3VT1A

Crystal structure of ct1,3gal43a in complex with galactose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
461
structure length
461
Chain Sequence
EGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYYYLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLVNKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDESKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSDAGGTNQHWKLVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of 1,3Gal43A, an exo-beta-1,3-galactanase from Clostridium thermocellum
pubmed doi rcsb
molecule keywords Ricin B lectin
molecule tags Sugar binding protein
source organism Clostridium thermocellum
total genus 128
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vt1A02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vt1A01
1JLYA 1W3AA 3OJ2A 5F90A 2LIEA 2YUGA 1TTUA 1UV4A 1AVXB 4JAWA 3PUBA 4A7YA 1V6WA 1XZZA 3C7GA 2VDTA 1XHBA 3FJKA 4N1IA 3O49A 1S0EA 1ONKB 2AAIB 3AKFA 3KMVA 3O4BA 1G82A 5DVHA 1K5UA 1HWMB 5G00A 5B2HA 4J23B 1FWVA 3TAWA 2IWTB 3FJ9A 2LIQA 2DS0A 1BLAA 3O4DA 1PUUB 1WL7A 4I4SA 4NOVA 2F2FC 3WMVA 1UYPA 5BQUA 5C0PA 4G6MA 1Q03A 2E4MA 5BXSA 2D20A 3V0AB 5BXPA 4JPZA 2Q9XA 3OJMA 3CA1A 4I4VA 1HWNB 5BXTA 3LV4A 2NTDA 4H04A 5EC5A 3OM6A 4JQ0A 4A7ZA 2QQVA 3POKA 3C7EA 2D44A 3A21A 4KCBA 1SZ6B 1S0BA 3Q7WA 1W2TA 1IJTA 1BFCA 1IRPA 4FFIA 4GP3A 4P0JA 4P0LA 3RTIB 5FIXA 3UD8A 1Y9GA 3R67A 3FGMA 4ZFWB 3BAOA 4LO2A 4QQSA 2P23A 1BARA 1BFBA 2AFGA 2QN4A 2QYIB 2FFUA 6I1BA 1YI7A 5D62A 2BEBA 4ZFYB 2EXJA 1DZDA 2NM1A 4I96A 5FLWA 3IAGC 1TWMA 3FUOA 4I4YA 2VSAA 2KI6B 1HKNA 4OWLA 3NBDA 1F31A 3CRGA 1II4A 2AEZA 3LDKA 5EG6C 3UGHA 3ZC9A 2EXIA 5FNWA 2K8RA 3V79C 4D0TA 1Y4WA 3HSMA 2NVHA 3CA5A 2FFVA 4EKXB 1Z0HA 3BTAA 5D63A 3CRIA 3LIHA 5DSSB 2M49A 3O4OA 3QYDA 4GAFA 3N0KA 3ZXJA 3V0BA 4I6IA 3WPUA 2VUAA 4X38A 3R4ZA 2NYYA 3VT1A 4UDKE 3WN1A 5E24E 1WD4A 4LO2C 3I2AA 3UD9A 4ONZA 3AKIA 4OEGA 1RZOB 4G6JA 3D60A 3KSTA 1AVUA 1G9AA 3R4UA 5A8DA 1EVTA 3BYKA 3BYNA 3D7WB 3WO2A 3E8LC 5BP5C 4R6UB 5AYCA 5JLVA 5B6SA 4ZLBB 3VEQA 2Z49A 2Y9GA 3B9UA 21BIA 2GO2A 2I1BA 4ZOTA 1WBAA 5BXRA 1Q04A 3OM2A 3VUOA 4PC4A 3CA0A 4QKSA 5I1BA 1IRAX 1S0DA 2RQ9A 4KCAA 4AK7A 4U6DA 1SR4A 3ZXDA 4O8NA 4EFPA 1G9BA 2FGFA 1EV2A 2FDBM 1ITBA 1MC9A 2X8TA 5AY9A 4Q9GA 3O5WB 4IQPA 4DENA 1XYFA 4Z8SB 4GAIA 1G9DA 2Y9FA 1ISXA 3OBRA 1DLLA 3UDAA 4UDIA 1WBCA 2AEYA 3H6RA 4L4HA 3N7LA 2F2FA 3H6SE 4J2YA 4UDGA 1YTOA 2MIBA 3JRRA 1YRZA 1IT0A 3LDRA 2FO1A 3NBCA 3ZXGA 2YFSA 1R8OA 3BAGA 1ILR1 3VSZA 1Y7BA 4N4BA 4P0KA 1SR4C 4F83A 3BA4A 3O4AA 4KC8A 2L5XA 4KEKA 3AJ6A 3PHZA 2ESUA 3A07A 4I8MA 3WO3A 2Y9WC 1ISWA 1S0LA 3WA1A 5F8SA 4USOA 3O44A 4HJJA 1W3GA 2X8FA 1N4KA 5EHAA 3QEEA 1FN0A 4EB2B 1TWEA 1FMZA 1T4QA 2K4AB 4QBVA 2X2SA 4G1RA 3U75A 4QC4A 4J2KA 3BRDA 3LTQA 4ZA3B 4KC7A 2D1ZA 3D5ZA 4N2RA 3O3QA 1DFQA 1HCDA 1EPWA 3F1RA 5FKCA 3AZWA 3WAUA 4KC3A 1RY7A 2ZQNA 3PMEA 4OW4A 3VSSA 3UGGA 2VXRA 3V0BB 4DCKC 3NJ5A 1JT7A 4O8PA 1UPSA 3AKGA 5FK7A 3FJJA 5JOXA 3PIJA 4ZKTB 3BAHA 5GLQA 5A8CA 2IHOA 4P6AA 4D47A 2MLLB 1VKDA 2YFRA 4OWKA 4ISQA 4LO7C 3CAHA 4QD2C 3AH2A 3U14A 3NBEA 2Z48A 2HZ9A 4GP0A 5D61A 4IYBA 4OUJA 1WD3A 5FMDA 3CA4A 5BP5A 4EQVA 1BA7A 4X37A 1Q1UA 1A8DA 4QBCA 3RMXA 2ET2A 1V6UA 5AYDA 1KNMA 4TLPA 4O8OA 4FFHA 2KI4A 2ADEA 2QQWA 3MPPG 1ISVA 3BRFA 5GLNA 2VLCA 3P6JA 1W18A 3ZXLA 3CU9A 2X8SA 1BFGA 1DQOA 3AKHA 1YYNA 3WN2A 4I4RA 3BX1C 3H6RB 4FFGA 4I4PA 3N7MA 4KBBA 3I29B 1NUNA 3HN1A 3OM5A 3CU1B 3PG0A 2ZR1B 4KEIA 2UUSA 3JUTA 1I1BA 4OWJA 3C7HA 3UGFA 1AFCA 2R9KB 3BAUA 1JTCA 2GZBA 3OGGA 2XQRA 1NZKA 1TOOA 1K5VA 4LO1C 1BFFA 3K1XA 1YIFA 3NQHA 5GLMA 2B4WA 3PIGA 3WATA 1TFMB 1YF8B 2D43A 3N7JA 2HW9A 2NZ9A 4JRAA 3CA3A 3OM4A 4YOLA 3MALA 3S8JA 3VSRA 3IM7A 4I0YA 4ISRA 3ZX7A 1JLXA 2KH2A 3LEMA 3FJ8A 1FV2A 1ABRB 3RWKX 2VSEA 3Q7XA 4LO3A 5GLRA 2D7RA 4ZFUB 1OQLB 4HA2A 4IZEA 3OM7A 3UD7A 4Z9WB 1PZZA 2AQZA 5FMBA 3WN0A 3AH1A 3FJFA 3AZVA 5F8YA 2P39A 4A7KA 2ADDA 2YFTA 5FZYA 3ZC8A 1XG6A 3BRGC 4UDKA 1V6VA 5BOWA 4X39A 1VCLA 4LO0C 3TC2A 2KKIA 4EFRA 5JMCA 2DRZA 2ZQOA 3K1UA 4I3NA 1FQ9A 4II0A 9ILBA 4EEEB 2D23A 5JOYA 3BADA 3QZ4A 1IILA 1HWPB 3WO4A 5JOZA 1DQGA 4LO3C 3P53A 1QQKA 3HALA 1OYGA 4AN6A 3FUQA 5HPZA 3CQAA 4G9MA 2J3PA 3C7OA 4OEFA 5A7VA 2Y9XE 2Q3NB 3WINC 5FZUA 4X3AA 3P2NA 3P6IA 1G9CA 3IM5A 4GOVA 4USPA 2MC2A 8I1BA 4I37A 3VSFA 4CJMA 1S0GA 4FGFA 1Z4SA 1BLDA 2EXHA 2X2TA 5B6TA 4MLGA 1RMLA 4QKRA 1M2TB 1HIBA 2QQUA 1L2HA 3S8KA 4XFSA 1J0SA 3N7KA 3ZXKA 3HMYA 5GLOA 5DZUA 4G9NA 2D22A 2EXKA 1QQLA 2WBCA 3AJ5A 4L4IA 5GAQA 4EFQA 2RG9B 3KF5A 1AF9A 1W3FA 4F34A 1ST8A 4IZXA 4HR6C 4Q9PA 5GLKA 4QO3A 1E0OA 2OXBA 3C7FA 1IOBA 4XFUA 3OBTA 1GGPB 1ISYA 4J2SA 3WASA 3ILAA 4IONA 4XFTA 1AXMA 3D61A 1YXWA 3FFZA 4AN7B 4LO1A 4JKQA 5GLLA 1QXMA 3IIRA 4H9WA 3C2UA 3I2XA 3NBNA 3LIGA 1DJSB 3QEDA 2RSTA 5BQUC 3QEFA 31BIA 4AK5A 1PC8B 4U6BA 7I1BA 2BEAA 4JKXB 4OEEA 2E4MC 5F8WA 4J2XA 1Y9MA 5JOWA 3FJAA 3Q7YA 3F62B 4FFFA 3V0AA 2HWAA 2WRYA 5BVPI 3FJHA 4I4XA 3CA6A 4WBCA 1HWOB 3FJCA 5FNXA 3BA5A 1M16A 4UDJA 3BYJA 4IHZA 2KLLA 2DRYA 3BA7A 1Z2VA 1FV3A 1AVWB 1FWUA 3FJIA 4PVAA 4QALA 2DREA 1PUMB 2D24A 3HOMA 1ISZA 4Q91A 3BYLA 4PVIA 1YBIA 4XKIA 3LFIA 3C9ZA 1PWAA 5FK8A 3WPVA 3VT2A 3W9TA 1IHKA 5FZZA 3FJBA 3A23A 41BIA 2AXMA 4I1EA 5FKBA 3BB2A 3A22A 3CRHA 1JQZA 4GOYA 4LO0A 3LLPA 1CVSA 1FGAA 3KF3A 1PT2A 4LO7B 4QD2B 3WMYA 3BAVA 2AC1A 5GLPA 3HBWA 1P63A 3BAQA 4IY9A 4I2SA 3LF7A 4IY8A 3UJ4A 1RG8A 3FJDA 1TP0A 2XOAA 4I4OA 1GYDB 4AK6A 3QC2A 1DIWA 4N2ZA 2VXTI 1FMMS 1TIEA 4D8HA 5A7VB 3SC7X 4I4UA 3EF2A 1CE7B 2F8XC 3WINA 3WPYA 4COTA 3R4SA 1JT3A 4I7IA 1JT4A 1S0CA 1DFCA 1V6XA 3RSJA 3FJEA 1AVAC 1S0FA 2K43A 1D0HA 3SNVA 1MD6A 1GYEB 4ZBVB 2VU9A 4I1BA 1HCEA 2D7IA 4FVVA 5AYEA 3RMYA 5DUYA 3OJVA 4I4QA 3WMUA 3WMZA 2ERMA 1DZCA 3R4YA 3VT0A 3VWCA 4ENDA 2HWMA 4ZGRB 1JY0A 3OGFA 1T9FA 1JT5A 2NP0A 3IM6A 5ANNA 5FMCA 3O4CA 4KEJA 3AH4A 1BASA 4JP0A 3UJ0A 3D5YA 3RTJB 3T8SA 4LO8B 1EYLA 3QR5A 4DEPA 4KMIA 2BFHA 4D0ZA 3WPZA 1R8NA 1GYHA 1I1EA 3H6QA
chains in the Genus database with same CATH superfamily
1JLYA 1W3AA 3OJ2A 5F90A 2LIEA 2YUGA 1TTUA 1UV4A 1AVXB 4JAWA 3PUBA 4A7YA 1V6WA 1XZZA 3C7GA 2VDTA 1XHBA 3FJKA 4N1IA 3O49A 1S0EA 1ONKB 2AAIB 3AKFA 3KMVA 3O4BA 1G82A 5DVHA 1K5UA 1HWMB 5G00A 5B2HA 4J23B 1FWVA 3TAWA 2IWTB 3FJ9A 2LIQA 2DS0A 1BLAA 3O4DA 1PUUB 1WL7A 4I4SA 4NOVA 2F2FC 3WMVA 1UYPA 5BQUA 5C0PA 4G6MA 1Q03A 2E4MA 5BXSA 2D20A 3V0AB 5BXPA 4JPZA 2Q9XA 3OJMA 3CA1A 4I4VA 1HWNB 5BXTA 3LV4A 2NTDA 4H04A 5EC5A 3OM6A 4JQ0A 4A7ZA 2QQVA 3POKA 3C7EA 2D44A 3A21A 4KCBA 1SZ6B 1TL2A 1S0BA 3Q7WA 1W2TA 1IJTA 1BFCA 1IRPA 4FFIA 4GP3A 4P0JA 4P0LA 3RTIB 5FIXA 3UD8A 1Y9GA 3R67A 3FGMA 4ZFWB 3BAOA 4LO2A 4QQSA 2P23A 1BARA 1BFBA 2AFGA 2QN4A 2QYIB 2FFUA 6I1BA 1YI7A 5D62A 2BEBA 4ZFYB 2EXJA 1DZDA 2NM1A 4I96A 5FLWA 3IAGC 1TWMA 3FUOA 4I4YA 2VSAA 2KI6B 1HKNA 4OWLA 3NBDA 1F31A 3CRGA 1II4A 2AEZA 3LDKA 5EG6C 3UGHA 3ZC9A 2EXIA 5FNWA 2K8RA 3V79C 4D0TA 1Y4WA 3HSMA 2NVHA 3CA5A 2FFVA 4EKXB 1Z0HA 3BTAA 5D63A 3CRIA 3LIHA 5DSSB 2M49A 3O4OA 3QYDA 4GAFA 3N0KA 3ZXJA 3V0BA 4I6IA 3WPUA 2VUAA 4X38A 3R4ZA 2NYYA 3VT1A 4UDKE 3WN1A 5E24E 1WD4A 4LO2C 3I2AA 3UD9A 4ONZA 3AKIA 4OEGA 1RZOB 4G6JA 3D60A 3KSTA 1AVUA 1G9AA 3R4UA 5A8DA 1EVTA 3BYKA 3BYNA 3D7WB 3WO2A 3E8LC 5BP5C 4R6UB 5AYCA 5JLVA 5B6SA 4ZLBB 3VEQA 2Z49A 2Y9GA 3B9UA 21BIA 2GO2A 2I1BA 4ZOTA 1WBAA 5BXRA 1Q04A 3OM2A 3VUOA 4PC4A 3CA0A 4QKSA 5I1BA 1IRAX 1S0DA 2RQ9A 4KCAA 4AK7A 4U6DA 1SR4A 3ZXDA 4O8NA 4EFPA 1G9BA 2FGFA 1EV2A 2FDBM 1ITBA 1MC9A 2X8TA 5AY9A 4Q9GA 3O5WB 4IQPA 4DENA 1XYFA 4Z8SB 4GAIA 1G9DA 2Y9FA 1ISXA 3OBRA 1DLLA 3UDAA 4UDIA 1WBCA 2AEYA 3H6RA 4L4HA 3N7LA 2F2FA 3H6SE 4J2YA 4UDGA 1YTOA 2MIBA 3JRRA 1YRZA 1IT0A 3LDRA 2FO1A 4MZHA 3NBCA 3ZXGA 2YFSA 1R8OA 3BAGA 1ILR1 3VSZA 1Y7BA 4N4BA 4P0KA 1SR4C 4F83A 3BA4A 3O4AA 4KC8A 2L5XA 4KEKA 3AJ6A 3PHZA 2ESUA 3A07A 4I8MA 3WO3A 2Y9WC 1ISWA 1S0LA 3WA1A 5F8SA 4USOA 3O44A 4HJJA 2NS2A 1W3GA 2X8FA 1N4KA 5EHAA 3QEEA 1FN0A 4EB2B 1TWEA 1FMZA 1T4QA 2K4AB 4QBVA 2X2SA 4G1RA 3U75A 4QC4A 4J2KA 3BRDA 3LTQA 4ZA3B 4KC7A 2D1ZA 3D5ZA 4N2RA 3O3QA 1DFQA 1HCDA 1EPWA 3F1RA 5FKCA 3AZWA 3WAUA 4KC3A 1RY7A 2ZQNA 3PMEA 4OW4A 3VSSA 3UGGA 2VXRA 3V0BB 4DCKC 3NJ5A 1JT7A 4O8PA 1UPSA 3AKGA 5FK7A 3FJJA 5JOXA 3PIJA 4ZKTB 3BAHA 5GLQA 5A8CA 2IHOA 4P6AA 4D47A 2MLLB 1VKDA 2YFRA 4OWKA 4ISQA 4LO7C 3CAHA 4QD2C 3AH2A 3U14A 3NBEA 2Z48A 2HZ9A 4GP0A 5D61A 4IYBA 4OUJA 1WD3A 5FMDA 3CA4A 5BP5A 4EQVA 1BA7A 4X37A 1Q1UA 1A8DA 4QBCA 3RMXA 2ET2A 1V6UA 5AYDA 1KNMA 4TLPA 4O8OA 4FFHA 2KI4A 2ADEA 2QQWA 3MPPG 1ISVA 3BRFA 5GLNA 2VLCA 3P6JA 1W18A 3ZXLA 3CU9A 2X8SA 1BFGA 1DQOA 3AKHA 1YYNA 3WN2A 4I4RA 3BX1C 3H6RB 4FFGA 4I4PA 3N7MA 4KBBA 3I29B 1NUNA 3HN1A 3OM5A 3CU1B 3PG0A 2ZR1B 4KEIA 2UUSA 3JUTA 1I1BA 4OWJA 3C7HA 3UGFA 1AFCA 2R9KB 3BAUA 1JTCA 2GZBA 3OGGA 2XQRA 1NZKA 1TOOA 1K5VA 4LO1C 1BFFA 3K1XA 1YIFA 3NQHA 5GLMA 2B4WA 3PIGA 3WATA 1TFMB 1YF8B 2D43A 3N7JA 2HW9A 2NZ9A 4JRAA 3CA3A 3OM4A 4YOLA 3MALA 3S8JA 3VSRA 3IM7A 4I0YA 4ISRA 3ZX7A 1JLXA 2KH2A 3LEMA 3FJ8A 1FV2A 1ABRB 3RWKX 2VSEA 3Q7XA 4LO3A 5GLRA 2D7RA 4ZFUB 1OQLB 4HA2A 4IZEA 3OM7A 3UD7A 4Z9WB 1PZZA 2AQZA 5FMBA 3WN0A 3AH1A 3FJFA 3AZVA 5F8YA 2P39A 4A7KA 2ADDA 4UY4A 2YFTA 5FZYA 3ZC8A 1XG6A 3BRGC 4UDKA 1V6VA 5BOWA 4X39A 1VCLA 4LO0C 3TC2A 2KKIA 4EFRA 5JMCA 2DRZA 2ZQOA 3K1UA 4I3NA 1FQ9A 4II0A 9ILBA 4EEEB 4MZGB 2D23A 5JOYA 3BADA 3QZ4A 1IILA 1HWPB 3WO4A 5JOZA 1DQGA 4LO3C 3P53A 1QQKA 3HALA 1OYGA 4AN6A 3FUQA 5HPZA 3CQAA 4G9MA 2J3PA 3C7OA 4OEFA 5A7VA 2Y9XE 2Q3NB 3WINC 5FZUA 4X3AA 3P2NA 3P6IA 1G9CA 3IM5A 4GOVA 4USPA 2MC2A 8I1BA 4I37A 3VSFA 4CJMA 1S0GA 4FGFA 1Z4SA 1BLDA 2EXHA 2X2TA 5B6TA 4MLGA 1RMLA 4QKRA 1M2TB 1HIBA 2QQUA 1L2HA 3S8KA 4XFSA 1J0SA 3N7KA 3ZXKA 3HMYA 5GLOA 5DZUA 4G9NA 2D22A 2EXKA 1QQLA 2WBCA 3AJ5A 4L4IA 5GAQA 4EFQA 2RG9B 3KF5A 1AF9A 1W3FA 4F34A 1ST8A 4IZXA 4HR6C 4Q9PA 5GLKA 4QO3A 1E0OA 2OXBA 3C7FA 1IOBA 4XFUA 3OBTA 1GGPB 1ISYA 4J2SA 3WASA 3ILAA 4IONA 4XFTA 1AXMA 3D61A 1YXWA 3FFZA 4AN7B 4LO1A 4JKQA 5GLLA 1QXMA 3IIRA 4H9WA 3C2UA 3I2XA 3NBNA 3LIGA 1DJSB 3QEDA 2RSTA 5BQUC 3QEFA 31BIA 4AK5A 1PC8B 4U6BA 7I1BA 2BEAA 4JKXB 4OEEA 2E4MC 5F8WA 4J2XA 1Y9MA 5JOWA 3FJAA 3Q7YA 3F62B 4FFFA 3V0AA 2HWAA 2WRYA 5BVPI 3FJHA 4I4XA 3CA6A 4WBCA 1HWOB 3FJCA 5FNXA 3BA5A 1M16A 4UDJA 3BYJA 4IHZA 2KLLA 2DRYA 3BA7A 1Z2VA 1FV3A 1AVWB 1FWUA 3FJIA 4PVAA 4QALA 2DREA 1PUMB 2D24A 3HOMA 1ISZA 4Q91A 3BYLA 4PVIA 1YBIA 4XKIA 3LFIA 3C9ZA 1PWAA 5FK8A 3WPVA 3VT2A 3W9TA 1IHKA 5FZZA 3FJBA 3A23A 41BIA 2AXMA 4I1EA 5FKBA 3BB2A 3A22A 3CRHA 1JQZA 4GOYA 4LO0A 3LLPA 1CVSA 1FGAA 4H75A 3KF3A 1PT2A 4LO7B 4QD2B 3WMYA 3BAVA 2AC1A 4MZFB 5GLPA 3HBWA 1P63A 3BAQA 4IY9A 4I2SA 3LF7A 4IY8A 3UJ4A 1RG8A 5C2MA 3FJDA 1TP0A 2XOAA 4I4OA 1GYDB 4AK6A 3QC2A 1DIWA 4N2ZA 2VXTI 1FMMS 1TIEA 4D8HA 5A7VB 3SC7X 4I4UA 3EF2A 1CE7B 2F8XC 3WINA 3WPYA 4COTA 3R4SA 1JT3A 4I7IA 1JT4A 1S0CA 1DFCA 1V6XA 3RSJA 3FJEA 1AVAC 1S0FA 2K43A 1D0HA 3SNVA 1MD6A 1GYEB 4ZBVB 2VU9A 4I1BA 1HCEA 2D7IA 4FVVA 5AYEA 3RMYA 5DUYA 3OJVA 4I4QA 3WMUA 3WMZA 2ERMA 1DZCA 3R4YA 3VT0A 3VWCA 4ENDA 2HWMA 4ZGRB 1JY0A 3OGFA 1T9FA 1JT5A 2NP0A 3IM6A 5ANNA 5FMCA 3O4CA 4KEJA 3AH4A 1BASA 4JP0A 3UJ0A 3D5YA 3RTJB 3T8SA 4LO8B 1EYLA 3QR5A 4DEPA 4KMIA 2BFHA 4D0ZA 3WPZA 1R8NA 1GYHA 1I1EA 3H6QA
chains in the Genus database with same CATH topology
1JLYA 1W3AA 3OJ2A 5F90A 2LIEA 2YUGA 1TTUA 1UV4A 1AVXB 4JAWA 3PUBA 4A7YA 1V6WA 1XZZA 3C7GA 2VDTA 1XHBA 3FJKA 4N1IA 3O49A 1S0EA 1ONKB 2AAIB 3AKFA 3KMVA 3O4BA 1G82A 5DVHA 1K5UA 1HWMB 5G00A 5B2HA 4J23B 1FWVA 3TAWA 2IWTB 3FJ9A 2LIQA 2DS0A 1BLAA 3O4DA 1PUUB 1WL7A 4I4SA 4NOVA 2F2FC 3WMVA 1UYPA 5BQUA 5C0PA 4G6MA 1Q03A 2E4MA 5BXSA 2D20A 3V0AB 5BXPA 4JPZA 2Q9XA 3OJMA 3CA1A 4I4VA 1HWNB 5BXTA 3LV4A 2NTDA 4H04A 5EC5A 3OM6A 4JQ0A 4A7ZA 2QQVA 3POKA 3C7EA 2D44A 3A21A 4KCBA 1SZ6B 1S0BA 3Q7WA 1W2TA 1IJTA 1BFCA 1IRPA 4FFIA 4GP3A 4P0JA 4P0LA 3RTIB 5FIXA 3UD8A 1Y9GA 3R67A 3FGMA 4ZFWB 3BAOA 4LO2A 4QQSA 2P23A 1BARA 1BFBA 2AFGA 2QN4A 2QYIB 2FFUA 6I1BA 1YI7A 5D62A 2BEBA 4ZFYB 2EXJA 1DZDA 2NM1A 4I96A 5FLWA 3IAGC 1TWMA 3FUOA 4I4YA 2VSAA 2KI6B 1HKNA 4OWLA 3NBDA 1F31A 3CRGA 1II4A 2AEZA 3LDKA 5EG6C 3UGHA 3ZC9A 2EXIA 5FNWA 2K8RA 3V79C 4D0TA 1Y4WA 3HSMA 2NVHA 3CA5A 2FFVA 4EKXB 1Z0HA 3BTAA 5D63A 3CRIA 3LIHA 5DSSB 2M49A 3O4OA 3QYDA 4GAFA 3N0KA 3ZXJA 3V0BA 4I6IA 3WPUA 2VUAA 4X38A 3R4ZA 2NYYA 3VT1A 4UDKE 3WN1A 5E24E 1WD4A 4LO2C 3I2AA 3UD9A 4ONZA 3AKIA 4OEGA 1RZOB 4G6JA 3D60A 3KSTA 1AVUA 1G9AA 3R4UA 5A8DA 1EVTA 3BYKA 3BYNA 3D7WB 3WO2A 3E8LC 5BP5C 4R6UB 5AYCA 5JLVA 5B6SA 4ZLBB 3VEQA 2Z49A 2Y9GA 3B9UA 21BIA 2GO2A 2I1BA 4ZOTA 1WBAA 5BXRA 1Q04A 3OM2A 3VUOA 4PC4A 3CA0A 4QKSA 5I1BA 1IRAX 1S0DA 2RQ9A 4KCAA 4AK7A 4U6DA 1SR4A 3ZXDA 4O8NA 4EFPA 1G9BA 2FGFA 1EV2A 2FDBM 1ITBA 1MC9A 2X8TA 5AY9A 4Q9GA 3O5WB 4IQPA 4DENA 1XYFA 4Z8SB 4GAIA 1G9DA 2Y9FA 1ISXA 3OBRA 1DLLA 3UDAA 4UDIA 1WBCA 2AEYA 3H6RA 4L4HA 3N7LA 2F2FA 3H6SE 4J2YA 4UDGA 1YTOA 2MIBA 3JRRA 1YRZA 1IT0A 3LDRA 2FO1A 4MZHA 3NBCA 3ZXGA 2YFSA 1R8OA 3BAGA 1ILR1 3VSZA 1Y7BA 4N4BA 4P0KA 1SR4C 4F83A 3BA4A 3O4AA 4KC8A 2L5XA 4KEKA 3AJ6A 3PHZA 2ESUA 3A07A 4I8MA 3WO3A 2Y9WC 1ISWA 1S0LA 3WA1A 5F8SA 4USOA 3O44A 4HJJA 2NS2A 1W3GA 2X8FA 1N4KA 5EHAA 3QEEA 1FN0A 4EB2B 1TWEA 1FMZA 1T4QA 2K4AB 4QBVA 2X2SA 4G1RA 3U75A 4QC4A 4J2KA 3BRDA 3LTQA 4ZA3B 4KC7A 2D1ZA 3D5ZA 4N2RA 3O3QA 1DFQA 1HCDA 1EPWA 3F1RA 5FKCA 3AZWA 3WAUA 4KC3A 1RY7A 2ZQNA 3PMEA 4OW4A 3VSSA 3UGGA 2VXRA 3V0BB 4DCKC 3NJ5A 1JT7A 4O8PA 1UPSA 3AKGA 5FK7A 3FJJA 5JOXA 3PIJA 4ZKTB 3BAHA 5GLQA 5A8CA 2IHOA 4P6AA 4D47A 2MLLB 1VKDA 2YFRA 4OWKA 4ISQA 4LO7C 3CAHA 4QD2C 3AH2A 3U14A 3NBEA 2Z48A 2HZ9A 4GP0A 5D61A 4IYBA 4OUJA 1WD3A 5FMDA 3CA4A 5BP5A 4EQVA 1BA7A 4X37A 1Q1UA 1A8DA 4QBCA 3RMXA 2ET2A 1V6UA 5AYDA 1KNMA 4TLPA 4O8OA 4FFHA 2KI4A 2ADEA 2QQWA 3MPPG 1ISVA 3BRFA 5GLNA 2VLCA 3P6JA 1W18A 3ZXLA 3CU9A 2X8SA 1BFGA 1DQOA 3AKHA 1YYNA 3WN2A 4I4RA 3BX1C 3H6RB 4FFGA 4I4PA 3N7MA 4KBBA 3I29B 1NUNA 3HN1A 3OM5A 3CU1B 3PG0A 2ZR1B 4KEIA 2UUSA 3JUTA 1I1BA 4OWJA 3C7HA 3UGFA 1AFCA 2R9KB 3BAUA 1JTCA 2GZBA 3OGGA 2XQRA 1NZKA 1TOOA 1K5VA 4LO1C 1BFFA 3K1XA 1YIFA 3NQHA 5GLMA 2B4WA 3PIGA 3WATA 1TFMB 1YF8B 2D43A 3N7JA 2HW9A 2NZ9A 4JRAA 3CA3A 3OM4A 4YOLA 3MALA 3S8JA 3VSRA 3IM7A 4I0YA 4ISRA 3ZX7A 1JLXA 2KH2A 3LEMA 3FJ8A 1FV2A 1ABRB 3RWKX 2VSEA 3Q7XA 4LO3A 5GLRA 2D7RA 4ZFUB 1OQLB 4HA2A 4IZEA 3OM7A 3UD7A 4Z9WB 1PZZA 2AQZA 5FMBA 3WN0A 3AH1A 3FJFA 3AZVA 5F8YA 2P39A 4A7KA 2ADDA 4UY4A 2YFTA 5FZYA 3ZC8A 1XG6A 3BRGC 4UDKA 1V6VA 5BOWA 4X39A 1VCLA 4LO0C 3TC2A 2KKIA 4EFRA 5JMCA 2DRZA 2ZQOA 3K1UA 4I3NA 1FQ9A 4II0A 9ILBA 4EEEB 4MZGB 2D23A 5JOYA 3BADA 3QZ4A 1IILA 1HWPB 3WO4A 5JOZA 1DQGA 4LO3C 3P53A 1QQKA 3HALA 1OYGA 4AN6A 3FUQA 5HPZA 3CQAA 4G9MA 2J3PA 3C7OA 4OEFA 5A7VA 2Y9XE 2Q3NB 3WINC 5FZUA 4X3AA 3P2NA 3P6IA 1G9CA 3IM5A 4GOVA 4USPA 2MC2A 8I1BA 4I37A 3VSFA 4CJMA 1S0GA 4FGFA 1Z4SA 1BLDA 2EXHA 2X2TA 5B6TA 4MLGA 1RMLA 4QKRA 1M2TB 1HIBA 2QQUA 1L2HA 3S8KA 4XFSA 1J0SA 3N7KA 3ZXKA 3HMYA 5GLOA 5DZUA 4G9NA 2D22A 2EXKA 1QQLA 2WBCA 3AJ5A 4L4IA 5GAQA 4EFQA 2RG9B 3KF5A 1AF9A 1W3FA 4F34A 1ST8A 4IZXA 4HR6C 4Q9PA 5GLKA 4QO3A 1E0OA 2OXBA 3C7FA 1IOBA 4XFUA 3OBTA 1GGPB 1ISYA 4J2SA 3WASA 3ILAA 4IONA 4XFTA 1AXMA 3D61A 1YXWA 3FFZA 4AN7B 4LO1A 4JKQA 5GLLA 1QXMA 3IIRA 4H9WA 3C2UA 3I2XA 3NBNA 3LIGA 1DJSB 3QEDA 2RSTA 5BQUC 3QEFA 31BIA 4AK5A 1PC8B 4U6BA 7I1BA 2BEAA 4JKXB 4OEEA 2E4MC 5F8WA 4J2XA 1Y9MA 5JOWA 3FJAA 3Q7YA 3F62B 4FFFA 3V0AA 2HWAA 2WRYA 5BVPI 3FJHA 4I4XA 3CA6A 4WBCA 1HWOB 3FJCA 5FNXA 3BA5A 1M16A 4UDJA 3BYJA 4IHZA 2KLLA 2DRYA 3BA7A 1Z2VA 1FV3A 1AVWB 1FWUA 3FJIA 4PVAA 4QALA 2DREA 1PUMB 2D24A 3HOMA 1ISZA 4Q91A 3BYLA 4PVIA 1YBIA 4XKIA 3LFIA 3C9ZA 1PWAA 5FK8A 3WPVA 3VT2A 3W9TA 1IHKA 5FZZA 3FJBA 3A23A 41BIA 2AXMA 4I1EA 5FKBA 3BB2A 3A22A 3CRHA 1JQZA 4GOYA 4LO0A 3LLPA 1CVSA 1FGAA 4H75A 3KF3A 1PT2A 4LO7B 4QD2B 3WMYA 3BAVA 2AC1A 4MZFB 5GLPA 3HBWA 1P63A 3BAQA 4IY9A 4I2SA 3LF7A 4IY8A 3UJ4A 1RG8A 3FJDA 1TP0A 2XOAA 4I4OA 1GYDB 4AK6A 3QC2A 1DIWA 4N2ZA 2VXTI 1FMMS 1TIEA 4D8HA 5A7VB 3SC7X 4I4UA 3EF2A 1CE7B 2F8XC 3WINA 3WPYA 4COTA 3R4SA 1JT3A 4I7IA 1JT4A 1S0CA 1DFCA 1V6XA 3RSJA 3FJEA 1AVAC 1S0FA 2K43A 1D0HA 3SNVA 1MD6A 1GYEB 4ZBVB 2VU9A 4I1BA 1HCEA 2D7IA 4FVVA 5AYEA 3RMYA 5DUYA 3OJVA 4I4QA 3WMUA 3WMZA 2ERMA 1DZCA 3R4YA 3VT0A 3VWCA 4ENDA 2HWMA 4ZGRB 1JY0A 3OGFA 1T9FA 1JT5A 2NP0A 3IM6A 5ANNA 5FMCA 3O4CA 4KEJA 3AH4A 1BASA 4JP0A 3UJ0A 3D5YA 3RTJB 3T8SA 4LO8B 1EYLA 3QR5A 4DEPA 4KMIA 2BFHA 4D0ZA 3WPZA 1R8NA 1GYHA 1I1EA 3H6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JLY A;  1W3A A;  3OJ2 A;  5F90 A;  2LIE A;  2YUG A;  1TTU A;  1UV4 A;  1AVX B;  4JAW A;  3PUB A;  4A7Y A;  1V6W A;  1XZZ A;  3C7G A;  2VDT A;  1XHB A;  3FJK A;  4N1I A;  3O49 A;  1S0E A;  1ONK B;  2AAI B;  3AKF A;  3KMV A;  3O4B A;  1G82 A;  5DVH A;  1K5U A;  1HWM B;  5G00 A;  5B2H A;  4J23 B;  1FWV A;  3TAW A;  2IWT B;  3FJ9 A;  2LIQ A;  2DS0 A;  1BLA A;  3O4D A;  1PUU B;  1WL7 A;  4I4S A;  4NOV A;  2F2F C;  3WMV A;  1UYP A;  5BQU A;  5C0P A;  4G6M A;  1Q03 A;  2E4M A;  5BXS A;  2D20 A;  3V0A B;  5BXP A;  4JPZ A;  2Q9X A;  3OJM A;  3CA1 A;  4I4V A;  1HWN B;  5BXT A;  3LV4 A;  2NTD A;  4H04 A;  5EC5 A;  3OM6 A;  4JQ0 A;  4A7Z A;  2QQV A;  3POK A;  3C7E A;  2D44 A;  3A21 A;  4KCB A;  1SZ6 B;  1S0B A;  3Q7W A;  1W2T A;  1IJT A;  1BFC A;  1IRP A;  4FFI A;  4GP3 A;  4P0J A;  4P0L A;  3RTI B;  5FIX A;  3UD8 A;  1Y9G A;  3R67 A;  3FGM A;  4ZFW B;  3BAO A;  4LO2 A;  4QQS A;  2P23 A;  1BAR A;  1BFB A;  2AFG A;  2QN4 A;  2QYI B;  2FFU A;  6I1B A;  1YI7 A;  5D62 A;  2BEB A;  4ZFY B;  2EXJ A;  1DZD A;  2NM1 A;  4I96 A;  5FLW A;  3IAG C;  1TWM A;  3FUO A;  4I4Y A;  2VSA A;  2KI6 B;  1HKN A;  4OWL A;  3NBD A;  1F31 A;  3CRG A;  1II4 A;  2AEZ A;  3LDK A;  5EG6 C;  3UGH A;  3ZC9 A;  2EXI A;  5FNW A;  2K8R A;  3V79 C;  4D0T A;  1Y4W A;  3HSM A;  2NVH A;  3CA5 A;  2FFV A;  4EKX B;  1Z0H A;  3BTA A;  5D63 A;  3CRI A;  3LIH A;  5DSS B;  2M49 A;  3O4O A;  3QYD A;  4GAF A;  3N0K A;  3ZXJ A;  3V0B A;  4I6I A;  3WPU A;  2VUA A;  4X38 A;  3R4Z A;  2NYY A;  3VT1 A;  4UDK E;  3WN1 A;  5E24 E;  1WD4 A;  4LO2 C;  3I2A A;  3UD9 A;  4ONZ A;  3AKI A;  4OEG A;  1RZO B;  4G6J A;  3D60 A;  3KST A;  1AVU A;  1G9A A;  3R4U A;  5A8D A;  1EVT A;  3BYK A;  3BYN A;  3D7W B;  3WO2 A;  3E8L C;  5BP5 C;  4R6U B;  5AYC A;  5JLV A;  5B6S A;  4ZLB B;  3VEQ A;  2Z49 A;  2Y9G A;  3B9U A;  21BI A;  2GO2 A;  2I1B A;  4ZOT A;  1WBA A;  5BXR A;  1Q04 A;  3OM2 A;  3VUO A;  4PC4 A;  3CA0 A;  4QKS A;  5I1B A;  1IRA X;  1S0D A;  2RQ9 A;  4KCA A;  4AK7 A;  4U6D A;  1SR4 A;  3ZXD A;  4O8N A;  4EFP A;  1G9B A;  2FGF A;  1EV2 A;  2FDB M;  1ITB A;  1MC9 A;  2X8T A;  5AY9 A;  4Q9G A;  3O5W B;  4IQP A;  4DEN A;  1XYF A;  4Z8S B;  4GAI A;  1G9D A;  2Y9F A;  1ISX A;  3OBR A;  1DLL A;  3UDA A;  4UDI A;  1WBC A;  2AEY A;  3H6R A;  4L4H A;  3N7L A;  2F2F A;  3H6S E;  4J2Y A;  4UDG A;  1YTO A;  2MIB A;  3JRR A;  1YRZ A;  1IT0 A;  3LDR A;  2FO1 A;  3NBC A;  3ZXG A;  2YFS A;  1R8O A;  3BAG A;  1ILR 1;  3VSZ A;  1Y7B A;  4N4B A;  4P0K A;  1SR4 C;  4F83 A;  3BA4 A;  3O4A A;  4KC8 A;  2L5X A;  4KEK A;  3AJ6 A;  3PHZ A;  2ESU A;  3A07 A;  4I8M A;  3WO3 A;  2Y9W C;  1ISW A;  1S0L A;  3WA1 A;  5F8S A;  4USO A;  3O44 A;  4HJJ A;  1W3G A;  2X8F A;  1N4K A;  5EHA A;  3QEE A;  1FN0 A;  4EB2 B;  1TWE A;  1FMZ A;  1T4Q A;  2K4A B;  4QBV A;  2X2S A;  4G1R A;  3U75 A;  4QC4 A;  4J2K A;  3BRD A;  3LTQ A;  4ZA3 B;  4KC7 A;  2D1Z A;  3D5Z A;  4N2R A;  3O3Q A;  1DFQ A;  1HCD A;  1EPW A;  3F1R A;  5FKC A;  3AZW A;  3WAU A;  4KC3 A;  1RY7 A;  2ZQN A;  3PME A;  4OW4 A;  3VSS A;  3UGG A;  2VXR A;  3V0B B;  4DCK C;  3NJ5 A;  1JT7 A;  4O8P A;  1UPS A;  3AKG A;  5FK7 A;  3FJJ A;  5JOX A;  3PIJ A;  4ZKT B;  3BAH A;  5GLQ A;  5A8C A;  2IHO A;  4P6A A;  4D47 A;  2MLL B;  1VKD A;  2YFR A;  4OWK A;  4ISQ A;  4LO7 C;  3CAH A;  4QD2 C;  3AH2 A;  3U14 A;  3NBE A;  2Z48 A;  2HZ9 A;  4GP0 A;  5D61 A;  4IYB A;  4OUJ A;  1WD3 A;  5FMD A;  3CA4 A;  5BP5 A;  4EQV A;  1BA7 A;  4X37 A;  1Q1U A;  1A8D A;  4QBC A;  3RMX A;  2ET2 A;  1V6U A;  5AYD A;  1KNM A;  4TLP A;  4O8O A;  4FFH A;  2KI4 A;  2ADE A;  2QQW A;  3MPP G;  1ISV A;  3BRF A;  5GLN A;  2VLC A;  3P6J A;  1W18 A;  3ZXL A;  3CU9 A;  2X8S A;  1BFG A;  1DQO A;  3AKH A;  1YYN A;  3WN2 A;  4I4R A;  3BX1 C;  3H6R B;  4FFG A;  4I4P A;  3N7M A;  4KBB A;  3I29 B;  1NUN A;  3HN1 A;  3OM5 A;  3CU1 B;  3PG0 A;  2ZR1 B;  4KEI A;  2UUS A;  3JUT A;  1I1B A;  4OWJ A;  3C7H A;  3UGF A;  1AFC A;  2R9K B;  3BAU A;  1JTC A;  2GZB A;  3OGG A;  2XQR A;  1NZK A;  1TOO A;  1K5V A;  4LO1 C;  1BFF A;  3K1X A;  1YIF A;  3NQH A;  5GLM A;  2B4W A;  3PIG A;  3WAT A;  1TFM B;  1YF8 B;  2D43 A;  3N7J A;  2HW9 A;  2NZ9 A;  4JRA A;  3CA3 A;  3OM4 A;  4YOL A;  3MAL A;  3S8J A;  3VSR A;  3IM7 A;  4I0Y A;  4ISR A;  3ZX7 A;  1JLX A;  2KH2 A;  3LEM A;  3FJ8 A;  1FV2 A;  1ABR B;  3RWK X;  2VSE A;  3Q7X A;  4LO3 A;  5GLR A;  2D7R A;  4ZFU B;  1OQL B;  4HA2 A;  4IZE A;  3OM7 A;  3UD7 A;  4Z9W B;  1PZZ A;  2AQZ A;  5FMB A;  3WN0 A;  3AH1 A;  3FJF A;  3AZV A;  5F8Y A;  2P39 A;  4A7K A;  2ADD A;  2YFT A;  5FZY A;  3ZC8 A;  1XG6 A;  3BRG C;  4UDK A;  1V6V A;  5BOW A;  4X39 A;  1VCL A;  4LO0 C;  3TC2 A;  2KKI A;  4EFR A;  5JMC A;  2DRZ A;  2ZQO A;  3K1U A;  4I3N A;  1FQ9 A;  4II0 A;  9ILB A;  4EEE B;  2D23 A;  5JOY A;  3BAD A;  3QZ4 A;  1IIL A;  1HWP B;  3WO4 A;  5JOZ A;  1DQG A;  4LO3 C;  3P53 A;  1QQK A;  3HAL A;  1OYG A;  4AN6 A;  3FUQ A;  5HPZ A;  3CQA A;  4G9M A;  2J3P A;  3C7O A;  4OEF A;  5A7V A;  2Y9X E;  2Q3N B;  3WIN C;  5FZU A;  4X3A A;  3P2N A;  3P6I A;  1G9C A;  3IM5 A;  4GOV A;  4USP A;  2MC2 A;  8I1B A;  4I37 A;  3VSF A;  4CJM A;  1S0G A;  4FGF A;  1Z4S A;  1BLD A;  2EXH A;  2X2T A;  5B6T A;  4MLG A;  1RML A;  4QKR A;  1M2T B;  1HIB A;  2QQU A;  1L2H A;  3S8K A;  4XFS A;  1J0S A;  3N7K A;  3ZXK A;  3HMY A;  5GLO A;  5DZU A;  4G9N A;  2D22 A;  2EXK A;  1QQL A;  2WBC A;  3AJ5 A;  4L4I A;  5GAQ A;  4EFQ A;  2RG9 B;  3KF5 A;  1AF9 A;  1W3F A;  4F34 A;  1ST8 A;  4IZX A;  4HR6 C;  4Q9P A;  5GLK A;  4QO3 A;  1E0O A;  2OXB A;  3C7F A;  1IOB A;  4XFU A;  3OBT A;  1GGP B;  1ISY A;  4J2S A;  3WAS A;  3ILA A;  4ION A;  4XFT A;  1AXM A;  3D61 A;  1YXW A;  3FFZ A;  4AN7 B;  4LO1 A;  4JKQ A;  5GLL A;  1QXM A;  3IIR A;  4H9W A;  3C2U A;  3I2X A;  3NBN A;  3LIG A;  1DJS B;  3QED A;  2RST A;  5BQU C;  3QEF A;  31BI A;  4AK5 A;  1PC8 B;  4U6B A;  7I1B A;  2BEA A;  4JKX B;  4OEE A;  2E4M C;  5F8W A;  4J2X A;  1Y9M A;  5JOW A;  3FJA A;  3Q7Y A;  3F62 B;  4FFF A;  3V0A A;  2HWA A;  2WRY A;  5BVP I;  3FJH A;  4I4X A;  3CA6 A;  4WBC A;  1HWO B;  3FJC A;  5FNX A;  3BA5 A;  1M16 A;  4UDJ A;  3BYJ A;  4IHZ A;  2KLL A;  2DRY A;  3BA7 A;  1Z2V A;  1FV3 A;  1AVW B;  1FWU A;  3FJI A;  4PVA A;  4QAL A;  2DRE A;  1PUM B;  2D24 A;  3HOM A;  1ISZ A;  4Q91 A;  3BYL A;  4PVI A;  1YBI A;  4XKI A;  3LFI A;  3C9Z A;  1PWA A;  5FK8 A;  3WPV A;  3VT2 A;  3W9T A;  1IHK A;  5FZZ A;  3FJB A;  3A23 A;  41BI A;  2AXM A;  4I1E A;  5FKB A;  3BB2 A;  3A22 A;  3CRH A;  1JQZ A;  4GOY A;  4LO0 A;  3LLP A;  1CVS A;  1FGA A;  3KF3 A;  1PT2 A;  4LO7 B;  4QD2 B;  3WMY A;  3BAV A;  2AC1 A;  5GLP A;  3HBW A;  1P63 A;  3BAQ A;  4IY9 A;  4I2S A;  3LF7 A;  4IY8 A;  3UJ4 A;  1RG8 A;  3FJD A;  1TP0 A;  2XOA A;  4I4O A;  1GYD B;  4AK6 A;  3QC2 A;  1DIW A;  4N2Z A;  2VXT I;  1FMM S;  1TIE A;  4D8H A;  5A7V B;  3SC7 X;  4I4U A;  3EF2 A;  1CE7 B;  2F8X C;  3WIN A;  3WPY A;  4COT A;  3R4S A;  1JT3 A;  4I7I A;  1JT4 A;  1S0C A;  1DFC A;  1V6X A;  3RSJ A;  3FJE A;  1AVA C;  1S0F A;  2K43 A;  1D0H A;  3SNV A;  1MD6 A;  1GYE B;  4ZBV B;  2VU9 A;  4I1B A;  1HCE A;  2D7I A;  4FVV A;  5AYE A;  3RMY A;  5DUY A;  3OJV A;  4I4Q A;  3WMU A;  3WMZ A;  2ERM A;  1DZC A;  3R4Y A;  3VT0 A;  3VWC A;  4END A;  2HWM A;  4ZGR B;  1JY0 A;  3OGF A;  1T9F A;  1JT5 A;  2NP0 A;  3IM6 A;  5ANN A;  5FMC A;  3O4C A;  4KEJ A;  3AH4 A;  1BAS A;  4JP0 A;  3UJ0 A;  3D5Y A;  3RTJ B;  3T8S A;  4LO8 B;  1EYL A;  3QR5 A;  4DEP A;  4KMI A;  2BFH A;  4D0Z A;  3WPZ A;  1R8N A;  1GYH A;  1I1E A;  3H6Q A; 
#chains in the Genus database with same CATH topology
 1JLY A;  1W3A A;  3OJ2 A;  5F90 A;  2LIE A;  2YUG A;  1TTU A;  1UV4 A;  1AVX B;  4JAW A;  3PUB A;  4A7Y A;  1V6W A;  1XZZ A;  3C7G A;  2VDT A;  1XHB A;  3FJK A;  4N1I A;  3O49 A;  1S0E A;  1ONK B;  2AAI B;  3AKF A;  3KMV A;  3O4B A;  1G82 A;  5DVH A;  1K5U A;  1HWM B;  5G00 A;  5B2H A;  4J23 B;  1FWV A;  3TAW A;  2IWT B;  3FJ9 A;  2LIQ A;  2DS0 A;  1BLA A;  3O4D A;  1PUU B;  1WL7 A;  4I4S A;  4NOV A;  2F2F C;  3WMV A;  1UYP A;  5BQU A;  5C0P A;  4G6M A;  1Q03 A;  2E4M A;  5BXS A;  2D20 A;  3V0A B;  5BXP A;  4JPZ A;  2Q9X A;  3OJM A;  3CA1 A;  4I4V A;  1HWN B;  5BXT A;  3LV4 A;  2NTD A;  4H04 A;  5EC5 A;  3OM6 A;  4JQ0 A;  4A7Z A;  2QQV A;  3POK A;  3C7E A;  2D44 A;  3A21 A;  4KCB A;  1SZ6 B;  1TL2 A;  1S0B A;  3Q7W A;  1W2T A;  1IJT A;  1BFC A;  1IRP A;  4FFI A;  4GP3 A;  4P0J A;  4P0L A;  3RTI B;  5FIX A;  3UD8 A;  1Y9G A;  3R67 A;  3FGM A;  4ZFW B;  3BAO A;  4LO2 A;  4QQS A;  2P23 A;  1BAR A;  1BFB A;  2AFG A;  2QN4 A;  2QYI B;  2FFU A;  6I1B A;  1YI7 A;  5D62 A;  2BEB A;  4ZFY B;  2EXJ A;  1DZD A;  2NM1 A;  4I96 A;  5FLW A;  3IAG C;  1TWM A;  3FUO A;  4I4Y A;  2VSA A;  2KI6 B;  1HKN A;  4OWL A;  3NBD A;  1F31 A;  3CRG A;  1II4 A;  2AEZ A;  3LDK A;  5EG6 C;  3UGH A;  3ZC9 A;  2EXI A;  5FNW A;  2K8R A;  3V79 C;  4D0T A;  1Y4W A;  3HSM A;  2NVH A;  3CA5 A;  2FFV A;  4EKX B;  1Z0H A;  3BTA A;  5D63 A;  3CRI A;  3LIH A;  5DSS B;  2M49 A;  3O4O A;  3QYD A;  4GAF A;  3N0K A;  3ZXJ A;  3V0B A;  4I6I A;  3WPU A;  2VUA A;  4X38 A;  3R4Z A;  2NYY A;  3VT1 A;  4UDK E;  3WN1 A;  5E24 E;  1WD4 A;  4LO2 C;  3I2A A;  3UD9 A;  4ONZ A;  3AKI A;  4OEG A;  1RZO B;  4G6J A;  3D60 A;  3KST A;  1AVU A;  1G9A A;  3R4U A;  5A8D A;  1EVT A;  3BYK A;  3BYN A;  3D7W B;  3WO2 A;  3E8L C;  5BP5 C;  4R6U B;  5AYC A;  5JLV A;  5B6S A;  4ZLB B;  3VEQ A;  2Z49 A;  2Y9G A;  3B9U A;  21BI A;  2GO2 A;  2I1B A;  4ZOT A;  1WBA A;  5BXR A;  1Q04 A;  3OM2 A;  3VUO A;  4PC4 A;  3CA0 A;  4QKS A;  5I1B A;  1IRA X;  1S0D A;  2RQ9 A;  4KCA A;  4AK7 A;  4U6D A;  1SR4 A;  3ZXD A;  4O8N A;  4EFP A;  1G9B A;  2FGF A;  1EV2 A;  2FDB M;  1ITB A;  1MC9 A;  2X8T A;  5AY9 A;  4Q9G A;  3O5W B;  4IQP A;  4DEN A;  1XYF A;  4Z8S B;  4GAI A;  1G9D A;  2Y9F A;  1ISX A;  3OBR A;  1DLL A;  3UDA A;  4UDI A;  1WBC A;  2AEY A;  3H6R A;  4L4H A;  3N7L A;  2F2F A;  3H6S E;  4J2Y A;  4UDG A;  1YTO A;  2MIB A;  3JRR A;  1YRZ A;  1IT0 A;  3LDR A;  2FO1 A;  4MZH A;  3NBC A;  3ZXG A;  2YFS A;  1R8O A;  3BAG A;  1ILR 1;  3VSZ A;  1Y7B A;  4N4B A;  4P0K A;  1SR4 C;  4F83 A;  3BA4 A;  3O4A A;  4KC8 A;  2L5X A;  4KEK A;  3AJ6 A;  3PHZ A;  2ESU A;  3A07 A;  4I8M A;  3WO3 A;  2Y9W C;  1ISW A;  1S0L A;  3WA1 A;  5F8S A;  4USO A;  3O44 A;  4HJJ A;  2NS2 A;  1W3G A;  2X8F A;  1N4K A;  5EHA A;  3QEE A;  1FN0 A;  4EB2 B;  1TWE A;  1FMZ A;  1T4Q A;  2K4A B;  4QBV A;  2X2S A;  4G1R A;  3U75 A;  4QC4 A;  4J2K A;  3BRD A;  3LTQ A;  4ZA3 B;  4KC7 A;  2D1Z A;  3D5Z A;  4N2R A;  3O3Q A;  1DFQ A;  1HCD A;  1EPW A;  3F1R A;  5FKC A;  3AZW A;  3WAU A;  4KC3 A;  1RY7 A;  2ZQN A;  3PME A;  4OW4 A;  3VSS A;  3UGG A;  2VXR A;  3V0B B;  4DCK C;  3NJ5 A;  1JT7 A;  4O8P A;  1UPS A;  3AKG A;  5FK7 A;  3FJJ A;  5JOX A;  3PIJ A;  4ZKT B;  3BAH A;  5GLQ A;  5A8C A;  2IHO A;  4P6A A;  4D47 A;  2MLL B;  1VKD A;  2YFR A;  4OWK A;  4ISQ A;  4LO7 C;  3CAH A;  4QD2 C;  3AH2 A;  3U14 A;  3NBE A;  2Z48 A;  2HZ9 A;  4GP0 A;  5D61 A;  4IYB A;  4OUJ A;  1WD3 A;  5FMD A;  3CA4 A;  5BP5 A;  4EQV A;  1BA7 A;  4X37 A;  1Q1U A;  1A8D A;  4QBC A;  3RMX A;  2ET2 A;  1V6U A;  5AYD A;  1KNM A;  4TLP A;  4O8O A;  4FFH A;  2KI4 A;  2ADE A;  2QQW A;  3MPP G;  1ISV A;  3BRF A;  5GLN A;  2VLC A;  3P6J A;  1W18 A;  3ZXL A;  3CU9 A;  2X8S A;  1BFG A;  1DQO A;  3AKH A;  1YYN A;  3WN2 A;  4I4R A;  3BX1 C;  3H6R B;  4FFG A;  4I4P A;  3N7M A;  4KBB A;  3I29 B;  1NUN A;  3HN1 A;  3OM5 A;  3CU1 B;  3PG0 A;  2ZR1 B;  4KEI A;  2UUS A;  3JUT A;  1I1B A;  4OWJ A;  3C7H A;  3UGF A;  1AFC A;  2R9K B;  3BAU A;  1JTC A;  2GZB A;  3OGG A;  2XQR A;  1NZK A;  1TOO A;  1K5V A;  4LO1 C;  1BFF A;  3K1X A;  1YIF A;  3NQH A;  5GLM A;  2B4W A;  3PIG A;  3WAT A;  1TFM B;  1YF8 B;  2D43 A;  3N7J A;  2HW9 A;  2NZ9 A;  4JRA A;  3CA3 A;  3OM4 A;  4YOL A;  3MAL A;  3S8J A;  3VSR A;  3IM7 A;  4I0Y A;  4ISR A;  3ZX7 A;  1JLX A;  2KH2 A;  3LEM A;  3FJ8 A;  1FV2 A;  1ABR B;  3RWK X;  2VSE A;  3Q7X A;  4LO3 A;  5GLR A;  2D7R A;  4ZFU B;  1OQL B;  4HA2 A;  4IZE A;  3OM7 A;  3UD7 A;  4Z9W B;  1PZZ A;  2AQZ A;  5FMB A;  3WN0 A;  3AH1 A;  3FJF A;  3AZV A;  5F8Y A;  2P39 A;  4A7K A;  2ADD A;  4UY4 A;  2YFT A;  5FZY A;  3ZC8 A;  1XG6 A;  3BRG C;  4UDK A;  1V6V A;  5BOW A;  4X39 A;  1VCL A;  4LO0 C;  3TC2 A;  2KKI A;  4EFR A;  5JMC A;  2DRZ A;  2ZQO A;  3K1U A;  4I3N A;  1FQ9 A;  4II0 A;  9ILB A;  4EEE B;  4MZG B;  2D23 A;  5JOY A;  3BAD A;  3QZ4 A;  1IIL A;  1HWP B;  3WO4 A;  5JOZ A;  1DQG A;  4LO3 C;  3P53 A;  1QQK A;  3HAL A;  1OYG A;  4AN6 A;  3FUQ A;  5HPZ A;  3CQA A;  4G9M A;  2J3P A;  3C7O A;  4OEF A;  5A7V A;  2Y9X E;  2Q3N B;  3WIN C;  5FZU A;  4X3A A;  3P2N A;  3P6I A;  1G9C A;  3IM5 A;  4GOV A;  4USP A;  2MC2 A;  8I1B A;  4I37 A;  3VSF A;  4CJM A;  1S0G A;  4FGF A;  1Z4S A;  1BLD A;  2EXH A;  2X2T A;  5B6T A;  4MLG A;  1RML A;  4QKR A;  1M2T B;  1HIB A;  2QQU A;  1L2H A;  3S8K A;  4XFS A;  1J0S A;  3N7K A;  3ZXK A;  3HMY A;  5GLO A;  5DZU A;  4G9N A;  2D22 A;  2EXK A;  1QQL A;  2WBC A;  3AJ5 A;  4L4I A;  5GAQ A;  4EFQ A;  2RG9 B;  3KF5 A;  1AF9 A;  1W3F A;  4F34 A;  1ST8 A;  4IZX A;  4HR6 C;  4Q9P A;  5GLK A;  4QO3 A;  1E0O A;  2OXB A;  3C7F A;  1IOB A;  4XFU A;  3OBT A;  1GGP B;  1ISY A;  4J2S A;  3WAS A;  3ILA A;  4ION A;  4XFT A;  1AXM A;  3D61 A;  1YXW A;  3FFZ A;  4AN7 B;  4LO1 A;  4JKQ A;  5GLL A;  1QXM A;  3IIR A;  4H9W A;  3C2U A;  3I2X A;  3NBN A;  3LIG A;  1DJS B;  3QED A;  2RST A;  5BQU C;  3QEF A;  31BI A;  4AK5 A;  1PC8 B;  4U6B A;  7I1B A;  2BEA A;  4JKX B;  4OEE A;  2E4M C;  5F8W A;  4J2X A;  1Y9M A;  5JOW A;  3FJA A;  3Q7Y A;  3F62 B;  4FFF A;  3V0A A;  2HWA A;  2WRY A;  5BVP I;  3FJH A;  4I4X A;  3CA6 A;  4WBC A;  1HWO B;  3FJC A;  5FNX A;  3BA5 A;  1M16 A;  4UDJ A;  3BYJ A;  4IHZ A;  2KLL A;  2DRY A;  3BA7 A;  1Z2V A;  1FV3 A;  1AVW B;  1FWU A;  3FJI A;  4PVA A;  4QAL A;  2DRE A;  1PUM B;  2D24 A;  3HOM A;  1ISZ A;  4Q91 A;  3BYL A;  4PVI A;  1YBI A;  4XKI A;  3LFI A;  3C9Z A;  1PWA A;  5FK8 A;  3WPV A;  3VT2 A;  3W9T A;  1IHK A;  5FZZ A;  3FJB A;  3A23 A;  41BI A;  2AXM A;  4I1E A;  5FKB A;  3BB2 A;  3A22 A;  3CRH A;  1JQZ A;  4GOY A;  4LO0 A;  3LLP A;  1CVS A;  1FGA A;  4H75 A;  3KF3 A;  1PT2 A;  4LO7 B;  4QD2 B;  3WMY A;  3BAV A;  2AC1 A;  4MZF B;  5GLP A;  3HBW A;  1P63 A;  3BAQ A;  4IY9 A;  4I2S A;  3LF7 A;  4IY8 A;  3UJ4 A;  1RG8 A;  5C2M A;  3FJD A;  1TP0 A;  2XOA A;  4I4O A;  1GYD B;  4AK6 A;  3QC2 A;  1DIW A;  4N2Z A;  2VXT I;  1FMM S;  1TIE A;  4D8H A;  5A7V B;  3SC7 X;  4I4U A;  3EF2 A;  1CE7 B;  2F8X C;  3WIN A;  3WPY A;  4COT A;  3R4S A;  1JT3 A;  4I7I A;  1JT4 A;  1S0C A;  1DFC A;  1V6X A;  3RSJ A;  3FJE A;  1AVA C;  1S0F A;  2K43 A;  1D0H A;  3SNV A;  1MD6 A;  1GYE B;  4ZBV B;  2VU9 A;  4I1B A;  1HCE A;  2D7I A;  4FVV A;  5AYE A;  3RMY A;  5DUY A;  3OJV A;  4I4Q A;  3WMU A;  3WMZ A;  2ERM A;  1DZC A;  3R4Y A;  3VT0 A;  3VWC A;  4END A;  2HWM A;  4ZGR B;  1JY0 A;  3OGF A;  1T9F A;  1JT5 A;  2NP0 A;  3IM6 A;  5ANN A;  5FMC A;  3O4C A;  4KEJ A;  3AH4 A;  1BAS A;  4JP0 A;  3UJ0 A;  3D5Y A;  3RTJ B;  3T8S A;  4LO8 B;  1EYL A;  3QR5 A;  4DEP A;  4KMI A;  2BFH A;  4D0Z A;  3WPZ A;  1R8N A;  1GYH A;  1I1E A;  3H6Q A; 
#chains in the Genus database with same CATH homology
 1JLY A;  1W3A A;  3OJ2 A;  5F90 A;  2LIE A;  2YUG A;  1TTU A;  1UV4 A;  1AVX B;  4JAW A;  3PUB A;  4A7Y A;  1V6W A;  1XZZ A;  3C7G A;  2VDT A;  1XHB A;  3FJK A;  4N1I A;  3O49 A;  1S0E A;  1ONK B;  2AAI B;  3AKF A;  3KMV A;  3O4B A;  1G82 A;  5DVH A;  1K5U A;  1HWM B;  5G00 A;  5B2H A;  4J23 B;  1FWV A;  3TAW A;  2IWT B;  3FJ9 A;  2LIQ A;  2DS0 A;  1BLA A;  3O4D A;  1PUU B;  1WL7 A;  4I4S A;  4NOV A;  2F2F C;  3WMV A;  1UYP A;  5BQU A;  5C0P A;  4G6M A;  1Q03 A;  2E4M A;  5BXS A;  2D20 A;  3V0A B;  5BXP A;  4JPZ A;  2Q9X A;  3OJM A;  3CA1 A;  4I4V A;  1HWN B;  5BXT A;  3LV4 A;  2NTD A;  4H04 A;  5EC5 A;  3OM6 A;  4JQ0 A;  4A7Z A;  2QQV A;  3POK A;  3C7E A;  2D44 A;  3A21 A;  4KCB A;  1SZ6 B;  1S0B A;  3Q7W A;  1W2T A;  1IJT A;  1BFC A;  1IRP A;  4FFI A;  4GP3 A;  4P0J A;  4P0L A;  3RTI B;  5FIX A;  3UD8 A;  1Y9G A;  3R67 A;  3FGM A;  4ZFW B;  3BAO A;  4LO2 A;  4QQS A;  2P23 A;  1BAR A;  1BFB A;  2AFG A;  2QN4 A;  2QYI B;  2FFU A;  6I1B A;  1YI7 A;  5D62 A;  2BEB A;  4ZFY B;  2EXJ A;  1DZD A;  2NM1 A;  4I96 A;  5FLW A;  3IAG C;  1TWM A;  3FUO A;  4I4Y A;  2VSA A;  2KI6 B;  1HKN A;  4OWL A;  3NBD A;  1F31 A;  3CRG A;  1II4 A;  2AEZ A;  3LDK A;  5EG6 C;  3UGH A;  3ZC9 A;  2EXI A;  5FNW A;  2K8R A;  3V79 C;  4D0T A;  1Y4W A;  3HSM A;  2NVH A;  3CA5 A;  2FFV A;  4EKX B;  1Z0H A;  3BTA A;  5D63 A;  3CRI A;  3LIH A;  5DSS B;  2M49 A;  3O4O A;  3QYD A;  4GAF A;  3N0K A;  3ZXJ A;  3V0B A;  4I6I A;  3WPU A;  2VUA A;  4X38 A;  3R4Z A;  2NYY A;  3VT1 A;  4UDK E;  3WN1 A;  5E24 E;  1WD4 A;  4LO2 C;  3I2A A;  3UD9 A;  4ONZ A;  3AKI A;  4OEG A;  1RZO B;  4G6J A;  3D60 A;  3KST A;  1AVU A;  1G9A A;  3R4U A;  5A8D A;  1EVT A;  3BYK A;  3BYN A;  3D7W B;  3WO2 A;  3E8L C;  5BP5 C;  4R6U B;  5AYC A;  5JLV A;  5B6S A;  4ZLB B;  3VEQ A;  2Z49 A;  2Y9G A;  3B9U A;  21BI A;  2GO2 A;  2I1B A;  4ZOT A;  1WBA A;  5BXR A;  1Q04 A;  3OM2 A;  3VUO A;  4PC4 A;  3CA0 A;  4QKS A;  5I1B A;  1IRA X;  1S0D A;  2RQ9 A;  4KCA A;  4AK7 A;  4U6D A;  1SR4 A;  3ZXD A;  4O8N A;  4EFP A;  1G9B A;  2FGF A;  1EV2 A;  2FDB M;  1ITB A;  1MC9 A;  2X8T A;  5AY9 A;  4Q9G A;  3O5W B;  4IQP A;  4DEN A;  1XYF A;  4Z8S B;  4GAI A;  1G9D A;  2Y9F A;  1ISX A;  3OBR A;  1DLL A;  3UDA A;  4UDI A;  1WBC A;  2AEY A;  3H6R A;  4L4H A;  3N7L A;  2F2F A;  3H6S E;  4J2Y A;  4UDG A;  1YTO A;  2MIB A;  3JRR A;  1YRZ A;  1IT0 A;  3LDR A;  2FO1 A;  4MZH A;  3NBC A;  3ZXG A;  2YFS A;  1R8O A;  3BAG A;  1ILR 1;  3VSZ A;  1Y7B A;  4N4B A;  4P0K A;  1SR4 C;  4F83 A;  3BA4 A;  3O4A A;  4KC8 A;  2L5X A;  4KEK A;  3AJ6 A;  3PHZ A;  2ESU A;  3A07 A;  4I8M A;  3WO3 A;  2Y9W C;  1ISW A;  1S0L A;  3WA1 A;  5F8S A;  4USO A;  3O44 A;  4HJJ A;  2NS2 A;  1W3G A;  2X8F A;  1N4K A;  5EHA A;  3QEE A;  1FN0 A;  4EB2 B;  1TWE A;  1FMZ A;  1T4Q A;  2K4A B;  4QBV A;  2X2S A;  4G1R A;  3U75 A;  4QC4 A;  4J2K A;  3BRD A;  3LTQ A;  4ZA3 B;  4KC7 A;  2D1Z A;  3D5Z A;  4N2R A;  3O3Q A;  1DFQ A;  1HCD A;  1EPW A;  3F1R A;  5FKC A;  3AZW A;  3WAU A;  4KC3 A;  1RY7 A;  2ZQN A;  3PME A;  4OW4 A;  3VSS A;  3UGG A;  2VXR A;  3V0B B;  4DCK C;  3NJ5 A;  1JT7 A;  4O8P A;  1UPS A;  3AKG A;  5FK7 A;  3FJJ A;  5JOX A;  3PIJ A;  4ZKT B;  3BAH A;  5GLQ A;  5A8C A;  2IHO A;  4P6A A;  4D47 A;  2MLL B;  1VKD A;  2YFR A;  4OWK A;  4ISQ A;  4LO7 C;  3CAH A;  4QD2 C;  3AH2 A;  3U14 A;  3NBE A;  2Z48 A;  2HZ9 A;  4GP0 A;  5D61 A;  4IYB A;  4OUJ A;  1WD3 A;  5FMD A;  3CA4 A;  5BP5 A;  4EQV A;  1BA7 A;  4X37 A;  1Q1U A;  1A8D A;  4QBC A;  3RMX A;  2ET2 A;  1V6U A;  5AYD A;  1KNM A;  4TLP A;  4O8O A;  4FFH A;  2KI4 A;  2ADE A;  2QQW A;  3MPP G;  1ISV A;  3BRF A;  5GLN A;  2VLC A;  3P6J A;  1W18 A;  3ZXL A;  3CU9 A;  2X8S A;  1BFG A;  1DQO A;  3AKH A;  1YYN A;  3WN2 A;  4I4R A;  3BX1 C;  3H6R B;  4FFG A;  4I4P A;  3N7M A;  4KBB A;  3I29 B;  1NUN A;  3HN1 A;  3OM5 A;  3CU1 B;  3PG0 A;  2ZR1 B;  4KEI A;  2UUS A;  3JUT A;  1I1B A;  4OWJ A;  3C7H A;  3UGF A;  1AFC A;  2R9K B;  3BAU A;  1JTC A;  2GZB A;  3OGG A;  2XQR A;  1NZK A;  1TOO A;  1K5V A;  4LO1 C;  1BFF A;  3K1X A;  1YIF A;  3NQH A;  5GLM A;  2B4W A;  3PIG A;  3WAT A;  1TFM B;  1YF8 B;  2D43 A;  3N7J A;  2HW9 A;  2NZ9 A;  4JRA A;  3CA3 A;  3OM4 A;  4YOL A;  3MAL A;  3S8J A;  3VSR A;  3IM7 A;  4I0Y A;  4ISR A;  3ZX7 A;  1JLX A;  2KH2 A;  3LEM A;  3FJ8 A;  1FV2 A;  1ABR B;  3RWK X;  2VSE A;  3Q7X A;  4LO3 A;  5GLR A;  2D7R A;  4ZFU B;  1OQL B;  4HA2 A;  4IZE A;  3OM7 A;  3UD7 A;  4Z9W B;  1PZZ A;  2AQZ A;  5FMB A;  3WN0 A;  3AH1 A;  3FJF A;  3AZV A;  5F8Y A;  2P39 A;  4A7K A;  2ADD A;  4UY4 A;  2YFT A;  5FZY A;  3ZC8 A;  1XG6 A;  3BRG C;  4UDK A;  1V6V A;  5BOW A;  4X39 A;  1VCL A;  4LO0 C;  3TC2 A;  2KKI A;  4EFR A;  5JMC A;  2DRZ A;  2ZQO A;  3K1U A;  4I3N A;  1FQ9 A;  4II0 A;  9ILB A;  4EEE B;  4MZG B;  2D23 A;  5JOY A;  3BAD A;  3QZ4 A;  1IIL A;  1HWP B;  3WO4 A;  5JOZ A;  1DQG A;  4LO3 C;  3P53 A;  1QQK A;  3HAL A;  1OYG A;  4AN6 A;  3FUQ A;  5HPZ A;  3CQA A;  4G9M A;  2J3P A;  3C7O A;  4OEF A;  5A7V A;  2Y9X E;  2Q3N B;  3WIN C;  5FZU A;  4X3A A;  3P2N A;  3P6I A;  1G9C A;  3IM5 A;  4GOV A;  4USP A;  2MC2 A;  8I1B A;  4I37 A;  3VSF A;  4CJM A;  1S0G A;  4FGF A;  1Z4S A;  1BLD A;  2EXH A;  2X2T A;  5B6T A;  4MLG A;  1RML A;  4QKR A;  1M2T B;  1HIB A;  2QQU A;  1L2H A;  3S8K A;  4XFS A;  1J0S A;  3N7K A;  3ZXK A;  3HMY A;  5GLO A;  5DZU A;  4G9N A;  2D22 A;  2EXK A;  1QQL A;  2WBC A;  3AJ5 A;  4L4I A;  5GAQ A;  4EFQ A;  2RG9 B;  3KF5 A;  1AF9 A;  1W3F A;  4F34 A;  1ST8 A;  4IZX A;  4HR6 C;  4Q9P A;  5GLK A;  4QO3 A;  1E0O A;  2OXB A;  3C7F A;  1IOB A;  4XFU A;  3OBT A;  1GGP B;  1ISY A;  4J2S A;  3WAS A;  3ILA A;  4ION A;  4XFT A;  1AXM A;  3D61 A;  1YXW A;  3FFZ A;  4AN7 B;  4LO1 A;  4JKQ A;  5GLL A;  1QXM A;  3IIR A;  4H9W A;  3C2U A;  3I2X A;  3NBN A;  3LIG A;  1DJS B;  3QED A;  2RST A;  5BQU C;  3QEF A;  31BI A;  4AK5 A;  1PC8 B;  4U6B A;  7I1B A;  2BEA A;  4JKX B;  4OEE A;  2E4M C;  5F8W A;  4J2X A;  1Y9M A;  5JOW A;  3FJA A;  3Q7Y A;  3F62 B;  4FFF A;  3V0A A;  2HWA A;  2WRY A;  5BVP I;  3FJH A;  4I4X A;  3CA6 A;  4WBC A;  1HWO B;  3FJC A;  5FNX A;  3BA5 A;  1M16 A;  4UDJ A;  3BYJ A;  4IHZ A;  2KLL A;  2DRY A;  3BA7 A;  1Z2V A;  1FV3 A;  1AVW B;  1FWU A;  3FJI A;  4PVA A;  4QAL A;  2DRE A;  1PUM B;  2D24 A;  3HOM A;  1ISZ A;  4Q91 A;  3BYL A;  4PVI A;  1YBI A;  4XKI A;  3LFI A;  3C9Z A;  1PWA A;  5FK8 A;  3WPV A;  3VT2 A;  3W9T A;  1IHK A;  5FZZ A;  3FJB A;  3A23 A;  41BI A;  2AXM A;  4I1E A;  5FKB A;  3BB2 A;  3A22 A;  3CRH A;  1JQZ A;  4GOY A;  4LO0 A;  3LLP A;  1CVS A;  1FGA A;  4H75 A;  3KF3 A;  1PT2 A;  4LO7 B;  4QD2 B;  3WMY A;  3BAV A;  2AC1 A;  4MZF B;  5GLP A;  3HBW A;  1P63 A;  3BAQ A;  4IY9 A;  4I2S A;  3LF7 A;  4IY8 A;  3UJ4 A;  1RG8 A;  3FJD A;  1TP0 A;  2XOA A;  4I4O A;  1GYD B;  4AK6 A;  3QC2 A;  1DIW A;  4N2Z A;  2VXT I;  1FMM S;  1TIE A;  4D8H A;  5A7V B;  3SC7 X;  4I4U A;  3EF2 A;  1CE7 B;  2F8X C;  3WIN A;  3WPY A;  4COT A;  3R4S A;  1JT3 A;  4I7I A;  1JT4 A;  1S0C A;  1DFC A;  1V6X A;  3RSJ A;  3FJE A;  1AVA C;  1S0F A;  2K43 A;  1D0H A;  3SNV A;  1MD6 A;  1GYE B;  4ZBV B;  2VU9 A;  4I1B A;  1HCE A;  2D7I A;  4FVV A;  5AYE A;  3RMY A;  5DUY A;  3OJV A;  4I4Q A;  3WMU A;  3WMZ A;  2ERM A;  1DZC A;  3R4Y A;  3VT0 A;  3VWC A;  4END A;  2HWM A;  4ZGR B;  1JY0 A;  3OGF A;  1T9F A;  1JT5 A;  2NP0 A;  3IM6 A;  5ANN A;  5FMC A;  3O4C A;  4KEJ A;  3AH4 A;  1BAS A;  4JP0 A;  3UJ0 A;  3D5Y A;  3RTJ B;  3T8S A;  4LO8 B;  1EYL A;  3QR5 A;  4DEP A;  4KMI A;  2BFH A;  4D0Z A;  3WPZ A;  1R8N A;  1GYH A;  1I1E A;  3H6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...