP1A 4O3YA 1YWDA 5LJKA 2B4WA 1EW3A 2MO5A 4EXZA 1VWHB 4KMIA 1AELA 4KIIA 1VWCB 2IZEB 1I78A 4AZNA 3HWGA 1SRFA 2WWPA 1BWYA 1E06A 1HXLA 1Y9MA 4DQ3A 1OYGA 4O4OA 2BT9A 2HZQA 2AT8X 3B2JA 4AK6A 4MVEA 2AC1A 3U03A 4ORUA 5HBSA 4NV7A 4AYHA 1GKAB 2IZIA 3KZAA 3WAUA 2AVIA 2G5LA 3ZW2A 1KL4A 3PDFA 2IZAA 3F9DA 1Y4WA 1EXSA 4U8UN 1QFVA 4LKTA 4AZQA 2IZKA 2AT6X 4IRWA 2FWVA 4LKPA 4YFPA 3MVFA 4O4SA 3HOLA 1B8EA 2Q2PA 3P6EA 5C0NA 4OELA 4QGVA 1SXYA 2FGSA 5B11O 2OF9A 2BLGA 4IMOA 3FW4A 3VHIA 1KFFA 2RTMA 1KXOA 1GKAA 4KC7A 3VGWA 4U8UO 1QABE 3UGGA 4FFGA 1ZNEA 5IRUA 2QCBA 1YP7A 4CDDA 2JW1A 2FS7A 2QM9A 3K3LA 3VE2A 1NQNA 5IRAA 3WJGA 4IBAA 3T6LA 2IZBA 1TOUA 2ANSA 2HNXA 4BOEA 2BS6A 1G74A 4NV8A 1SXUA 2W2AA 3R4ZA 2RTDB 3BY0A 1IFCA 4N1IA 2LKKA 4QYNA 1PEEA 2FLJA 1SWQA 3SC7X 3B2IA 2FR3A 2QOSC 2RTPB 3FW5A 2WEWA 1LKEA 4ORXA 2OL6O 1W5RA 3RE6A 3P2NA 3HWEA 3HPEA 4EEJA 3WN2A 3C76X 3QEDA 2BC3A 2OVAA 4ZGUA 1JJXA 2KD2A 4GGTA 1SLFB 2IZHB 3OM6A 3LDKA 2AKQA 4COTA 3VHMA 1BJ7A 5LKEA 4HWMA 4TNNA 1NP4A 1DFVA 4DQ4A 2C1SA 4PVAA 1T8VA 3OM4A 4ML7B 3V8UA 5HCEC 1JYJA 2O62A 3BU9A 1DZPA 1DZKA 2QO4A 2QMIA 4MVLA 1XKIA 2W2FA 3B2HA 3DTQA 1YIFA 3U9PC 3D5ZA 1VWLB 1MK5A 4GKCA 3FENA 1WBIA 1LDQA 3B2KA 4CPEA 1SWCA 2G7BA 4MLGA 4O8NA 1SY3A 4UDJA 2YMSA 3DSZA 4Z2PA 2RTJA 5F58A 5GLMA 2CBSA 4FFFA 2CZTA 2LBAA 3I17A 4GE1A 5H9LA 3CU9A 1UZ2X 3WZPA 2ADEA 5D48A 2Q2MA 3BLGA 2AH7X 4KC8A 5JR8A 4UU3A 1OEJA 3O2YA 1UYNX 3WJCA 2ADDA 1R0UA 4ORRA 2P8GA 1QFTA 3WZNA 1GT5A 5L8OA 2EU7X 1X71A 1O8VA 4HPAA 2QO5A 3WMYA 2RTEB 1SWUA 1EPBA 5CYBA 1AVGI 3C77X 2AT5X 1VWGB 1KT5A 3QC2A 4ARHA 3TAWA 1WL7A 4O8OA 2R74A 3LV4A 1TXLA 4YH0A 4JNJA 1VWNB 5B5GA 1FJ1E 3EBWA 3TGAA 2WQAE 1KQXA 2G79A 2RQ0A 3UGHA 1EIIA 4ALBA 5AQ6A 4AK7A 2HLVA 1HBPA 1VWOB 4HFOA 1H91A 2Z4HA 3WVMA 4CDCA 4GDZA 1BSQA 3VSRA 3WJFA 4NNTA 1YP6A 3G7XA 1VYGA 1Y9GA 2IZCB 1GX3A 4AZPA 3BS2A 2RN4A 3VG2A 3GE2A 3ZUIA 3ELZA 2OFRX 3RDUA 1LCVA 2MF6A 2JU3A 1FENA 5A7VA 1IJ8A 1KT3A 3WN0A 4ZFXA 2Q9SA 2AF5A 3LFIA 4GH7A 1IKEA 1GYEB 3GAQA 1STRB 4UDGA 3FA9A 1OBQA 4GJVA 3PQSA 2XSTA 4ODDA 3OM2A 1HMRA 5K67A 5FKCA 4MIRA 3D95A 2VDTA 3NBXX 2WEXA 1AB0A 2MWHA 4BVMA 1FTPA 2AEYA 2DJGA 2FHLA 2E4JA 5HWZA 1LELA 5HCCC 2ZAIA 4CPHB 4OS0A 1PBYA 1ML7A 1GX8A 2VDFA 4YDBA 2X34A 1GM6A 3U14A 3FR2A 1IIUA 2C1QA 1OBPA 2KW1A 3TGBA 1BLRA 2QO6A 3H3IA 1MUPA 2IZFB 4IAWA 2VFCA 1VWQB 4ZHFA 5IO5A 4OKAA 2OVDA 3TZSA 2YFTA 3SZIA 5EDCA 4GUZA 5HZ8A 1DF8A 1QQSA 1GT4A 1SY0A 3KFIA 2NNQA 3MG5A 3PH6A 5AYEA 3HK1A 1IKJA 5DG4A 4CPHA 3FEKA 4M7MA 3ELXA 5HZ5A 3FMZA 2QQWA 4GJSA 4AZOA 4UU2A 4D6AA 4MEEA 3T6FA 1ICNA 3PQUA 3APXA 1SWJA 2WUTA 3JQOA 2R56A 3NQ3A 2FT9A 3D9WA 1SWHA 3CR6A 3UEVA 1SREA 1JBHA 3HTYA 4QQSA 3B2LA 1B0OA 3WPUA 4KCBA 5LKFA 1S7DA 4ZHGA 2FRSA 2EXIA 2OL7A 2HYSA 2AL0X 5F6ZA 3P24A 2C4IA 4IB8A 5EZ2A 1EUOA 1X8OA 4U9CA 4IB9A 5AJCA 5CE4A 4OS8A 5C2MA 3FLLA 3LHNA 5F7GA 1I4UA 5GLQA 3D97A 3OM5A 4WFUA 5FK8A 3S60A 2RTGB 2PY1A 4DCBA 4AK5A 4XMDA 1BBPA 5H9KA 1SWRA 1SLEB 1EQDA 1HMTA 1SLDB 4I3BA 3CQRA 1DZMA 2IZDB 4JHQA 4GNWA 4BGFA 1RXJA 1LICA 2A5CA 1KT7A 1VWFB 4GD9A 3NQ9A 2OYBO 1HBQA 1S2PA 3STNA 2Y3FA 2X8FA 1RAVA 2YG2A 2XQRA 4YCEA 2PI3O 3WN1A 5HTEA 4FBOA 1S44A 2RCTA 4XMFA 5HTDA 3PECA 2RTRB 2JU7A 1SWPA 1W4TA 3BSZE 3BDRA 2RTIB 3RDSA 1LIDA 4ORWA 5LJCA 3QEFA 4BX5B 1YWBA 4ID2A 3WATA 2ALLX 2RTAA 1MEPA 3FIQA 1SWBA 3BYKA 3SZJA 3BU1A 4QZUA 3NX2A 4N7CA 1STSB 3ZUOA 5L8NA 5DPQA 3ZXJA 1KT6A 3QEEA 1SXWA 1LUQA 2A8GA 4O8PA 5H8TA 3C7OA 3UAQA 1NGLA 3MBTA 1VWIB 1MVGA 2UYWA 3L4RA 3O22A 3BX7A 3C7HA 2OY1O 3D96A 4INNA 2BSZA 2FTBA 4NW4A 4U46A 2RTHB 4OMWA 1GXAA 3STKA 2RA6A 1E02A 1O1UA 2EXHA 3E3CA 4C5PA 5K06A 3OJYC 1CBRA 4U6BA 3AKMA 2LBVA 1DF3A 4U6DA 3FA7A 1N7YA 1RSUB 1MOYA 3FEPA 4BX5A 5BVQA 4ON1A 1SWOA 4I95A 5B10O 3OM7A 2X32A 4B55A 4N4BA 4Z28A 1CBSA 2YFSA 3AUMO 1X8QA 4I6SA 5LJBA 1JJJA 1VWRB 1P6PA 5FMCA 3VT0A 1CBQA 5GLPA 1SWFA 4IB6A 1CBIA 3FYFA 3APUA 3ZW1B 4K19A 3FIDA 3FR4A 1ACDA 2A2UA 5BYPA 1VWMB 4YFQA 1G85A 5IXGA 4AW8A 1DC9A 1KT4A 4GU8A 3VG4A 2IZJA 4YVBA 4YKMA 3WPYA 2I5VO 1KL5A 2MM3A 1ZNKA 4N7DA 5FMBA 5HA1A 2L68A 2HKDA 1VWDB 4O9SA 5AEOA 1A18A 4OS3A 1N4JA 3HWFA 3SLOA 3HWDA 5FAZA 5KHPA 2Y32A 1GT1A 5BVSA 4FBVA 3NQKA 4BX7B 3ZW1A 5CSEA 2JN3A 4LZVA 3RDQA 3RDMA 1HQQA 1UYPA 2WPUA 1SXXA 3QZ4A 3PP6A 3PH5A 2CM4A 4CSBA 5A7VB 2OFAA 5HAEA 4YDAA 4GNYA 3AEHA 3APWA 2JMBA 1SRIA 4IMNA 4YBUA 2X56A 3S5VA 4TJZA 4ONZA 1A3YA 4ZJ0A 1YI7A 5AY9A 1OBUA 5F2BA 1OSPO 1I9HA 3KFGA 1VWEB 1BEBA 4Y0QA 3VE1A 2LFOA 3Q6LA 4BX7A 1PM1X 1SWTA 1SWNA 3PPTA 4QZTA 3FA8A 2GTFX 1YUPA 1A2DA 3RY2A 1ICMA 1YIVA 1JYDA 4GK9A 1JMZA 5F1EA 2ACOA 3R67A 4IABA 3VU1A 1GYHA 1ZNDA 3UEUA 2A0AA 2OXBA 4D6BA 3D4RA 3NPOA 3BYJA 3SLJA 1ZRYA 3RE5A 3PIJA 2CZUA 1AVDA 4BBOA 4I9SA 5B6SA 2CM9A 1Y9TA 1FEMA 1PBOA 2QQVA 3BX8A 1SWKA 1QG5A 4GDAA 4PJ2A 5AJBA 3TGCA 4Z6JA 1N9MA 4ZR2A 4QGXA 2RTCB 4ORSA 3OD9A 4XMHA 2IZGB 1KQWA 1BRPA 1JV4A 4GETA 1LIEA 3C7FA 4HPCA 1MX8A 4Z2OA 1T0VA 1N9YA 1W18A 3NP1A 3NX1A 2A13A 4NYQA 3VSFA 4CDEA 5EEDA 3KFHA 2Y3EA 2Z4IA 4CV7A 3T2WA 1FELA 4JO6A 5K68A 2NP1A 3D61A 4TKBA 5EPQA 4WBKA 4CDFA 3U75A 4I60A 2XKLA 5A8DA 4WHIA 1VWBB 2X45A 3S5XA 1EI5A 4EQAC 1QWDA 2R73A 2K62A 4XMEA 4OMXA 3AKGA 1NC9A 2OF8A 5JOYA 3ZXKA 2GTLM 3T2XA 4BQUA 4UDIA 2G8CO 4YBPA 4I3DA 4ZH9A 3EBKA 4EFGA 4HPBA 4ALOA 4I9RA 4HPDA 1ERBA 1LFOA 5GLOA 5FQ6E 4NOVA 1LIFA 5H9NA 2DJFA 5CHKA 3EM0A 2OY8A 1ERXA 3UEWA 3KF3A 1E2TA 1E5PA 3EW1A 1BSYA 5FLWA 5B6TA 4YKOA 2W2BA 3PEDA 5LJGA 1LF7A 1JIWI 3WOVA 4N2ZA 4D47A 1VWJB 2JGSA 4GRJA 1B4MA 4OEMA 2JU8A 4NNSA 4EQVA 4XMCA 1ST8A 1EIOA 1Y7BA 1EALA 3TF6A 1SY2A 3C78X 1OEKA 4A60A 3C2UA 3F6ZB 3CQNA 3AKFA 1K3BA 1KZXA 2I5ZO 2GH7A 2L5PA 5FENA 2OVSA 3CMPA 3CKFA 4EKVA 4O49A 5HZ9A 3C7GA 5FQ7E 3VG7A 1OPBA 3RWXA 4YFRA 4ZH6A 4ES7A 2YFRA 2RTOB 2FR2A 2RTLA 4FQBB 1O1VA 1KGLA 3KFFA 1NBXA 1OEEA 1LCWA 3KQ0A 1L6MA 1WUBA 1LDOA 3KVNA 5LJDA 1SWGA 2MJIA 5JD2A 2AEZA 4MVIA 2L67A 2X46A 5HA0A 4BJ8A 3P6FA 1RXKA 3P02A 5JOXA 2POAA 1VYOA 1TVQA 3JS1A 1E00A 3LTWA
chains in the Genus database with same CATH topology
4IB6A 4U3QA 3VG5A 1YP6A 3G7XA 1CBIA 3LIHA 4N2RA 4A8ZA 1HMSA 3EYCA 5FIXA 3D5YA 4PVIA 1RLBE 1ZNLA 3FYFA 1VYGA 3P6DA 2GTLN 3KSTA 2ASNX 5LJEA 2F73A 1HQPA 3APUA 1Y9GA 3VT2A 4FFHA 3NR3A 3ZW1B 4K19A 2GC9A 4MISA 2K23A 4AZPA 1IFBA 3O19A 5FQ8E 3HOEA 3BS2A 2RN4A 3ZI8A 3IFBA 3CBCA 1IW2A 1D3SA 1X8NA 4L3RA 3FR4A 3VG2A 3PIGA 1ACDA 3GE2A 3ZUIA 2A2UA 3ELZA 4ZHHA 5BYPA 3AKIA 2OFRX 2L9CA 4NLJA 4YFQA 1G85A 1G5WA 3UEXA 4AW8A 2JU3A 3OE3A 1FENA 3IA8A 4PSQA 5A7VA 1DC9A 1KT3A 1KT4A 3WN0A 4ZFXA 4GU8A 3VG4A 3BRNA 1SY1A 3WPZA 1X8UA 2HZRA 2Q9SA 1W18A 1X89A 1SMPI 4L1NA 3JSQA 3LFIA 4GH7A 3RZYA 1B56A 1X8PA 4YKMA 5HZQA 1LNMA 3F8AA 1GT3A 1IKEA 5C0PA 3LF7A 3WPYA 2AT3X 3BYNA 4TQ2A 5LJHA 5FK7A 2JOZA 4RUUA 1GYEB 3GAQA 2FS6A 4UDGA 2OFMX 2MM3A 3OBLA 3FA9A 1G7NA 5A8CA 3BYLA 1OBQA 1GYDB 1ZNKA 4N7DA 3RKGA 1NP1A 4O3YA 1HN2A 1MX7A 1Z24A 3PQSA 3RBYA 5HA1A 5FMBA 1YWDA 1SA8A 2L68A 2XSTA 4ODDA 4YGGA 1I04A 5LJKA 2B4WA 1EW3A 3OM2A 2MO5A 4EXZA 1HMRA 2GTLO 3WMZA 5FKCA 4MIRA 4O9SA 1I05A 1YWAA 1QY1A 3D95A 5AEOA 1A18A 4KMIA 2VDTA 4NYRA 3NBXX 4OS3A 4TKJA 1AELA 4KIIA 2WEXA 3HWFA 3AKHA 3HWDA 1AB0A 2X8SA 5FAZA 3WXQA 5KHPA 5KICA 2OVEA 4AZNA 3VSSA 3HWGA 2MWHA 3U0DA 4BVMA 1GT1A 2WWPA 5BVSA 4FBVA 3NQKA 1BWYA 5HZ6A 1E06A 1FTPA 4M6SA 1Y9MA 3ZW1A 4DQ3A 2JN3A 4O4OA 1OYGA 2AEYA 1UREA 4LZVA 2BT9A 4EDEA 4FGIB 4QRLA 3WJEA 5GLLA 1EPAA 3N91A 4RUNA 1UYPA 2HZQA 2AT8X 2CBRA 1SXXA 3B2JA 3QZ4A 2E4JA 3PP6A 3PH5A 4AK6A 4LQZA 5HWZA 4MVEA 2F09A 1BM5A 1U18A 4A1HA 2CM4A 2AC1A 5HCCC 3U03A 4CSBA 3KF5A 5A7VB 4ORUA 4QYPA 2ZAIA 5HBSA 4OS0A 5HAEA 4YDAA 1KOIA 2GJ5A 1GKAB 3MX7A 4GNYA 4Y0SA 4QQ1A 4AYHA 2IFBA 1ML7A 1GX8A 3APWA 3KZAA 3WBGA 3WAUA 4YDBA 2JMBA 4TLJA 3ZW2A 1GM6A 3U14A 3FR2A 1IIUA 2DM5A 1ZNHA 4IMNA 4YBUA 3S5VA 2RD7C 4TJZA 5D4AA 5JOWA 4ONZA 1A3YA 1AQBA 4ZCBA 1OBPA 2KW1A 2LA7A 1Y9LA 1OPAA 3F9DA 4ZJ0A 1EXSA 4U8UN 1Y4WA 3TGBA 1D2UA 1BLRA 2G78A 2QO6A 3D60A 3H3IA 1YI7A 1MUPA 1QFVA 4O4UA 1VYFA 4LKTA 5AY9A 1OBUA 4AZQA 2AT6X 4IAWA 1U17A 3KFGA 2FWVA 4O3XB 4LKPA 4YFPA 4ZHFA 3VT1A 3MVFA 5IO5A 4O4SA 2WR6A 1BEBA 1TW4A 3HOLA 4Y0QA 3VE1A 2LFOA 1B8EA 4UDKA 2Q2PA 2OVDA 3Q6LA 3TZSA 5AYCA 2YFTA 1PM1X 3P6CA 3PPTA 5EDCA 4WFVA 4QZTA 3FA8A 2GTFX 5HZ8A 3P6EA 5C0NA 1QQSA 1YUPA 1A2DA 1ICMA 4O3ZA 1YIVA 1JYDA 4GK9A 4QGVA 1GT4A 1SXYA 5F1EA 5B27A 2ACOA 3LEMA 4IABA 3VU1A 1GYHA 1ZNDA 1SY0A 3R67A 3UEUA 2A0AA 2OXBA 4D6BA 3KFIA 3D4RA 3NPOA 2NNQA 3BYJA 3PH6A 4MVKA 5BVTA 5AYEA 1ZRYA 2BLGA 3HK1A 1IKJA 4IMOA 4AZRA 3FW4A 3PIJA 2CZUA 2A2GA 3FEKA 4M7MA 5DG4A 1KXOA 1GKAA 3ELXA 5HZ5A 1I06A 3FMZA 4KT5A 4KC7A 4I9SA 5HCDC 2CM9A 2QQWA 5B6SA 4AZOA 1Y9TA 4UU2A 1FEMA 4U8UO 2NNEA 4D6AA 1QABE 4YGZA 1PBOA 2QQVA 1ICNA 3BX8A 3PQUA 3UGGA 1QG5A 3P6GA 4FFGA 3APXA 1ZNEA 2WUTA 3JQOA 1YP7A 2R56A 4PJ2A 2BS5A 2JW1A 5AJBA 3NQ3A 3TGCA 5FFHA 2FT9A 2FS7A 2RCQA 5B29A 2QM9A 4ZR2A 4QGXA 5EDBA 3CR6A 3UEVA 3K3LA 1JBHA 5EEEA 3VE2A 4IAXA 4ORSA 3OD9A 3WJGA 4IBAA 3HTYA 4XMHA 4QQSA 1TOUA 2ANSA 3B2LA 1BSOA 3ZZVA 1B0OA 3WPUA 2HNXA 4BOEA 2BS6A 1G74A 4QAEA 4R0BA 5JR8A 5LKFA 4KCBA 1S7DA 1KQWA 4ZHGA 1BRPA 1JV4A 2FRSA 3VG6A 3FELA 2EXIA 2HYSA 1SXUA 1FDQA 2AL0X 2W2AA 4GETA 1LIEA 5F6ZA 3C7FA 3P24A 3VPJE 3R4ZA 1ADLA 4IB8A 4KCAA 4HPCA 2N93A 1MX8A 5EZ2A 2EXKA 3BY0A 3R4YA 1IFCA 2Q39A 4N1IA 1T0VA 1EUOA 2LKKA 1X8OA 4QYNA 1PEEA 2FLJA 4U9CA 3NP1A 4IB9A 3NX1A 5AJCA 3SOTA 5CE4A 1GX9A 2A13A 4NYQA 4OS8A 3VSFA 3SC7X 3FLLA 3LHNA 5EEDA 5F7GA 3B2IA 1I4UA 1T68X 2FR3A 2QOSC 5H9AA 2KT4B 5GLQA 3D97A 2BHVA 3KFHA 2Z4IA 4CV7A 3OM5A 4WFUA 3CWKA 5FK8A 2ZAGA 3FW5A 2WEWA 3S60A 1FELA 1LKEA 2HMBA 4ORXA 1CJ5A 2PY1A 3WJFA 2NP1A 5D47A 4YMYA 3D61A 4TKBA 3FA6A 4NLIA 2M4LA 4WBKA 5EPQA 3WJDA 3P2NA 3HWEA 4AK5A 4XMDA 1LPJA 1YRZA 3U75A 1BBPA 4EEJA 3LIGA 2XKLA 2EXJA 5A8DA 3WN2A 3C76X 1MDCA 3I0AA 4WHIA 2X45A 3QEDA 4TKHA 2OVAA 3S5XA 1EI5A 4EQAC 5H9KA 4ZGUA 4O3WA 1JJXA 1QWDA 1ZNGA 2R73A 2KD2A 5IO7A 4Y0PA 2K62A 1EQDA 4XMEA 1HMTA 3CBSA 4OMXA 3AKGA 3WJBA 4I3BA 3LDKA 3OM6A 2AKQA 1U0XA 3VSZA 3CQRA 4COTA 1DZMA 1QY0A 5JOYA 3ZXKA 1BJ7A 2GTLM 4NP1A 2WQ9A 5LKEA 4BQUA 4HWMA 4UDIA 4TNNA 4YBPA 4I3DA 1NP4A 1YWCA 4KH8A 4ZH9A 3ZQ3A 4CK4A 3EBKA 4QNIA 1QY2A 5D8JA 4EFGA 1DFVA 4HPBA 4ALOA 5ANNA 4DQ4A 4GNWA 4I9RA 4HPDA 4YCHA 3AKNA 1ERBA 4PVAA 1W2TA 1LFOA 1LICA 1T8VA 5FQ6E 3OM4A 4ML7B 3V8UA 5GLOA 3WASA 3ZW0B 5HCEC 1JYJA 4NOVA 1KT7A 4A1YA 1LIFA 2O62A 5H9NA 3NQ9A 3BU9A 4ZHCA 1DZPA 1DZKA 2QO4A 4FFIA 2QMIA 3LDRA 4MVLA 3EM0A 1HBQA 1XKIA 1UV4A 3RWKX 1S2PA 2W2FA 3APVA 4GZVA 3STNA 1ERXA 3UEWA 2X8FA 2YG2A 3B2HA 2XQRA 4YCEA 3KF3A 3DTQA 1E5PA 4ZHDA 5KIDA 1YIFA 3U9PC 3D5ZA 1BSYA 1VKDA 3WN1A 5HTEA 4FBOA 1DZJA 1S44A 1PT2A 4GKCA 3T1DA 3FENA 2RCTA 4XMFA 5FLWA 5HTDA 5B6TA 3PECA 2W2BA 3PEDA 4YKOA 5LJGA 3S26A 1LF7A 3B2KA 1FE3A 1JIWI 2JU7A 5AYDA 3WOVA 2G7BA 4MLGA 4O8NA 3BSZE 4N2ZA 3BDRA 1SY3A 4UDJA 4D47A 2YMSA 5FMDA 4YGHA 5GLKA 3DSZA 4GRJA 4ZGFA 1B4MA 3FR5A 3NADA 1LIDA 5F58A 3SAOA 4ORWA 5LJCA 3QEFA 2CBSA 5GLMA 4QGWA 4FFFA 1YWBA 4ID2A 4UDKE 2CZTA 3WATA 3QEEA 2LBAA 3I17A 2ALLX 1GGLA 4GE1A 2KTDA 5H9LA 3CU9A 3FIQA 3K1UA 2ACPX 2JU8A 4NNSA 3BYKA 1UZ2X 4EQVA 1BRQA 3BU1A 5GLNA 4FBRA 4XMCA 4QZUA 1ST8A 3NX2A 4N7CA 1EIOA 1Y7BA 3ZUOA 2ADEA 5JOZA 1PMPA 5D48A 5L8NA 1EALA 2AMMX 1DV9A 2Q2MA 3NQHA 3BLGA 3TF6A 3C7EA 5DPQA 3ZXJA 2AH7X 1SY2A 1KT6A 3C78X 1OEJA 1OEKA 3O2YA 4IB7A 4KC8A 4UU3A 3ZW0A 4A60A 3C2UA 3F6ZB 5GLRA 1SXWA 3WJCA 3CQNA 4AZMA 2ADDA 3AKFA 4O8PA 5D45A 5H8TA 3C7OA 1VPRA 1R0UA 1NGLA 3UAQA 3MBTA 4ORRA 2P8GA 5IO6A 1KZXA 4LZUA 1MVGA 1RBPA 3L4RA 3O22A 2L5PA 3BX7A 5FENA 1QFTA 3C7HA 2OVSA 1GT5A 3CMPA 5L8OA 2EU7X 3D96A 1TOWA 1X71A 4INNA 1O8VA 4HPAA 2WSJA 4O49A 2A3FX 2FTBA 1LIBA 2QO5A 4NW4A 3STKA 4OMWA 1GXAA 3ZWEA 3WMYA 5HZ9A 2RA6A 1E02A 1O1UA 5FQ7E 3STMX 3C7GA 4Y0RA 1EPBA 5CYBA 3E3CA 5K06A 4JGLA 3VG7A 2EXHA 3ZXLA 1OPBA 1AVGI 3C77X 1CBRA 3OJYC 3AKMA 4U8UM 2AT5X 3RWXA 1A57A 4U6BA 4YFRA 2LB6A 4ZH6A 4ES7A 2LBVA 1DF3A 4U6DA 1KT5A 3FA7A 2YFRA 1CRBA 3QKGA 3UGFA 3QC2A 4ARHA 2FR2A 5FKBA 1WL7A 1XCAA 3FEPA 1JZUA 3TAWA 4FQBB 2KTSA 1O1VA 1KGLA 3KFFA 2X8TA 4O8OA 5BVQA 4ON1A 2R74A 3LV4A 3WPVA 4I95A 1OEEA 1TXLA 2NNDA 4YH0A 3KQ0A 3RSWA 5L8IA 1L6MA 4O4XA 2MHDA 3OM7A 3P6HA 2AT0X 4N4BA 5LJDA 1CBSA 2Q4NA 2MJIA 1N0SA 3EBWA 2AEZA 3TGAA 4MVIA 2WQAE 2YFSA 1KQXA 2L67A 2G79A 2X46A 5HA0A 2RQ0A 3UGHA 1EIIA 4ALBA 1X8QA 4I6SA 5LJBA 5AQ6A 1JJJA 4AK7A 3P6FA 4I3CA 4XMGA 1P6PA 2HLVA 1KZWA 1HBPA 4HFOA 3VG3A 1H91A 2Z4HA 3WVMA 5FMCA 3VT0A 2OZQA 4GDZA 1CBQA 3P02A 5F6BA 5JOXA 1BSQA 2POAA 5GLPA 1ALBA 3EMMA 1TVQA 4ORYA 3JS1A 2QQUA 1E00A 3VSRA 4NNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAU A;  4KCA A;  4N2R A;  3LIH A;  2EXK A;  3QEF A;  5GLM A;  3R4Y A;  4N1I A;  4FFF A;  3U14 A;  5FIX A;  3D5Y A;  4PVI A;  4UDK E;  3WAT A;  3KST A;  3VT2 A;  1Y9G A;  3CU9 A;  1W18 A;  4FFH A;  3K1U A;  3VSF A;  3BYK A;  3SC7 X;  4ONZ A;  5JOW A;  4EQV A;  5GLN A;  2RN4 A;  5GLQ A;  1ST8 A;  1YI7 A;  3OM5 A;  1Y4W A;  5FK8 A;  1Y7B A;  3D60 A;  2ADE A;  5JOZ A;  3PIG A;  5AY9 A;  3NQH A;  3AKI A;  3D61 A;  3C7E A;  3ZXJ A;  4KC8 A;  4AK5 A;  3P2N A;  3QEE A;  3C2U A;  5GLR A;  1YRZ A;  3U75 A;  3LIG A;  3VT1 A;  2ADD A;  2EXJ A;  5A8D A;  3WN2 A;  3AKF A;  5A7V A;  4O8P A;  3C7O A;  3WN0 A;  3WPZ A;  3QED A;  4UDK A;  5AYC A;  1SMP I;  2YFT A;  3LFI A;  3WPY A;  5C0P A;  3LF7 A;  3AKG A;  3BYN A;  3C7H A;  5FK7 A;  3OM6 A;  3LDK A;  1GYE B;  3VSZ A;  4COT A;  5JOY A;  3ZXK A;  4UDG A;  3WMY A;  5A8C A;  4UDI A;  3LEM A;  3BYL A;  3R67 A;  1GYH A;  1GYD B;  3C7G A;  2OXB A;  5FMB A;  2EXH A;  3ZXL A;  3BYJ A;  2B4W A;  5ANN A;  4U6B A;  3OM2 A;  5AYE A;  4PVA A;  1W2T A;  3OM4 A;  3PIJ A;  5GLO A;  4U6D A;  3WMZ A;  3WAS A;  5FKC A;  4KMI A;  2YFR A;  4NOV A;  4KC7 A;  2VDT A;  3UGF A;  3QC2 A;  3AKH A;  5B6S A;  2QQW A;  4FFI A;  5FKB A;  3TAW A;  3LDR A;  2X8S A;  1WL7 A;  3VSS A;  2X8T A;  1UV4 A;  4O8O A;  2QQV A;  3RWK X;  3LV4 A;  3UGG A;  3WPV A;  4FFG A;  1Y9M A;  2X8F A;  2XQR A;  1OYG A;  2AEY A;  3KF3 A;  1YIF A;  3OM7 A;  3D5Z A;  4N4B A;  5GLL A;  1VKD A;  3WN1 A;  1UYP A;  2AEZ A;  2YFS A;  1PT2 A;  3QZ4 A;  5FLW A;  3UGH A;  4AK6 A;  4QQS A;  5B6T A;  4AK7 A;  1JIW I;  3WPU A;  5AYD A;  2AC1 A;  3KF5 A;  5A7V B;  5FMC A;  4KCB A;  4MLG A;  3VT0 A;  4O8N A;  4N2Z A;  5JOX A;  4UDJ A;  5GLP A;  2EXI A;  5FMD A;  4D47 A;  5GLK A;  2QQU A;  3VSR A;  3C7F A;  3R4Z A; 
#chains in the Genus database with same CATH topology
 1JJU A;  4U3Q A;  3VG5 A;  4N2R A;  3EYC A;  1RST B;  5FIX A;  2VFB A;  4PVI A;  1RLB E;  3P6D A;  2GTL N;  4CPI A;  2F73 A;  1HQP A;  4FFH A;  3NR3 A;  2GC9 A;  2K23 A;  1IFB A;  3O19 A;  3HOE A;  3CBC A;  1LCZ A;  1D3S A;  1X8N A;  3PIG A;  4ZHH A;  4Z27 A;  2L9C A;  1G5W A;  3UEX A;  3OE3 A;  4PSQ A;  3BRN A;  1X8U A;  2HZR A;  1SMP I;  4L1N A;  3JSQ A;  1B56 A;  1X8P A;  5HZQ A;  5B2A O;  5C0P A;  1GT3 A;  3LF7 A;  2AT3 X;  5LJH A;  4RUU A;  3OBL A;  1G7N A;  1GYD B;  3PK2 A;  1AVE A;  1TL2 A;  1HN2 A;  1MX7 A;  1Z24 A;  3RBY A;  1SA8 A;  4YGG A;  1I04 A;  1N43 A;  2GTL O;  3WMZ A;  1I05 A;  1YWA A;  1QY1 A;  2OL8 O;  4NYR A;  1Y52 X;  4TKJ A;  3AKH A;  2X8S A;  3WXQ A;  5KIC A;  2OVE A;  3VSS A;  3U0D A;  4Y59 A;  5HZ6 A;  4M6S A;  1URE A;  4GGZ A;  4EDE A;  4FGI B;  4QRL A;  3WJE A;  5GLL A;  1EPA A;  3N91 A;  4RUN A;  2CBR A;  2RTQ B;  2RTB B;  2UZ2 A;  1MM9 A;  3WZQ A;  4LQZ A;  2F09 A;  1BM5 A;  1U18 A;  4A1H A;  3KF5 A;  4QYP A;  2X4M A;  1KOI A;  2GJ5 A;  1SRH A;  3MX7 A;  4Y0S A;  4QQ1 A;  2IFB A;  5IRW A;  3WBG A;  4TLJ A;  1NDJ A;  2DM5 A;  1ZNH A;  2RD7 C;  5D4A A;  1SRJ A;  5JOW A;  1AQB A;  4ZCB A;  2ZSC A;  2LA7 A;  1Y9L A;  1OPA A;  1D2U A;  3D60 A;  2G78 A;  1STP A;  3SZH A;  4GGR A;  4O4U A;  1HXZ A;  1VYF A;  4CPF A;  1U17 A;  4O3X B;  3VT1 A;  2WR6 A;  1TW4 A;  4UDK A;  5AYC A;  1SRG A;  3P6C A;  4WFV A;  4O3Z A;  5B27 A;  1VWK B;  2RTF B;  3LEM A;  4MVK A;  5BVT A;  4AZR A;  2A2G A;  1I06 A;  4KT5 A;  5B3M O;  5HCD C;  3WZO A;  2NNE A;  1SWA A;  4YGZ A;  2CAM A;  1Y55 X;  1Y53 X;  3P6G A;  2BS5 A;  5FFH A;  2RCQ A;  5B29 A;  5EDB A;  1SWS A;  5EEE A;  4IAX A;  3SLT A;  1BSO A;  3ZZV A;  1Y0G A;  4R0B A;  4QAE A;  2FKG A;  3VG6 A;  3FEL A;  1FDQ A;  1SLG B;  1SWL A;  1JQP A;  3VPJ E;  1ADL A;  4KCA A;  2N93 A;  2EXK A;  3R4Y A;  1PTS A;  2Q39 A;  3SOT A;  1GX9 A;  1T68 X;  5H9A A;  2KT4 B;  2BHV A;  3CWK A;  2ZAG A;  2HMB A;  1CJ5 A;  1KL3 A;  4YMY A;  3MM0 A;  5D47 A;  3FA6 A;  4NLI A;  2M4L A;  3WJD A;  2RTN B;  1LPJ A;  1YRZ A;  3LIG A;  2EXJ A;  1MDC A;  3I0A A;  4BCS A;  4TKH A;  4O3W A;  1ZNG A;  5IO7 A;  4Y0P A;  3CBS A;  3RDO A;  3WJB A;  2X55 A;  1U0X A;  3VSZ A;  1QY0 A;  4NP1 A;  2WQ9 A;  1UYO X;  1VWA B;  1YWC A;  4KH8 A;  3ZQ3 A;  4CK4 A;  1JMX A;  4QNI A;  1QY2 A;  5D8J A;  5ANN A;  4YCH A;  3AKN A;  1W2T A;  3WAS A;  3ZW0 B;  2RTK A;  4A1Y A;  4ZHC A;  2FKJ A;  4FFI A;  3LDR A;  3WYP A;  1UV4 A;  3RWK X;  3APV A;  4GZV A;  2OFB A;  4ZHD A;  5KID A;  1VKD A;  1DZJ A;  3EW2 A;  1PT2 A;  3T1D A;  3S26 A;  1FE3 A;  5AYD A;  5FMD A;  4YGH A;  5GLK A;  4ZGF A;  3FR5 A;  2OY5 O;  3NAD A;  3SAO A;  4QGW A;  4UDK E;  1GGL A;  2KTD A;  3K1U A;  2ACP X;  2IZL B;  1BRQ A;  5GLN A;  4FBR A;  5JOZ A;  1PMP A;  2OY7 A;  2AMM X;  1DV9 A;  3NQH A;  3C7E A;  3QQ2 A;  4IB7 A;  3Q34 A;  3ZW0 A;  5GLR A;  4AZM A;  3CKG A;  5D45 A;  1VPR A;  1HY2 A;  5IO6 A;  4LZU A;  1RBP A;  1TOW A;  3RY1 A;  2WSJ A;  2A3F X;  1LIB A;  3ZWE A;  3STM X;  4Y0R A;  4JGL A;  3ZXL A;  4U8U M;  4BX6 B;  1A57 A;  2LB6 A;  1RXH A;  4DNE A;  1CRB A;  3QKG A;  3UGF A;  5FKB A;  1XCA A;  1JZU A;  2KTS A;  2X8T A;  3WPV A;  1SWD A;  1NQM A;  2F01 A;  2NND A;  3RSW A;  5L8I A;  4O4X A;  2MHD A;  3FDC A;  3P6H A;  2AT0 X;  2Q4N A;  1N0S A;  4Z2V A;  3EC5 A;  4I3C A;  4XMG A;  1KZW A;  3VG3 A;  2OZQ A;  5F6B A;  1ALB A;  3EMM A;  4ORY A;  2QQU A;  3LIH A;  4A8Z A;  1HMS A;  3D5Y A;  1ZNL A;  3KST A;  3VT2 A;  2ASN X;  5LJE A;  5B5F A;  4MIS A;  3VHH A;  5FQ8 E;  3ZI8 A;  3IFB A;  1IW2 A;  1K24 A;  3X00 A;  4L3R A;  4Y5D A;  4BX6 A;  3AKI A;  1VWP B;  4NLJ A;  5L3Y A;  2FHN X;  3IA8 A;  2QOM A;  1W6F A;  1SY1 A;  3WPZ A;  3RDX A;  1X89 A;  3RZY A;  1LNM A;  3F8A A;  3WYQ A;  3BYN A;  4TQ2 A;  5FK7 A;  2JOZ A;  2FS6 A;  2OFM X;  1SWE A;  2A5B A;  5A8C A;  3BYL A;  3RKG A;  1NP1 A;  4O3Y A;  1YWD A;  5LJK A;  2B4W A;  1EW3 A;  2MO5 A;  4EXZ A;  1VWH B;  4KMI A;  1AEL A;  4KII A;  1VWC B;  2IZE B;  1I78 A;  4AZN A;  3HWG A;  1SRF A;  2WWP A;  1BWY A;  1E06 A;  1HXL A;  1Y9M A;  4DQ3 A;  1OYG A;  4O4O A;  2BT9 A;  2HZQ A;  2AT8 X;  3B2J A;  4AK6 A;  4MVE A;  2AC1 A;  3U03 A;  4ORU A;  5HBS A;  4NV7 A;  4AYH A;  1GKA B;  2IZI A;  3KZA A;  3WAU A;  2AVI A;  2G5L A;  3ZW2 A;  1KL4 A;  3PDF A;  2IZA A;  3F9D A;  1Y4W A;  1EXS A;  4U8U N;  1QFV A;  4LKT A;  4AZQ A;  2IZK A;  2AT6 X;  4IRW A;  2FWV A;  4LKP A;  4YFP A;  3MVF A;  4O4S A;  3HOL A;  1B8E A;  2Q2P A;  3P6E A;  5C0N A;  4OEL A;  4QGV A;  1SXY A;  2FGS A;  5B11 O;  2OF9 A;  2BLG A;  4IMO A;  3FW4 A;  3VHI A;  1KFF A;  2RTM A;  1KXO A;  1GKA A;  4KC7 A;  3VGW A;  4U8U O;  1QAB E;  3UGG A;  4FFG A;  1ZNE A;  5IRU A;  2QCB A;  1YP7 A;  4CDD A;  2JW1 A;  2FS7 A;  2QM9 A;  3K3L A;  3VE2 A;  1NQN A;  5IRA A;  3WJG A;  4IBA A;  3T6L A;  2IZB A;  1TOU A;  2ANS A;  2HNX A;  4BOE A;  2BS6 A;  1G74 A;  4NV8 A;  1SXU A;  2W2A A;  3R4Z A;  2RTD B;  3BY0 A;  1IFC A;  4N1I A;  2LKK A;  4QYN A;  1PEE A;  2FLJ A;  1SWQ A;  3SC7 X;  3B2I A;  2FR3 A;  2QOS C;  2RTP B;  3FW5 A;  2WEW A;  1LKE A;  4ORX A;  2OL6 O;  1W5R A;  3RE6 A;  3P2N A;  3HWE A;  3HPE A;  4EEJ A;  3WN2 A;  3C76 X;  3QED A;  2BC3 A;  2OVA A;  4ZGU A;  1JJX A;  2KD2 A;  4GGT A;  1SLF B;  2IZH B;  3OM6 A;  3LDK A;  2AKQ A;  4COT A;  3VHM A;  1BJ7 A;  5LKE A;  4HWM A;  4TNN A;  1NP4 A;  1DFV A;  4DQ4 A;  2C1S A;  4PVA A;  1T8V A;  3OM4 A;  4ML7 B;  3V8U A;  5HCE C;  1JYJ A;  2O62 A;  3BU9 A;  1DZP A;  1DZK A;  2QO4 A;  2QMI A;  4MVL A;  1XKI A;  2W2F A;  3B2H A;  3DTQ A;  1YIF A;  3U9P C;  3D5Z A;  1VWL B;  1MK5 A;  4GKC A;  3FEN A;  1WBI A;  1LDQ A;  3B2K A;  4CPE A;  1SWC A;  2G7B A;  4MLG A;  4O8N A;  1SY3 A;  4UDJ A;  2YMS A;  3DSZ A;  4Z2P A;  2RTJ A;  5F58 A;  5GLM A;  2CBS A;  4FFF A;  2CZT A;  2LBA A;  3I17 A;  4GE1 A;  5H9L A;  3CU9 A;  1UZ2 X;  3WZP A;  2ADE A;  5D48 A;  2Q2M A;  3BLG A;  2AH7 X;  4KC8 A;  5JR8 A;  4UU3 A;  1OEJ A;  3O2Y A;  1UYN X;  3WJC A;  2ADD A;  1R0U A;  4ORR A;  2P8G A;  1QFT A;  3WZN A;  1GT5 A;  5L8O A;  2EU7 X;  1X71 A;  1O8V A;  4HPA A;  2QO5 A;  3WMY A;  2RTE B;  1SWU A;  1EPB A;  5CYB A;  1AVG I;  3C77 X;  2AT5 X;  1VWG B;  1KT5 A;  3QC2 A;  4ARH A;  3TAW A;  1WL7 A;  4O8O A;  2R74 A;  3LV4 A;  1TXL A;  4YH0 A;  4JNJ A;  1VWN B;  5B5G A;  1FJ1 E;  3EBW A;  3TGA A;  2WQA E;  1KQX A;  2G79 A;  2RQ0 A;  3UGH A;  1EII A;  4ALB A;  5AQ6 A;  4AK7 A;  2HLV A;  1HBP A;  1VWO B;  4HFO A;  1H91 A;  2Z4H A;  3WVM A;  4CDC A;  4GDZ A;  1BSQ A;  3VSR A;  3WJF A;  4NNT A;  1YP6 A;  3G7X A;  1VYG A;  1Y9G A;  2IZC B;  1GX3 A;  4AZP A;  3BS2 A;  2RN4 A;  3VG2 A;  3GE2 A;  3ZUI A;  3ELZ A;  2OFR X;  3RDU A;  1LCV A;  2MF6 A;  2JU3 A;  1FEN A;  5A7V A;  1IJ8 A;  1KT3 A;  3WN0 A;  4ZFX A;  2Q9S A;  2AF5 A;  3LFI A;  4GH7 A;  1IKE A;  1GYE B;  3GAQ A;  1STR B;  4UDG A;  3FA9 A;  1OBQ A;  4GJV A;  3PQS A;  2XST A;  4ODD A;  3OM2 A;  1HMR A;  5K67 A;  5FKC A;  4MIR A;  3D95 A;  2VDT A;  3NBX X;  2WEX A;  1AB0 A;  2MWH A;  4BVM A;  1FTP A;  2AEY A;  2DJG A;  2FHL A;  2E4J A;  5HWZ A;  1LEL A;  5HCC C;  2ZAI A;  4CPH B;  4OS0 A;  1PBY A;  1ML7 A;  1GX8 A;  2VDF A;  4YDB A;  2X34 A;  1GM6 A;  3U14 A;  3FR2 A;  1IIU A;  2C1Q A;  1OBP A;  2KW1 A;  3TGB A;  1BLR A;  2QO6 A;  3H3I A;  1MUP A;  2IZF B;  4IAW A;  2VFC A;  1VWQ B;  4ZHF A;  5IO5 A;  4OKA A;  2OVD A;  3TZS A;  2YFT A;  3SZI A;  5EDC A;  4GUZ A;  5HZ8 A;  1DF8 A;  1QQS A;  1GT4 A;  1SY0 A;  3KFI A;  2NNQ A;  3MG5 A;  3PH6 A;  5AYE A;  3HK1 A;  1IKJ A;  5DG4 A;  4CPH A;  3FEK A;  4M7M A;  3ELX A;  5HZ5 A;  3FMZ A;  2QQW A;  4GJS A;  4AZO A;  4UU2 A;  4D6A A;  4MEE A;  3T6F A;  1ICN A;  3PQU A;  3APX A;  1SWJ A;  2WUT A;  3JQO A;  2R56 A;  3NQ3 A;  2FT9 A;  3D9W A;  1SWH A;  3CR6 A;  3UEV A;  1SRE A;  1JBH A;  3HTY A;  4QQS A;  3B2L A;  1B0O A;  3WPU A;  4KCB A;  5LKF A;  1S7D A;  4ZHG A;  2FRS A;  2EXI A;  2OL7 A;  2HYS A;  2AL0 X;  5F6Z A;  3P24 A;  2C4I A;  4IB8 A;  5EZ2 A;  1EUO A;  1X8O A;  4U9C A;  4IB9 A;  5AJC A;  5CE4 A;  4OS8 A;  5C2M A;  3FLL A;  3LHN A;  5F7G A;  1I4U A;  5GLQ A;  3D97 A;  3OM5 A;  4WFU A;  5FK8 A;  3S60 A;  2RTG B;  2PY1 A;  4DCB A;  4AK5 A;  4XMD A;  1BBP A;  5H9K A;  1SWR A;  1SLE B;  1EQD A;  1HMT A;  1SLD B;  4I3B A;  3CQR A;  1DZM A;  2IZD B;  4JHQ A;  4GNW A;  4BGF A;  1RXJ A;  1LIC A;  2A5C A;  1KT7 A;  1VWF B;  4GD9 A;  3NQ9 A;  2OYB O;  1HBQ A;  1S2P A;  3STN A;  2Y3F A;  2X8F A;  1RAV A;  2YG2 A;  2XQR A;  4YCE A;  2PI3 O;  3WN1 A;  5HTE A;  4FBO A;  1S44 A;  2RCT A;  4XMF A;  5HTD A;  3PEC A;  2RTR B;  2JU7 A;  1SWP A;  1W4T A;  3BSZ E;  3BDR A;  2RTI B;  3RDS A;  1LID A;  4ORW A;  5LJC A;  3QEF A;  4BX5 B;  1YWB A;  4ID2 A;  3WAT A;  2ALL X;  2RTA A;  1MEP A;  3FIQ A;  1SWB A;  3BYK A;  3SZJ A;  3BU1 A;  4QZU A;  3NX2 A;  4N7C A;  1STS B;  3ZUO A;  5L8N A;  5DPQ A;  3ZXJ A;  1KT6 A;  3QEE A;  1SXW A;  1LUQ A;  2A8G A;  4O8P A;  5H8T A;  3C7O A;  3UAQ A;  1NGL A;  3MBT A;  1VWI B;  1MVG A;  2UYW A;  3L4R A;  3O22 A;  3BX7 A;  3C7H A;  2OY1 O;  3D96 A;  4INN A;  2BSZ A;  2FTB A;  4NW4 A;  4U46 A;  2RTH B;  4OMW A;  1GXA A;  3STK A;  2RA6 A;  1E02 A;  1O1U A;  2EXH A;  3E3C A;  4C5P A;  5K06 A;  3OJY C;  1CBR A;  4U6B A;  3AKM A;  2LBV A;  1DF3 A;  4U6D A;  3FA7 A;  1N7Y A;  1RSU B;  1MOY A;  3FEP A;  4BX5 A;  5BVQ A;  4ON1 A;  1SWO A;  4I95 A;  5B10 O;  3OM7 A;  2X32 A;  4B55 A;  4N4B A;  4Z28 A;  1CBS A;  2YFS A;  3AUM O;  1X8Q A;  4I6S A;  5LJB A;  1JJJ A;  1VWR B;  1P6P A;  5FMC A;  3VT0 A;  1CBQ A;  5GLP A;  1SWF A;  4IB6 A;  1CBI A;  3FYF A;  3APU A;  3ZW1 B;  4K19 A;  3FID A;  3FR4 A;  1ACD A;  2A2U A;  5BYP A;  1VWM B;  4YFQ A;  1G85 A;  5IXG A;  4AW8 A;  1DC9 A;  1KT4 A;  4GU8 A;  3VG4 A;  2IZJ A;  4YVB A;  4YKM A;  3WPY A;  2I5V O;  1KL5 A;  2MM3 A;  1ZNK A;  4N7D A;  5FMB A;  5HA1 A;  2L68 A;  2HKD A;  1VWD B;  4O9S A;  5AEO A;  1A18 A;  4OS3 A;  1N4J A;  3HWF A;  3SLO A;  3HWD A;  5FAZ A;  5KHP A;  2Y32 A;  1GT1 A;  5BVS A;  4FBV A;  3NQK A;  4BX7 B;  3ZW1 A;  5CSE A;  2JN3 A;  4LZV A;  3RDQ A;  3RDM A;  1HQQ A;  1UYP A;  2WPU A;  1SXX A;  3QZ4 A;  3PP6 A;  3PH5 A;  2CM4 A;  4CSB A;  5A7V B;  2OFA A;  5HAE A;  4YDA A;  4GNY A;  3AEH A;  3APW A;  2JMB A;  1SRI A;  4IMN A;  4YBU A;  2X56 A;  3S5V A;  4TJZ A;  4ONZ A;  1A3Y A;  4ZJ0 A;  1YI7 A;  5AY9 A;  1OBU A;  5F2B A;  1OSP O;  1I9H A;  3KFG A;  1VWE B;  1BEB A;  4Y0Q A;  3VE1 A;  2LFO A;  3Q6L A;  4BX7 A;  1PM1 X;  1SWT A;  1SWN A;  3PPT A;  4QZT A;  3FA8 A;  2GTF X;  1YUP A;  1A2D A;  3RY2 A;  1ICM A;  1YIV A;  1JYD A;  4GK9 A;  1JMZ A;  5F1E A;  2ACO A;  3R67 A;  4IAB A;  3VU1 A;  1GYH A;  1ZND A;  3UEU A;  2A0A A;  2OXB A;  4D6B A;  3D4R A;  3NPO A;  3BYJ A;  3SLJ A;  1ZRY A;  3RE5 A;  3PIJ A;  2CZU A;  1AVD A;  4BBO A;  4I9S A;  5B6S A;  2CM9 A;  1Y9T A;  1FEM A;  1PBO A;  2QQV A;  3BX8 A;  1SWK A;  1QG5 A;  4GDA A;  4PJ2 A;  5AJB A;  3TGC A;  4Z6J A;  1N9M A;  4ZR2 A;  4QGX A;  2RTC B;  4ORS A;  3OD9 A;  4XMH A;  2IZG B;  1KQW A;  1BRP A;  1JV4 A;  4GET A;  1LIE A;  3C7F A;  4HPC A;  1MX8 A;  4Z2O A;  1T0V A;  1N9Y A;  1W18 A;  3NP1 A;  3NX1 A;  2A13 A;  4NYQ A;  3VSF A;  4CDE A;  5EED A;  3KFH A;  2Y3E A;  2Z4I A;  4CV7 A;  3T2W A;  1FEL A;  4JO6 A;  5K68 A;  2NP1 A;  3D61 A;  4TKB A;  5EPQ A;  4WBK A;  4CDF A;  3U75 A;  4I60 A;  2XKL A;  5A8D A;  4WHI A;  1VWB B;  2X45 A;  3S5X A;  1EI5 A;  4EQA C;  1QWD A;  2R73 A;  2K62 A;  4XME A;  4OMX A;  3AKG A;  1NC9 A;  2OF8 A;  5JOY A;  3ZXK A;  2GTL M;  3T2X A;  4BQU A;  4UDI A;  2G8C O;  4YBP A;  4I3D A;  4ZH9 A;  3EBK A;  4EFG A;  4HPB A;  4ALO A;  4I9R A;  4HPD A;  1ERB A;  1LFO A;  5GLO A;  5FQ6 E;  4NOV A;  1LIF A;  5H9N A;  2DJF A;  5CHK A;  3EM0 A;  2OY8 A;  1ERX A;  3UEW A;  3KF3 A;  1E2T A;  1E5P A;  3EW1 A;  1BSY A;  5FLW A;  5B6T A;  4YKO A;  2W2B A;  3PED A;  5LJG A;  1LF7 A;  1JIW I;  3WOV A;  4N2Z A;  4D47 A;  1VWJ B;  2JGS A;  4GRJ A;  1B4M A;  4OEM A;  2JU8 A;  4NNS A;  4EQV A;  4XMC A;  1ST8 A;  1EIO A;  1Y7B A;  1EAL A;  3TF6 A;  1SY2 A;  3C78 X;  1OEK A;  4A60 A;  3C2U A;  3F6Z B;  3CQN A;  3AKF A;  1K3B A;  1KZX A;  2I5Z O;  2GH7 A;  2L5P A;  5FEN A;  2OVS A;  3CMP A;  3CKF A;  4EKV A;  4O49 A;  5HZ9 A;  3C7G A;  5FQ7 E;  3VG7 A;  1OPB A;  3RWX A;  4YFR A;  4ZH6 A;  4ES7 A;  2YFR A;  2RTO B;  2FR2 A;  2RTL A;  4FQB B;  1O1V A;  1KGL A;  3KFF A;  1NBX A;  1OEE A;  1LCW A;  3KQ0 A;  1L6M A;  1WUB A;  1LDO A;  3KVN A;  5LJD A;  1SWG A;  2MJI A;  5JD2 A;  2AEZ A;  4MVI A;  2L67 A;  2X46 A;  5HA0 A;  4BJ8 A;  3P6F A;  1RXK A;  3P02 A;  5JOX A;  2POA A;  1VYO A;  1TVQ A;  3JS1 A;  1E00 A;  3LTW A; 
#chains in the Genus database with same CATH homology
 4IB6 A;  4U3Q A;  3VG5 A;  1YP6 A;  3G7X A;  1CBI A;  3LIH A;  4N2R A;  4A8Z A;  1HMS A;  3EYC A;  5FIX A;  3D5Y A;  4PVI A;  1RLB E;  1ZNL A;  3FYF A;  1VYG A;  3P6D A;  2GTL N;  3KST A;  2ASN X;  5LJE A;  2F73 A;  1HQP A;  3APU A;  1Y9G A;  3VT2 A;  4FFH A;  3NR3 A;  3ZW1 B;  4K19 A;  2GC9 A;  4MIS A;  2K23 A;  4AZP A;  1IFB A;  3O19 A;  5FQ8 E;  3HOE A;  3BS2 A;  2RN4 A;  3ZI8 A;  3IFB A;  3CBC A;  1IW2 A;  1D3S A;  1X8N A;  4L3R A;  3FR4 A;  3VG2 A;  3PIG A;  1ACD A;  3GE2 A;  3ZUI A;  2A2U A;  3ELZ A;  4ZHH A;  5BYP A;  3AKI A;  2OFR X;  2L9C A;  4NLJ A;  4YFQ A;  1G85 A;  1G5W A;  3UEX A;  4AW8 A;  2JU3 A;  3OE3 A;  1FEN A;  3IA8 A;  4PSQ A;  5A7V A;  1DC9 A;  1KT3 A;  1KT4 A;  3WN0 A;  4ZFX A;  4GU8 A;  3VG4 A;  3BRN A;  1SY1 A;  3WPZ A;  1X8U A;  2HZR A;  2Q9S A;  1W18 A;  1X89 A;  1SMP I;  4L1N A;  3JSQ A;  3LFI A;  4GH7 A;  3RZY A;  1B56 A;  1X8P A;  4YKM A;  5HZQ A;  1LNM A;  3F8A A;  1GT3 A;  1IKE A;  5C0P A;  3LF7 A;  3WPY A;  2AT3 X;  3BYN A;  4TQ2 A;  5LJH A;  5FK7 A;  2JOZ A;  4RUU A;  1GYE B;  3GAQ A;  2FS6 A;  4UDG A;  2OFM X;  2MM3 A;  3OBL A;  3FA9 A;  1G7N A;  5A8C A;  3BYL A;  1OBQ A;  1GYD B;  1ZNK A;  4N7D A;  3RKG A;  1NP1 A;  4O3Y A;  1HN2 A;  1MX7 A;  1Z24 A;  3PQS A;  3RBY A;  5HA1 A;  5FMB A;  1YWD A;  1SA8 A;  2L68 A;  2XST A;  4ODD A;  4YGG A;  1I04 A;  5LJK A;  2B4W A;  1EW3 A;  3OM2 A;  2MO5 A;  4EXZ A;  1HMR A;  2GTL O;  3WMZ A;  5FKC A;  4MIR A;  4O9S A;  1I05 A;  1YWA A;  1QY1 A;  3D95 A;  5AEO A;  1A18 A;  4KMI A;  2VDT A;  4NYR A;  3NBX X;  4OS3 A;  4TKJ A;  1AEL A;  4KII A;  2WEX A;  3HWF A;  3AKH A;  3HWD A;  1AB0 A;  2X8S A;  5FAZ A;  3WXQ A;  5KHP A;  5KIC A;  2OVE A;  4AZN A;  3VSS A;  3HWG A;  2MWH A;  3U0D A;  4BVM A;  1GT1 A;  2WWP A;  5BVS A;  4FBV A;  3NQK A;  1BWY A;  5HZ6 A;  1E06 A;  1FTP A;  4M6S A;  1Y9M A;  3ZW1 A;  4DQ3 A;  2JN3 A;  4O4O A;  1OYG A;  2AEY A;  1URE A;  4LZV A;  2BT9 A;  4EDE A;  4FGI B;  4QRL A;  3WJE A;  5GLL A;  1EPA A;  3N91 A;  4RUN A;  1UYP A;  2HZQ A;  2AT8 X;  2CBR A;  1SXX A;  3B2J A;  3QZ4 A;  2E4J A;  3PP6 A;  3PH5 A;  4AK6 A;  4LQZ A;  5HWZ A;  4MVE A;  2F09 A;  1BM5 A;  1U18 A;  4A1H A;  2CM4 A;  2AC1 A;  5HCC C;  3U03 A;  4CSB A;  3KF5 A;  5A7V B;  4ORU A;  4QYP A;  2ZAI A;  5HBS A;  4OS0 A;  5HAE A;  4YDA A;  1KOI A;  2GJ5 A;  1GKA B;  3MX7 A;  4GNY A;  4Y0S A;  4QQ1 A;  4AYH A;  2IFB A;  1ML7 A;  1GX8 A;  3APW A;  3KZA A;  3WBG A;  3WAU A;  4YDB A;  2JMB A;  4TLJ A;  3ZW2 A;  1GM6 A;  3U14 A;  3FR2 A;  1IIU A;  2DM5 A;  1ZNH A;  4IMN A;  4YBU A;  3S5V A;  2RD7 C;  4TJZ A;  5D4A A;  5JOW A;  4ONZ A;  1A3Y A;  1AQB A;  4ZCB A;  1OBP A;  2KW1 A;  2LA7 A;  1Y9L A;  1OPA A;  3F9D A;  4ZJ0 A;  1EXS A;  4U8U N;  1Y4W A;  3TGB A;  1D2U A;  1BLR A;  2G78 A;  2QO6 A;  3D60 A;  3H3I A;  1YI7 A;  1MUP A;  1QFV A;  4O4U A;  1VYF A;  4LKT A;  5AY9 A;  1OBU A;  4AZQ A;  2AT6 X;  4IAW A;  1U17 A;  3KFG A;  2FWV A;  4O3X B;  4LKP A;  4YFP A;  4ZHF A;  3VT1 A;  3MVF A;  5IO5 A;  4O4S A;  2WR6 A;  1BEB A;  1TW4 A;  3HOL A;  4Y0Q A;  3VE1 A;  2LFO A;  1B8E A;  4UDK A;  2Q2P A;  2OVD A;  3Q6L A;  3TZS A;  5AYC A;  2YFT A;  1PM1 X;  3P6C A;  3PPT A;  5EDC A;  4WFV A;  4QZT A;  3FA8 A;  2GTF X;  5HZ8 A;  3P6E A;  5C0N A;  1QQS A;  1YUP A;  1A2D A;  1ICM A;  4O3Z A;  1YIV A;  1JYD A;  4GK9 A;  4QGV A;  1GT4 A;  1SXY A;  5F1E A;  5B27 A;  2ACO A;  3LEM A;  4IAB A;  3VU1 A;  1GYH A;  1ZND A;  1SY0 A;  3R67 A;  3UEU A;  2A0A A;  2OXB A;  4D6B A;  3KFI A;  3D4R A;  3NPO A;  2NNQ A;  3BYJ A;  3PH6 A;  4MVK A;  5BVT A;  5AYE A;  1ZRY A;  2BLG A;  3HK1 A;  1IKJ A;  4IMO A;  4AZR A;  3FW4 A;  3PIJ A;  2CZU A;  2A2G A;  3FEK A;  4M7M A;  5DG4 A;  1KXO A;  1GKA A;  3ELX A;  5HZ5 A;  1I06 A;  3FMZ A;  4KT5 A;  4KC7 A;  4I9S A;  5HCD C;  2CM9 A;  2QQW A;  5B6S A;  4AZO A;  1Y9T A;  4UU2 A;  1FEM A;  4U8U O;  2NNE A;  4D6A A;  1QAB E;  4YGZ A;  1PBO A;  2QQV A;  1ICN A;  3BX8 A;  3PQU A;  3UGG A;  1QG5 A;  3P6G A;  4FFG A;  3APX A;  1ZNE A;  2WUT A;  3JQO A;  1YP7 A;  2R56 A;  4PJ2 A;  2BS5 A;  2JW1 A;  5AJB A;  3NQ3 A;  3TGC A;  5FFH A;  2FT9 A;  2FS7 A;  2RCQ A;  5B29 A;  2QM9 A;  4ZR2 A;  4QGX A;  5EDB A;  3CR6 A;  3UEV A;  3K3L A;  1JBH A;  5EEE A;  3VE2 A;  4IAX A;  4ORS A;  3OD9 A;  3WJG A;  4IBA A;  3HTY A;  4XMH A;  4QQS A;  1TOU A;  2ANS A;  3B2L A;  1BSO A;  3ZZV A;  1B0O A;  3WPU A;  2HNX A;  4BOE A;  2BS6 A;  1G74 A;  4QAE A;  4R0B A;  5JR8 A;  5LKF A;  4KCB A;  1S7D A;  1KQW A;  4ZHG A;  1BRP A;  1JV4 A;  2FRS A;  3VG6 A;  3FEL A;  2EXI A;  2HYS A;  1SXU A;  1FDQ A;  2AL0 X;  2W2A A;  4GET A;  1LIE A;  5F6Z A;  3C7F A;  3P24 A;  3VPJ E;  3R4Z A;  1ADL A;  4IB8 A;  4KCA A;  4HPC A;  2N93 A;  1MX8 A;  5EZ2 A;  2EXK A;  3BY0 A;  3R4Y A;  1IFC A;  2Q39 A;  4N1I A;  1T0V A;  1EUO A;  2LKK A;  1X8O A;  4QYN A;  1PEE A;  2FLJ A;  4U9C A;  3NP1 A;  4IB9 A;  3NX1 A;  5AJC A;  3SOT A;  5CE4 A;  1GX9 A;  2A13 A;  4NYQ A;  4OS8 A;  3VSF A;  3SC7 X;  3FLL A;  3LHN A;  5EED A;  5F7G A;  3B2I A;  1I4U A;  1T68 X;  2FR3 A;  2QOS C;  5H9A A;  2KT4 B;  5GLQ A;  3D97 A;  2BHV A;  3KFH A;  2Z4I A;  4CV7 A;  3OM5 A;  4WFU A;  3CWK A;  5FK8 A;  2ZAG A;  3FW5 A;  2WEW A;  3S60 A;  1FEL A;  1LKE A;  2HMB A;  4ORX A;  1CJ5 A;  2PY1 A;  3WJF A;  2NP1 A;  5D47 A;  4YMY A;  3D61 A;  4TKB A;  3FA6 A;  4NLI A;  2M4L A;  4WBK A;  5EPQ A;  3WJD A;  3P2N A;  3HWE A;  4AK5 A;  4XMD A;  1LPJ A;  1YRZ A;  3U75 A;  1BBP A;  4EEJ A;  3LIG A;  2XKL A;  2EXJ A;  5A8D A;  3WN2 A;  3C76 X;  1MDC A;  3I0A A;  4WHI A;  2X45 A;  3QED A;  4TKH A;  2OVA A;  3S5X A;  1EI5 A;  4EQA C;  5H9K A;  4ZGU A;  4O3W A;  1JJX A;  1QWD A;  1ZNG A;  2R73 A;  2KD2 A;  5IO7 A;  4Y0P A;  2K62 A;  1EQD A;  4XME A;  1HMT A;  3CBS A;  4OMX A;  3AKG A;  3WJB A;  4I3B A;  3LDK A;  3OM6 A;  2AKQ A;  1U0X A;  3VSZ A;  3CQR A;  4COT A;  1DZM A;  1QY0 A;  5JOY A;  3ZXK A;  1BJ7 A;  2GTL M;  4NP1 A;  2WQ9 A;  5LKE A;  4BQU A;  4HWM A;  4UDI A;  4TNN A;  4YBP A;  4I3D A;  1NP4 A;  1YWC A;  4KH8 A;  4ZH9 A;  3ZQ3 A;  4CK4 A;  3EBK A;  4QNI A;  1QY2 A;  5D8J A;  4EFG A;  1DFV A;  4HPB A;  4ALO A;  5ANN A;  4DQ4 A;  4GNW A;  4I9R A;  4HPD A;  4YCH A;  3AKN A;  1ERB A;  4PVA A;  1W2T A;  1LFO A;  1LIC A;  1T8V A;  5FQ6 E;  3OM4 A;  4ML7 B;  3V8U A;  5GLO A;  3WAS A;  3ZW0 B;  5HCE C;  1JYJ A;  4NOV A;  1KT7 A;  4A1Y A;  1LIF A;  2O62 A;  5H9N A;  3NQ9 A;  3BU9 A;  4ZHC A;  1DZP A;  1DZK A;  2QO4 A;  4FFI A;  2QMI A;  3LDR A;  4MVL A;  3EM0 A;  1HBQ A;  1XKI A;  1UV4 A;  3RWK X;  1S2P A;  2W2F A;  3APV A;  4GZV A;  3STN A;  1ERX A;  3UEW A;  2X8F A;  2YG2 A;  3B2H A;  2XQR A;  4YCE A;  3KF3 A;  3DTQ A;  1E5P A;  4ZHD A;  5KID A;  1YIF A;  3U9P C;  3D5Z A;  1BSY A;  1VKD A;  3WN1 A;  5HTE A;  4FBO A;  1DZJ A;  1S44 A;  1PT2 A;  4GKC A;  3T1D A;  3FEN A;  2RCT A;  4XMF A;  5FLW A;  5HTD A;  5B6T A;  3PEC A;  2W2B A;  3PED A;  4YKO A;  5LJG A;  3S26 A;  1LF7 A;  3B2K A;  1FE3 A;  1JIW I;  2JU7 A;  5AYD A;  3WOV A;  2G7B A;  4MLG A;  4O8N A;  3BSZ E;  4N2Z A;  3BDR A;  1SY3 A;  4UDJ A;  4D47 A;  2YMS A;  5FMD A;  4YGH A;  5GLK A;  3DSZ A;  4GRJ A;  4ZGF A;  1B4M A;  3FR5 A;  3NAD A;  1LID A;  5F58 A;  3SAO A;  4ORW A;  5LJC A;  3QEF A;  2CBS A;  5GLM A;  4QGW A;  4FFF A;  1YWB A;  4ID2 A;  4UDK E;  2CZT A;  3WAT A;  3QEE A;  2LBA A;  3I17 A;  2ALL X;  1GGL A;  4GE1 A;  2KTD A;  5H9L A;  3CU9 A;  3FIQ A;  3K1U A;  2ACP X;  2JU8 A;  4NNS A;  3BYK A;  1UZ2 X;  4EQV A;  1BRQ A;  3BU1 A;  5GLN A;  4FBR A;  4XMC A;  4QZU A;  1ST8 A;  3NX2 A;  4N7C A;  1EIO A;  1Y7B A;  3ZUO A;  2ADE A;  5JOZ A;  1PMP A;  5D48 A;  5L8N A;  1EAL A;  2AMM X;  1DV9 A;  2Q2M A;  3NQH A;  3BLG A;  3TF6 A;  3C7E A;  5DPQ A;  3ZXJ A;  2AH7 X;  1SY2 A;  1KT6 A;  3C78 X;  1OEJ A;  1OEK A;  3O2Y A;  4IB7 A;  4KC8 A;  4UU3 A;  3ZW0 A;  4A60 A;  3C2U A;  3F6Z B;  5GLR A;  1SXW A;  3WJC A;  3CQN A;  4AZM A;  2ADD A;  3AKF A;  4O8P A;  5D45 A;  5H8T A;  3C7O A;  1VPR A;  1R0U A;  1NGL A;  3UAQ A;  3MBT A;  4ORR A;  2P8G A;  5IO6 A;  1KZX A;  4LZU A;  1MVG A;  1RBP A;  3L4R A;  3O22 A;  2L5P A;  3BX7 A;  5FEN A;  1QFT A;  3C7H A;  2OVS A;  1GT5 A;  3CMP A;  5L8O A;  2EU7 X;  3D96 A;  1TOW A;  1X71 A;  4INN A;  1O8V A;  4HPA A;  2WSJ A;  4O49 A;  2A3F X;  2FTB A;  1LIB A;  2QO5 A;  4NW4 A;  3STK A;  4OMW A;  1GXA A;  3ZWE A;  3WMY A;  5HZ9 A;  2RA6 A;  1E02 A;  1O1U A;  5FQ7 E;  3STM X;  3C7G A;  4Y0R A;  1EPB A;  5CYB A;  3E3C A;  5K06 A;  4JGL A;  3VG7 A;  2EXH A;  3ZXL A;  1OPB A;  1AVG I;  3C77 X;  1CBR A;  3OJY C;  3AKM A;  4U8U M;  2AT5 X;  3RWX A;  1A57 A;  4U6B A;  4YFR A;  2LB6 A;  4ZH6 A;  4ES7 A;  2LBV A;  1DF3 A;  4U6D A;  1KT5 A;  3FA7 A;  2YFR A;  1CRB A;  3QKG A;  3UGF A;  3QC2 A;  4ARH A;  2FR2 A;  5FKB A;  1WL7 A;  1XCA A;  3FEP A;  1JZU A;  3TAW A;  4FQB B;  2KTS A;  1O1V A;  1KGL A;  3KFF A;  2X8T A;  4O8O A;  5BVQ A;  4ON1 A;  2R74 A;  3LV4 A;  3WPV A;  4I95 A;  1OEE A;  1TXL A;  2NND A;  4YH0 A;  3KQ0 A;  3RSW A;  5L8I A;  1L6M A;  4O4X A;  2MHD A;  3OM7 A;  3P6H A;  2AT0 X;  4N4B A;  5LJD A;  1CBS A;  2Q4N A;  2MJI A;  1N0S A;  3EBW A;  2AEZ A;  3TGA A;  4MVI A;  2WQA E;  2YFS A;  1KQX A;  2L67 A;  2G79 A;  2X46 A;  5HA0 A;  2RQ0 A;  3UGH A;  1EII A;  4ALB A;  1X8Q A;  4I6S A;  5LJB A;  5AQ6 A;  1JJJ A;  4AK7 A;  3P6F A;  4I3C A;  4XMG A;  1P6P A;  2HLV A;  1KZW A;  1HBP A;  4HFO A;  3VG3 A;  1H91 A;  2Z4H A;  3WVM A;  5FMC A;  3VT0 A;  2OZQ A;  4GDZ A;  1CBQ A;  3P02 A;  5F6B A;  5JOX A;  1BSQ A;  2POA A;  5GLP A;  1ALB A;  3EMM A;  1TVQ A;  4ORY A;  3JS1 A;  2QQU A;  1E00 A;  3VSR A;  4NNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...