3VT1A

Crystal structure of ct1,3gal43a in complex with galactose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
461
structure length
461
Chain Sequence
EGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYYYLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLVNKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDESKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSDAGGTNQHWKLVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ricin B lectin
publication title Crystal structure of 1,3Gal43A, an exo-beta-1,3-galactanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 128
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vt1A02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vt1A01
2D24A 3BADA 1HCEA 4GP3A 4QKSA 3MPPG 1J0SA 4KC7A 4PC4A 2VXRA 5DVHA 1WD4A 3WA1A 4U6DA 3FFZA 4QD2C 4I37A 4QQSA 4U6BA 3FJHA 1V6VA 4ZFWB 5A8CA 2ADEA 1QXMA 3AZWA 2X8TA 5A8DA 1TWMA 3CA1A 4G9MA 2X2SA 3EF2A 3HOMA 3R4YA 3U75A 4F83A 3CA3A 5GLKA 4ISQA 2HWAA 3Q7WA 5F8SA 2D7IA 1JY0A 2D44A 4UDKE 5JOWA 5DUYA 1WBAA 3WMZA 3O4AA 3OJMA 4LO1C 3BAUA 1JLXA 1AVXB 1Z0HA 4LO7B 3FUOA 2NYYA 4Q9PA 4ZBVB 3RTJB 3O49A 1HKNA 4XFTA 3H6RB 5FLWA 5FMDA 4AK7A 3LDKA 4LO0C 4J23B 4OWKA 4I4SA 1V6UA 1SR4C 5BXTA 3WPZA 3AJ6A 4I0YA 4DCKC 3QR5A 4X39A 2FFVA 1PWAA 1YXWA 3FJDA 4FVVA 1JT5A 1Q03A 1I1EA 4XFSA 4AN6A 4I4YA 3BA4A 1P63A 3BRFA 3CA4A 3WAUA 4PVIA 4I4PA 2XOAA 3O4OA 5FKCA 3AH1A 3MALA 3HSMA 3V0AA 1BFFA 2GO2A 3OBTA 4PVAA 4ISRA 1BFCA 2R9KB 4P0KA 1NUNA 4X37A 3HMYA 3IAGC 3WPYA 1JTCA 4GOVA 4I4OA 3ZX7A 1A8DA 21BIA 3UD9A 1TWEA 1SZ6B 4WBCA 1S0GA 3ZXGA 3OM6A 2DREA 2NZ9A 1UPSA 2K4AB 2Y9FA 3F1RA 4GAIA 2X8FA 3WATA 3WINC 3FJFA 1BARA 1FWVA 1G9DA 3C2UA 1W3FA 2LIQA 4FFHA 1MD6A 5D62A 3PIJA 5FK8A 3NJ5A 1II4A 2BEBA 4L4IA 5BQUA 2Z48A 4ZGRB 5AYDA 2EXHA 1HWPB 4OEGA 2NP0A 3K1UA 2QN4A 3AKFA 3LFIA 4KEJA 4HR6C 2IWTB 5D61A 1UYPA 3O3QA 4A7ZA 3BB2A 4ENDA 4LO7C 1XG6A 3OGGA 4MLGA 2RQ9A 1RY7A 3BAOA 1AXMA 3C7EA 3U14A 4QALA 4JRAA 1BFBA 4G1RA 4IHZA 3ZXDA 1Z2VA 4D0ZA 3OJVA 3C7HA 4ZOTA 2RG9B 2VUAA 3D60A 2KH2A 3CA0A 1AVUA 4KBBA 1T9FA 3FJEA 2D7RA 1PUMB 3P6IA 3RTIB 3S8KA 2ERMA 4ZFYB 1D0HA 3VUOA 2L5XA 3WO3A 3RWKX 4JP0A 3CA6A 5JOYA 3WO4A 3BA7A 3KF5A 1Y9GA 1FGAA 3R4ZA 3CRIA 3LV4A 1IRPA 4DENA 3JRRA 3WN1A 4EEEB 3PIGA 2MIBA 3AH4A 5BXPA 3FJJA 5GLMA 2P23A 3WINA 4HA2A 3BTAA 2MLLB 4YOLA 2AC1A 2FDBM 1TOOA 4NOVA 3BAGA 1G9BA 3BAHA 4KC8A 4I4UA 4IQPA 4O8PA 1RG8A 4UDJA 4ZFUB 3LEMA 1BFGA 3CU1B 1HWOB 1YI7A 3QEEA 2AFGA 2QYIB 1PZZA 3Q7YA 1S0BA 1YRZA 2MC2A 4IY8A 3IIRA 2BEAA 1OYGA 4QKRA 1ABRB 3O4CA 3WMYA 4I3NA 4I96A 3OM7A 4I4QA 3A23A 1I1BA 4D47A 3BAQA 3LTQA 4UDGA 2HWMA 5FMCA 3R4SA 1V6WA 1FV2A 3K1XA 4DEPA 3UD8A 3OBRA 3OM2A 3OJ2A 3HN1A 1Q04A 3CAHA 2VU9A 3TC2A 1YYNA 1ISWA 3FJKA 3D61A 4EKXB 3JUTA 1S0DA 2ZR1B 3FJ8A 1DLLA 1AVAC 1Y9MA 3I2AA 1TFMB 1G9CA 4A7YA 3WPVA 5AY9A 1AVWB 1DZDA 2Y9GA 4LO3C 3N7KA 3QZ4A 1AF9A 3VSZA 2QQWA 5EHAA 1OQLB 3O4DA 2F2FC 1ISVA 4J2YA 4LO2C 5G00A 4KMIA 3UGFA 3WPUA 5FZUA 3RMYA 3RSJA 3VSSA 3F62B 2E4MA 2Y9WC 1T4QA 2FFUA 1JT4A 1TP0A 4AK5A 4QBVA 5BP5A 2VSEA 4H04A 4IY9A 5BXSA 1XHBA 3V79C 1BLDA 1JQZA 1EPWA 2FO1A 1RZOB 5FZYA 2B4WA 1EYLA 3AKHA 3I29B 3OGFA 1YF8B 4OW4A 2KI4A 3ZC8A 3BX1C 3H6QA 1G82A 2M49A 1HWNB 5JLVA 2J3PA 3IM7A 3BYKA 2DRZA 5DZUA 1FWUA 4Q9GA 3QEDA 2VDTA 4JPZA 3W9TA 4IZXA 4O8OA 3AKGA 3NBEA 5AYCA 3P6JA 1EVTA 2I1BA 1K5VA 2VSAA 3QC2A 3PHZA 4KC3A 1TTUA 1S0FA 4I2SA 4LO1A 3SC7X 4JAWA 1W18A 5JOXA 1GGPB 4JQ0A 2P39A 2WRYA 1CE7B 4IONA 3BRGC 2LIEA 1ITBA 3BYJA 2UUSA 3LLPA 1IRAX 2BFHA 3WMUA 1DFCA 3QYDA 3AZVA 1GYEB 4XFUA 4LO0A 4J2SA 4LO3A 1JT3A 3KF3A 1AFCA 4LO8B 3V0AB 1SR4A 5A7VA 4I6IA 2AEYA 2YFTA 3N7MA 3T8SA 1GYDB 3C7OA 5HPZA 3V0BA 4QC4A 1DZCA 1UV4A 4EQVA 1G9AA 3VEQA 1L2HA 4L4HA 5B6SA 2X2TA 3N7JA 5BXRA 4Q91A 6I1BA 3O5WB 1R8NA 2Q3NB 3E8LC 1E0OA 4AN7B 1YTOA 3CRHA 3KSTA 4USOA 4P0LA 2ET2A 3LIHA 5C0PA 3FUQA 4IZEA 1DIWA 4P6AA 4ZA3B 3HBWA 3AKIA 3CA5A 3R4UA 2D23A 2AXMA 1ISZA 3FJCA 3UJ4A 5FK7A 4J2KA 5JOZA 1Z4SA 5B2HA 1MC9A 2KLLA 2AQZA 3KMVA 5GLLA 1WD3A 3P2NA 4TLPA 3PUBA 3N0KA 5EG6C 4X3AA 1Y7BA 2RSTA 2XQRA 4H9WA 3CU9A 5D63A 3OM4A 1RMLA 4F34A 4EB2B 3ZXLA 1IHKA 1VKDA 1W2TA 3BYNA 5F90A 3FJAA 4KEIA 3A21A 1CVSA 3LDRA 3WN0A 2YUGA 5FZZA 3ILAA 4GP0A 3H6SE 2D22A 1BA7A 3WO2A 5E24E 2AEZA 2EXKA 3D5YA 4OEEA 1M2TB 4G9NA 8I1BA 1ST8A 3UGGA 3H6RA 2ADDA 3BAVA 2FGFA 3CQAA 5GLPA 1FV3A 4I4XA 2K8RA 2NVHA 3PG0A 2HW9A 1IJTA 5JMCA 3I2XA 4I1EA 1V6XA 1W3AA 2YFSA 2KKIA 1BASA 2OXBA 4XKIA 5I1BA 1S0CA 3VSFA 2Q9XA 3C7GA 1PUUB 2Y9XE 1VCLA 1ILR1 4G6JA 5GLQA 1FN0A 4OWJA 3VSRA 4FFFA 1XZZA 3IM6A 4Z8SB 3ZC9A 4N1IA 2QQVA 3BA5A 3POKA 3WMVA 4COTA 4ZLBB 5DSSB 1XYFA 1FQ9A 1PT2A 5BQUC 3O4BA 2X8SA 4UDIA 3FJBA 3CRGA 9ILBA 1IOBA 3ZXKA 1WL7A 1M16A 5F8WA 3WASA 3AH2A 4OEFA 3UDAA 3HALA 3Q7XA 2AAIB 4FGFA 3TAWA 4I7IA 2D20A 2VLCA 4R6UB 1TIEA 3ZXJA 3O44A 4CJMA 1F31A 2NM1A 3C7FA 2WBCA 3NBCA 4X38A 1Y4WA 4J2XA 5GLNA 5FNXA 4N4BA 1R8OA 4EFPA 5GAQA 3WN2A 2DS0A 3NBDA 2GZBA 2ZQNA 4I1BA 2K43A 4JKXB 31BIA 3C9ZA 4O8NA 5GLRA 3UJ0A 1EV2A 4I4VA 4GOYA 4D8HA 3BRDA 1QQKA 3VT2A 4P0JA 4QD2B 1YIFA 5AYEA 1W3GA 2F2FA 4USPA 4LO2A 4IYBA 3S8JA 3NBNA 5FMBA 3D7WB 2EXIA 3IM5A 5B6TA 2HZ9A 4ONZA 1NZKA 3SNVA 3R67A 4UDKA 1ISXA 2NTDA 2ZQOA 3RMXA 4JKQA 3VT0A 4KCAA 3FGMA 2F8XC 4FFIA 3B9UA 4QBCA 2EXJA 4AK6A 1BLAA 5F8YA 1IT0A 3OM5A 4Z9WB 4FFGA 1JLYA 3A07A 3LIGA 5ANNA 1IILA 3N7LA 1N4KA 4OUJA 5BOWA 4QO3A 3P53A 3D5ZA 1YBIA 2KI6B 3VT1A 3NQHA 2IHOA 1ONKB 4I8MA 1FMZA 1HIBA 2Z49A 4KEKA 4OWLA 1QQLA 3A22A 2DRYA 1KNMA 1S0EA 3FJIA 3UD7A 5A7VB 5FKBA 1DFQA 3QEFA 1WBCA 4A7KA 3LF7A 4GAFA 5FNWA 3V0BB 2YFRA 3VWCA 5BVPI 2VXTI 3BYLA 1Q1UA 4N2ZA 2D43A 1K5UA 1HCDA 1S0LA 7I1BA 2QQUA 3UGHA 5EC5A 4N2RA 4EFQA 1DJSB 1DQGA 1GYHA 5GLOA 2D1ZA 1ISYA 1JT7A 1PC8B 41BIA 4KCBA 1DQOA 4HJJA 2ESUA 2E4MC 3AJ5A 4G6MA 4ZKTB 4D0TA 1HWMB 3FJ9A 5BP5C 4I4RA 3PMEA 4EFRA 4II0A 1FMMS 5FIXA
chains in the Genus database with same CATH superfamily
2D24A 3BADA 1HCEA 4GP3A 4QKSA 3MPPG 1J0SA 4KC7A 4PC4A 2VXRA 5DVHA 1WD4A 3WA1A 4U6DA 3FFZA 4QD2C 4I37A 4QQSA 4U6BA 3FJHA 1V6VA 4ZFWB 5A8CA 2ADEA 1QXMA 3AZWA 2X8TA 5A8DA 1TWMA 3CA1A 4G9MA 2X2SA 3EF2A 3HOMA 3R4YA 2NS2A 3U75A 4F83A 3CA3A 5GLKA 4ISQA 2HWAA 3Q7WA 5F8SA 2D7IA 1JY0A 2D44A 4UDKE 5JOWA 5DUYA 1WBAA 3WMZA 3O4AA 3OJMA 4LO1C 3BAUA 1JLXA 1AVXB 1Z0HA 4LO7B 3FUOA 2NYYA 4Q9PA 4ZBVB 3RTJB 3O49A 1HKNA 4XFTA 3H6RB 5FLWA 5FMDA 4AK7A 3LDKA 4LO0C 4J23B 4OWKA 4I4SA 1V6UA 1SR4C 5BXTA 3WPZA 3AJ6A 4I0YA 4DCKC 3QR5A 4X39A 2FFVA 1PWAA 1YXWA 3FJDA 4FVVA 1JT5A 1Q03A 1I1EA 4XFSA 4AN6A 4I4YA 3BA4A 1P63A 3BRFA 3CA4A 3WAUA 4PVIA 4I4PA 2XOAA 3O4OA 5FKCA 3AH1A 3MALA 3HSMA 3V0AA 1BFFA 2GO2A 3OBTA 4PVAA 4ISRA 1BFCA 2R9KB 4P0KA 1NUNA 4X37A 3HMYA 3IAGC 3WPYA 1JTCA 4GOVA 4I4OA 3ZX7A 1A8DA 21BIA 3UD9A 1TWEA 1SZ6B 4WBCA 1S0GA 3ZXGA 3OM6A 2DREA 2NZ9A 1UPSA 2K4AB 2Y9FA 3F1RA 4GAIA 2X8FA 3WATA 3WINC 3FJFA 1BARA 1FWVA 1G9DA 3C2UA 1W3FA 2LIQA 4FFHA 1MD6A 5D62A 3PIJA 5FK8A 3NJ5A 1II4A 2BEBA 4L4IA 5BQUA 2Z48A 4ZGRB 5AYDA 2EXHA 1HWPB 4OEGA 2NP0A 3K1UA 2QN4A 3AKFA 3LFIA 4KEJA 4HR6C 2IWTB 5D61A 1UYPA 3O3QA 4A7ZA 3BB2A 4ENDA 4LO7C 1XG6A 3OGGA 4MLGA 2RQ9A 1RY7A 3BAOA 1AXMA 3C7EA 3U14A 4QALA 4JRAA 1BFBA 4G1RA 4IHZA 3ZXDA 1Z2VA 4D0ZA 3OJVA 3C7HA 4ZOTA 2RG9B 2VUAA 3D60A 2KH2A 3CA0A 1AVUA 4KBBA 1T9FA 3FJEA 2D7RA 1PUMB 3P6IA 3RTIB 3S8KA 2ERMA 4ZFYB 1D0HA 3VUOA 2L5XA 3WO3A 3RWKX 4JP0A 3CA6A 5JOYA 3WO4A 3BA7A 3KF5A 1Y9GA 1FGAA 3R4ZA 3CRIA 3LV4A 1IRPA 4DENA 3JRRA 3WN1A 4EEEB 3PIGA 2MIBA 3AH4A 5BXPA 3FJJA 5GLMA 2P23A 3WINA 4HA2A 3BTAA 2MLLB 4YOLA 2AC1A 2FDBM 1TOOA 4NOVA 3BAGA 1G9BA 3BAHA 4KC8A 4I4UA 4IQPA 4O8PA 1RG8A 4UDJA 4ZFUB 3LEMA 1BFGA 3CU1B 1HWOB 1YI7A 3QEEA 2AFGA 2QYIB 1PZZA 3Q7YA 1S0BA 1YRZA 2MC2A 4IY8A 3IIRA 2BEAA 1OYGA 4QKRA 1ABRB 3O4CA 3WMYA 4I3NA 4I96A 3OM7A 4I4QA 3A23A 1I1BA 4D47A 3BAQA 3LTQA 4UDGA 2HWMA 5FMCA 3R4SA 1V6WA 1FV2A 3K1XA 4DEPA 3UD8A 3OBRA 4MZHA 3OM2A 3OJ2A 3HN1A 1Q04A 3CAHA 2VU9A 3TC2A 1YYNA 1ISWA 3FJKA 3D61A 4EKXB 3JUTA 1S0DA 2ZR1B 3FJ8A 1DLLA 1AVAC 1Y9MA 3I2AA 1TFMB 1G9CA 4A7YA 3WPVA 5AY9A 1AVWB 1DZDA 2Y9GA 4LO3C 3N7KA 3QZ4A 1AF9A 3VSZA 2QQWA 5EHAA 1OQLB 3O4DA 2F2FC 1ISVA 4J2YA 4LO2C 5G00A 4KMIA 3UGFA 3WPUA 5FZUA 3RMYA 3RSJA 3VSSA 3F62B 2E4MA 2Y9WC 1T4QA 2FFUA 1JT4A 1TP0A 4AK5A 4QBVA 5BP5A 2VSEA 4H04A 4IY9A 5BXSA 1XHBA 3V79C 1BLDA 1JQZA 1EPWA 2FO1A 1RZOB 5FZYA 2B4WA 1EYLA 3AKHA 3I29B 3OGFA 1YF8B 4OW4A 2KI4A 3ZC8A 3BX1C 3H6QA 1G82A 2M49A 1HWNB 5JLVA 2J3PA 3IM7A 3BYKA 2DRZA 5DZUA 1FWUA 4Q9GA 3QEDA 2VDTA 4JPZA 3W9TA 4IZXA 4O8OA 3AKGA 5C2MA 3NBEA 5AYCA 3P6JA 1EVTA 2I1BA 1K5VA 2VSAA 3QC2A 3PHZA 4KC3A 1TTUA 1S0FA 4I2SA 4LO1A 3SC7X 4JAWA 1W18A 5JOXA 1GGPB 4JQ0A 2P39A 2WRYA 1CE7B 4IONA 3BRGC 2LIEA 1ITBA 3BYJA 2UUSA 3LLPA 1IRAX 2BFHA 3WMUA 1DFCA 3QYDA 3AZVA 1GYEB 4XFUA 4LO0A 4J2SA 4LO3A 1JT3A 3KF3A 1AFCA 4LO8B 3V0AB 1SR4A 5A7VA 4I6IA 2AEYA 2YFTA 3N7MA 3T8SA 1GYDB 3C7OA 4UY4A 5HPZA 3V0BA 4QC4A 1DZCA 1UV4A 4EQVA 1G9AA 3VEQA 1L2HA 4L4HA 5B6SA 2X2TA 3N7JA 5BXRA 4Q91A 6I1BA 3O5WB 1R8NA 2Q3NB 3E8LC 4MZFB 1E0OA 4AN7B 1YTOA 3CRHA 3KSTA 4USOA 4P0LA 2ET2A 3LIHA 5C0PA 3FUQA 4IZEA 1DIWA 4P6AA 4ZA3B 3HBWA 3AKIA 3CA5A 3R4UA 2D23A 2AXMA 1ISZA 3FJCA 3UJ4A 5FK7A 4J2KA 5JOZA 1Z4SA 5B2HA 1MC9A 2KLLA 2AQZA 3KMVA 5GLLA 1WD3A 3P2NA 4TLPA 3PUBA 3N0KA 5EG6C 4X3AA 1Y7BA 2RSTA 2XQRA 4H9WA 3CU9A 5D63A 3OM4A 1RMLA 4F34A 4EB2B 3ZXLA 1IHKA 1VKDA 1W2TA 3BYNA 5F90A 3FJAA 4KEIA 3A21A 1CVSA 3LDRA 3WN0A 2YUGA 5FZZA 3ILAA 4GP0A 3H6SE 2D22A 1BA7A 3WO2A 5E24E 2AEZA 2EXKA 3D5YA 4OEEA 1M2TB 4G9NA 8I1BA 1ST8A 3UGGA 3H6RA 2ADDA 3BAVA 2FGFA 3CQAA 5GLPA 1FV3A 4I4XA 2K8RA 2NVHA 3PG0A 2HW9A 1IJTA 5JMCA 3I2XA 4I1EA 1V6XA 1W3AA 2YFSA 2KKIA 1BASA 2OXBA 4XKIA 5I1BA 1S0CA 3VSFA 2Q9XA 3C7GA 1PUUB 2Y9XE 1VCLA 1ILR1 4G6JA 5GLQA 1FN0A 4OWJA 3VSRA 4FFFA 1XZZA 3IM6A 4Z8SB 3ZC9A 4N1IA 2QQVA 3BA5A 3POKA 3WMVA 4COTA 4ZLBB 5DSSB 1XYFA 1FQ9A 1PT2A 5BQUC 3O4BA 2X8SA 4UDIA 3FJBA 3CRGA 9ILBA 1IOBA 3ZXKA 1WL7A 1M16A 5F8WA 3WASA 3AH2A 4OEFA 3UDAA 3HALA 3Q7XA 2AAIB 4FGFA 3TAWA 4I7IA 2D20A 2VLCA 1TL2A 4R6UB 1TIEA 3ZXJA 3O44A 4CJMA 1F31A 2NM1A 3C7FA 2WBCA 3NBCA 4X38A 1Y4WA 4J2XA 5GLNA 5FNXA 4N4BA 1R8OA 4EFPA 5GAQA 3WN2A 2DS0A 3NBDA 2GZBA 2ZQNA 4I1BA 2K43A 4JKXB 31BIA 3C9ZA 4O8NA 5GLRA 3UJ0A 1EV2A 4I4VA 4GOYA 4D8HA 3BRDA 1QQKA 3VT2A 4P0JA 4QD2B 1YIFA 5AYEA 1W3GA 2F2FA 4USPA 4LO2A 4IYBA 3S8JA 3NBNA 5FMBA 3D7WB 2EXIA 3IM5A 5B6TA 2HZ9A 4ONZA 1NZKA 3SNVA 4H75A 3R67A 4UDKA 1ISXA 2NTDA 2ZQOA 3RMXA 4JKQA 3VT0A 4KCAA 3FGMA 2F8XC 4MZGB 4FFIA 3B9UA 4QBCA 2EXJA 4AK6A 1BLAA 5F8YA 1IT0A 3OM5A 4Z9WB 4FFGA 1JLYA 3A07A 3LIGA 5ANNA 1IILA 3N7LA 1N4KA 4OUJA 5BOWA 4QO3A 3P53A 3D5ZA 1YBIA 2KI6B 3VT1A 3NQHA 2IHOA 1ONKB 4I8MA 1FMZA 1HIBA 2Z49A 4KEKA 4OWLA 1QQLA 3A22A 2DRYA 1KNMA 1S0EA 3FJIA 3UD7A 5A7VB 5FKBA 1DFQA 3QEFA 1WBCA 4A7KA 3LF7A 4GAFA 5FNWA 3V0BB 2YFRA 3VWCA 5BVPI 2VXTI 3BYLA 1Q1UA 4N2ZA 2D43A 1K5UA 1HCDA 1S0LA 7I1BA 2QQUA 3UGHA 5EC5A 4N2RA 4EFQA 1DJSB 1DQGA 1GYHA 5GLOA 2D1ZA 1ISYA 1JT7A 1PC8B 41BIA 4KCBA 1DQOA 4HJJA 2ESUA 2E4MC 3AJ5A 4G6MA 4ZKTB 4D0TA 1HWMB 3FJ9A 5BP5C 4I4RA 3PMEA 4EFRA 4II0A 1FMMS 5FIXA
chains in the Genus database with same CATH topology
2D24A 3BADA 1HCEA 4GP3A 4QKSA 3MPPG 1J0SA 4KC7A 4PC4A 2VXRA 5DVHA 1WD4A 3WA1A 4U6DA 3FFZA 4QD2C 4I37A 4QQSA 4U6BA 3FJHA 1V6VA 4ZFWB 5A8CA 2ADEA 1QXMA 3AZWA 2X8TA 5A8DA 1TWMA 3CA1A 4G9MA 2X2SA 3EF2A 3HOMA 3R4YA 2NS2A 3U75A 4F83A 3CA3A 5GLKA 4ISQA 2HWAA 3Q7WA 5F8SA 2D7IA 1JY0A 2D44A 4UDKE 5JOWA 5DUYA 1WBAA 3WMZA 3O4AA 3OJMA 4LO1C 3BAUA 1JLXA 1AVXB 1Z0HA 4LO7B 3FUOA 2NYYA 4Q9PA 4ZBVB 3RTJB 3O49A 1HKNA 4XFTA 3H6RB 5FLWA 5FMDA 4AK7A 3LDKA 4LO0C 4J23B 4OWKA 4I4SA 1V6UA 1SR4C 5BXTA 3WPZA 3AJ6A 4I0YA 4DCKC 3QR5A 4X39A 2FFVA 1PWAA 1YXWA 3FJDA 4FVVA 1JT5A 1Q03A 1I1EA 4XFSA 4AN6A 4I4YA 3BA4A 1P63A 3BRFA 3CA4A 3WAUA 4PVIA 4I4PA 2XOAA 3O4OA 5FKCA 3AH1A 3MALA 3HSMA 3V0AA 1BFFA 2GO2A 3OBTA 4PVAA 4ISRA 1BFCA 2R9KB 4P0KA 1NUNA 4X37A 3HMYA 3IAGC 3WPYA 1JTCA 4GOVA 4I4OA 3ZX7A 1A8DA 21BIA 3UD9A 1TWEA 1SZ6B 4WBCA 1S0GA 3ZXGA 3OM6A 2DREA 2NZ9A 1UPSA 2K4AB 2Y9FA 3F1RA 4GAIA 2X8FA 3WATA 3WINC 3FJFA 1BARA 1FWVA 1G9DA 3C2UA 1W3FA 2LIQA 4FFHA 1MD6A 5D62A 3PIJA 5FK8A 3NJ5A 1II4A 2BEBA 4L4IA 5BQUA 2Z48A 4ZGRB 5AYDA 2EXHA 1HWPB 4OEGA 2NP0A 3K1UA 2QN4A 3AKFA 3LFIA 4KEJA 4HR6C 2IWTB 5D61A 1UYPA 3O3QA 4A7ZA 3BB2A 4ENDA 4LO7C 1XG6A 3OGGA 4MLGA 2RQ9A 1RY7A 3BAOA 1AXMA 3C7EA 3U14A 4QALA 4JRAA 1BFBA 4G1RA 4IHZA 3ZXDA 1Z2VA 4D0ZA 3OJVA 3C7HA 4ZOTA 2RG9B 2VUAA 3D60A 2KH2A 3CA0A 1AVUA 4KBBA 1T9FA 3FJEA 2D7RA 1PUMB 3P6IA 3RTIB 3S8KA 2ERMA 4ZFYB 1D0HA 3VUOA 2L5XA 3WO3A 3RWKX 4JP0A 3CA6A 5JOYA 3WO4A 3BA7A 3KF5A 1Y9GA 1FGAA 3R4ZA 3CRIA 3LV4A 1IRPA 4DENA 3JRRA 3WN1A 4EEEB 3PIGA 2MIBA 3AH4A 5BXPA 3FJJA 5GLMA 2P23A 3WINA 4HA2A 3BTAA 2MLLB 4YOLA 2AC1A 2FDBM 1TOOA 4NOVA 3BAGA 1G9BA 3BAHA 4KC8A 4I4UA 4IQPA 4O8PA 1RG8A 4UDJA 4ZFUB 3LEMA 1BFGA 3CU1B 1HWOB 1YI7A 3QEEA 2AFGA 2QYIB 1PZZA 3Q7YA 1S0BA 1YRZA 2MC2A 4IY8A 3IIRA 2BEAA 1OYGA 4QKRA 1ABRB 3O4CA 3WMYA 4I3NA 4I96A 3OM7A 4I4QA 3A23A 1I1BA 4D47A 3BAQA 3LTQA 4UDGA 2HWMA 5FMCA 3R4SA 1V6WA 1FV2A 3K1XA 4DEPA 3UD8A 3OBRA 4MZHA 3OM2A 3OJ2A 3HN1A 1Q04A 3CAHA 2VU9A 3TC2A 1YYNA 1ISWA 3FJKA 3D61A 4EKXB 3JUTA 1S0DA 2ZR1B 3FJ8A 1DLLA 1AVAC 1Y9MA 3I2AA 1TFMB 1G9CA 4A7YA 3WPVA 5AY9A 1AVWB 1DZDA 2Y9GA 4LO3C 3N7KA 3QZ4A 1AF9A 3VSZA 2QQWA 5EHAA 1OQLB 3O4DA 2F2FC 1ISVA 4J2YA 4LO2C 5G00A 4KMIA 3UGFA 3WPUA 5FZUA 3RMYA 3RSJA 3VSSA 3F62B 2E4MA 2Y9WC 1T4QA 2FFUA 1JT4A 1TP0A 4AK5A 4QBVA 5BP5A 2VSEA 4H04A 4IY9A 5BXSA 1XHBA 3V79C 1BLDA 1JQZA 1EPWA 2FO1A 1RZOB 5FZYA 2B4WA 1EYLA 3AKHA 3I29B 3OGFA 1YF8B 4OW4A 2KI4A 3ZC8A 3BX1C 3H6QA 1G82A 2M49A 1HWNB 5JLVA 2J3PA 3IM7A 3BYKA 2DRZA 5DZUA 1FWUA 4Q9GA 3QEDA 2VDTA 4JPZA 3W9TA 4IZXA 4O8OA 3AKGA 3NBEA 5AYCA 3P6JA 1EVTA 2I1BA 1K5VA 2VSAA 3QC2A 3PHZA 4KC3A 1TTUA 1S0FA 4I2SA 4LO1A 3SC7X 4JAWA 1W18A 5JOXA 1GGPB 4JQ0A 2P39A 2WRYA 1CE7B 4IONA 3BRGC 2LIEA 1ITBA 3BYJA 2UUSA 3LLPA 1IRAX 2BFHA 3WMUA 1DFCA 3QYDA 3AZVA 1GYEB 4XFUA 4LO0A 4J2SA 4LO3A 1JT3A 3KF3A 1AFCA 4LO8B 3V0AB 1SR4A 5A7VA 4I6IA 2AEYA 2YFTA 3N7MA 3T8SA 1GYDB 3C7OA 4UY4A 5HPZA 3V0BA 4QC4A 1DZCA 1UV4A 4EQVA 1G9AA 3VEQA 1L2HA 4L4HA 5B6SA 2X2TA 3N7JA 5BXRA 4Q91A 6I1BA 3O5WB 1R8NA 2Q3NB 3E8LC 4MZFB 1E0OA 4AN7B 1YTOA 3CRHA 3KSTA 4USOA 4P0LA 2ET2A 3LIHA 5C0PA 3FUQA 4IZEA 1DIWA 4P6AA 4ZA3B 3HBWA 3AKIA 3CA5A 3R4UA 2D23A 2AXMA 1ISZA 3FJCA 3UJ4A 5FK7A 4J2KA 5JOZA 1Z4SA 5B2HA 1MC9A 2KLLA 2AQZA 3KMVA 5GLLA 1WD3A 3P2NA 4TLPA 3PUBA 3N0KA 5EG6C 4X3AA 1Y7BA 2RSTA 2XQRA 4H9WA 3CU9A 5D63A 3OM4A 1RMLA 4F34A 4EB2B 3ZXLA 1IHKA 1VKDA 1W2TA 3BYNA 5F90A 3FJAA 4KEIA 3A21A 1CVSA 3LDRA 3WN0A 2YUGA 5FZZA 3ILAA 4GP0A 3H6SE 2D22A 1BA7A 3WO2A 5E24E 2AEZA 2EXKA 3D5YA 4OEEA 1M2TB 4G9NA 8I1BA 1ST8A 3UGGA 3H6RA 2ADDA 3BAVA 2FGFA 3CQAA 5GLPA 1FV3A 4I4XA 2K8RA 2NVHA 3PG0A 2HW9A 1IJTA 5JMCA 3I2XA 4I1EA 1V6XA 1W3AA 2YFSA 2KKIA 1BASA 2OXBA 4XKIA 5I1BA 1S0CA 3VSFA 2Q9XA 3C7GA 1PUUB 2Y9XE 1VCLA 1ILR1 4G6JA 5GLQA 1FN0A 4OWJA 3VSRA 4FFFA 1XZZA 3IM6A 4Z8SB 3ZC9A 4N1IA 2QQVA 3BA5A 3POKA 3WMVA 4COTA 4ZLBB 5DSSB 1XYFA 1FQ9A 1PT2A 5BQUC 3O4BA 2X8SA 4UDIA 3FJBA 3CRGA 9ILBA 1IOBA 3ZXKA 1WL7A 1M16A 5F8WA 3WASA 3AH2A 4OEFA 3UDAA 3HALA 3Q7XA 2AAIB 4FGFA 3TAWA 4I7IA 2D20A 2VLCA 4R6UB 1TIEA 3ZXJA 3O44A 4CJMA 1F31A 2NM1A 3C7FA 2WBCA 3NBCA 4X38A 1Y4WA 4J2XA 5GLNA 5FNXA 4N4BA 1R8OA 4EFPA 5GAQA 3WN2A 2DS0A 3NBDA 2GZBA 2ZQNA 4I1BA 2K43A 4JKXB 31BIA 3C9ZA 4O8NA 5GLRA 3UJ0A 1EV2A 4I4VA 4GOYA 4D8HA 3BRDA 1QQKA 3VT2A 4P0JA 4QD2B 1YIFA 5AYEA 1W3GA 2F2FA 4USPA 4LO2A 4IYBA 3S8JA 3NBNA 5FMBA 3D7WB 2EXIA 3IM5A 5B6TA 2HZ9A 4ONZA 1NZKA 3SNVA 4H75A 3R67A 4UDKA 1ISXA 2NTDA 2ZQOA 3RMXA 4JKQA 3VT0A 4KCAA 3FGMA 2F8XC 4MZGB 4FFIA 3B9UA 4QBCA 2EXJA 4AK6A 1BLAA 5F8YA 1IT0A 3OM5A 4Z9WB 4FFGA 1JLYA 3A07A 3LIGA 5ANNA 1IILA 3N7LA 1N4KA 4OUJA 5BOWA 4QO3A 3P53A 3D5ZA 1YBIA 2KI6B 3VT1A 3NQHA 2IHOA 1ONKB 4I8MA 1FMZA 1HIBA 2Z49A 4KEKA 4OWLA 1QQLA 3A22A 2DRYA 1KNMA 1S0EA 3FJIA 3UD7A 5A7VB 5FKBA 1DFQA 3QEFA 1WBCA 4A7KA 3LF7A 4GAFA 5FNWA 3V0BB 2YFRA 3VWCA 5BVPI 2VXTI 3BYLA 1Q1UA 4N2ZA 2D43A 1K5UA 1HCDA 1S0LA 7I1BA 2QQUA 3UGHA 5EC5A 4N2RA 4EFQA 1DJSB 1DQGA 1GYHA 5GLOA 2D1ZA 1ISYA 1JT7A 1PC8B 41BIA 4KCBA 1DQOA 4HJJA 2ESUA 2E4MC 3AJ5A 4G6MA 4ZKTB 4D0TA 1HWMB 3FJ9A 5BP5C 4I4RA 3PMEA 4EFRA 4II0A 1FMMS 5FIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D24 A;  3BAD A;  1HCE A;  4GP3 A;  4QKS A;  3MPP G;  1J0S A;  4KC7 A;  4PC4 A;  2VXR A;  5DVH A;  1WD4 A;  3WA1 A;  4U6D A;  3FFZ A;  4QD2 C;  4I37 A;  4QQS A;  4U6B A;  3FJH A;  1V6V A;  4ZFW B;  5A8C A;  2ADE A;  1QXM A;  3AZW A;  2X8T A;  5A8D A;  1TWM A;  3CA1 A;  4G9M A;  2X2S A;  3EF2 A;  3HOM A;  3R4Y A;  3U75 A;  4F83 A;  3CA3 A;  5GLK A;  4ISQ A;  2HWA A;  3Q7W A;  5F8S A;  2D7I A;  1JY0 A;  2D44 A;  4UDK E;  5JOW A;  5DUY A;  1WBA A;  3WMZ A;  3O4A A;  3OJM A;  4LO1 C;  3BAU A;  1JLX A;  1AVX B;  1Z0H A;  4LO7 B;  3FUO A;  2NYY A;  4Q9P A;  4ZBV B;  3RTJ B;  3O49 A;  1HKN A;  4XFT A;  3H6R B;  5FLW A;  5FMD A;  4AK7 A;  3LDK A;  4LO0 C;  4J23 B;  4OWK A;  4I4S A;  1V6U A;  1SR4 C;  5BXT A;  3WPZ A;  3AJ6 A;  4I0Y A;  4DCK C;  3QR5 A;  4X39 A;  2FFV A;  1PWA A;  1YXW A;  3FJD A;  4FVV A;  1JT5 A;  1Q03 A;  1I1E A;  4XFS A;  4AN6 A;  4I4Y A;  3BA4 A;  1P63 A;  3BRF A;  3CA4 A;  3WAU A;  4PVI A;  4I4P A;  2XOA A;  3O4O A;  5FKC A;  3AH1 A;  3MAL A;  3HSM A;  3V0A A;  1BFF A;  2GO2 A;  3OBT A;  4PVA A;  4ISR A;  1BFC A;  2R9K B;  4P0K A;  1NUN A;  4X37 A;  3HMY A;  3IAG C;  3WPY A;  1JTC A;  4GOV A;  4I4O A;  3ZX7 A;  1A8D A;  21BI A;  3UD9 A;  1TWE A;  1SZ6 B;  4WBC A;  1S0G A;  3ZXG A;  3OM6 A;  2DRE A;  2NZ9 A;  1UPS A;  2K4A B;  2Y9F A;  3F1R A;  4GAI A;  2X8F A;  3WAT A;  3WIN C;  3FJF A;  1BAR A;  1FWV A;  1G9D A;  3C2U A;  1W3F A;  2LIQ A;  4FFH A;  1MD6 A;  5D62 A;  3PIJ A;  5FK8 A;  3NJ5 A;  1II4 A;  2BEB A;  4L4I A;  5BQU A;  2Z48 A;  4ZGR B;  5AYD A;  2EXH A;  1HWP B;  4OEG A;  2NP0 A;  3K1U A;  2QN4 A;  3AKF A;  3LFI A;  4KEJ A;  4HR6 C;  2IWT B;  5D61 A;  1UYP A;  3O3Q A;  4A7Z A;  3BB2 A;  4END A;  4LO7 C;  1XG6 A;  3OGG A;  4MLG A;  2RQ9 A;  1RY7 A;  3BAO A;  1AXM A;  3C7E A;  3U14 A;  4QAL A;  4JRA A;  1BFB A;  4G1R A;  4IHZ A;  3ZXD A;  1Z2V A;  4D0Z A;  3OJV A;  3C7H A;  4ZOT A;  2RG9 B;  2VUA A;  3D60 A;  2KH2 A;  3CA0 A;  1AVU A;  4KBB A;  1T9F A;  3FJE A;  2D7R A;  1PUM B;  3P6I A;  3RTI B;  3S8K A;  2ERM A;  4ZFY B;  1D0H A;  3VUO A;  2L5X A;  3WO3 A;  3RWK X;  4JP0 A;  3CA6 A;  5JOY A;  3WO4 A;  3BA7 A;  3KF5 A;  1Y9G A;  1FGA A;  3R4Z A;  3CRI A;  3LV4 A;  1IRP A;  4DEN A;  3JRR A;  3WN1 A;  4EEE B;  3PIG A;  2MIB A;  3AH4 A;  5BXP A;  3FJJ A;  5GLM A;  2P23 A;  3WIN A;  4HA2 A;  3BTA A;  2MLL B;  4YOL A;  2AC1 A;  2FDB M;  1TOO A;  4NOV A;  3BAG A;  1G9B A;  3BAH A;  4KC8 A;  4I4U A;  4IQP A;  4O8P A;  1RG8 A;  4UDJ A;  4ZFU B;  3LEM A;  1BFG A;  3CU1 B;  1HWO B;  1YI7 A;  3QEE A;  2AFG A;  2QYI B;  1PZZ A;  3Q7Y A;  1S0B A;  1YRZ A;  2MC2 A;  4IY8 A;  3IIR A;  2BEA A;  1OYG A;  4QKR A;  1ABR B;  3O4C A;  3WMY A;  4I3N A;  4I96 A;  3OM7 A;  4I4Q A;  3A23 A;  1I1B A;  4D47 A;  3BAQ A;  3LTQ A;  4UDG A;  2HWM A;  5FMC A;  3R4S A;  1V6W A;  1FV2 A;  3K1X A;  4DEP A;  3UD8 A;  3OBR A;  3OM2 A;  3OJ2 A;  3HN1 A;  1Q04 A;  3CAH A;  2VU9 A;  3TC2 A;  1YYN A;  1ISW A;  3FJK A;  3D61 A;  4EKX B;  3JUT A;  1S0D A;  2ZR1 B;  3FJ8 A;  1DLL A;  1AVA C;  1Y9M A;  3I2A A;  1TFM B;  1G9C A;  4A7Y A;  3WPV A;  5AY9 A;  1AVW B;  1DZD A;  2Y9G A;  4LO3 C;  3N7K A;  3QZ4 A;  1AF9 A;  3VSZ A;  2QQW A;  5EHA A;  1OQL B;  3O4D A;  2F2F C;  1ISV A;  4J2Y A;  4LO2 C;  5G00 A;  4KMI A;  3UGF A;  3WPU A;  5FZU A;  3RMY A;  3RSJ A;  3VSS A;  3F62 B;  2E4M A;  2Y9W C;  1T4Q A;  2FFU A;  1JT4 A;  1TP0 A;  4AK5 A;  4QBV A;  5BP5 A;  2VSE A;  4H04 A;  4IY9 A;  5BXS A;  1XHB A;  3V79 C;  1BLD A;  1JQZ A;  1EPW A;  2FO1 A;  1RZO B;  5FZY A;  2B4W A;  1EYL A;  3AKH A;  3I29 B;  3OGF A;  1YF8 B;  4OW4 A;  2KI4 A;  3ZC8 A;  3BX1 C;  3H6Q A;  1G82 A;  2M49 A;  1HWN B;  5JLV A;  2J3P A;  3IM7 A;  3BYK A;  2DRZ A;  5DZU A;  1FWU A;  4Q9G A;  3QED A;  2VDT A;  4JPZ A;  3W9T A;  4IZX A;  4O8O A;  3AKG A;  3NBE A;  5AYC A;  3P6J A;  1EVT A;  2I1B A;  1K5V A;  2VSA A;  3QC2 A;  3PHZ A;  4KC3 A;  1TTU A;  1S0F A;  4I2S A;  4LO1 A;  3SC7 X;  4JAW A;  1W18 A;  5JOX A;  1GGP B;  4JQ0 A;  2P39 A;  2WRY A;  1CE7 B;  4ION A;  3BRG C;  2LIE A;  1ITB A;  3BYJ A;  2UUS A;  3LLP A;  1IRA X;  2BFH A;  3WMU A;  1DFC A;  3QYD A;  3AZV A;  1GYE B;  4XFU A;  4LO0 A;  4J2S A;  4LO3 A;  1JT3 A;  3KF3 A;  1AFC A;  4LO8 B;  3V0A B;  1SR4 A;  5A7V A;  4I6I A;  2AEY A;  2YFT A;  3N7M A;  3T8S A;  1GYD B;  3C7O A;  5HPZ A;  3V0B A;  4QC4 A;  1DZC A;  1UV4 A;  4EQV A;  1G9A A;  3VEQ A;  1L2H A;  4L4H A;  5B6S A;  2X2T A;  3N7J A;  5BXR A;  4Q91 A;  6I1B A;  3O5W B;  1R8N A;  2Q3N B;  3E8L C;  1E0O A;  4AN7 B;  1YTO A;  3CRH A;  3KST A;  4USO A;  4P0L A;  2ET2 A;  3LIH A;  5C0P A;  3FUQ A;  4IZE A;  1DIW A;  4P6A A;  4ZA3 B;  3HBW A;  3AKI A;  3CA5 A;  3R4U A;  2D23 A;  2AXM A;  1ISZ A;  3FJC A;  3UJ4 A;  5FK7 A;  4J2K A;  5JOZ A;  1Z4S A;  5B2H A;  1MC9 A;  2KLL A;  2AQZ A;  3KMV A;  5GLL A;  1WD3 A;  3P2N A;  4TLP A;  3PUB A;  3N0K A;  5EG6 C;  4X3A A;  1Y7B A;  2RST A;  2XQR A;  4H9W A;  3CU9 A;  5D63 A;  3OM4 A;  1RML A;  4F34 A;  4EB2 B;  3ZXL A;  1IHK A;  1VKD A;  1W2T A;  3BYN A;  5F90 A;  3FJA A;  4KEI A;  3A21 A;  1CVS A;  3LDR A;  3WN0 A;  2YUG A;  5FZZ A;  3ILA A;  4GP0 A;  3H6S E;  2D22 A;  1BA7 A;  3WO2 A;  5E24 E;  2AEZ A;  2EXK A;  3D5Y A;  4OEE A;  1M2T B;  4G9N A;  8I1B A;  1ST8 A;  3UGG A;  3H6R A;  2ADD A;  3BAV A;  2FGF A;  3CQA A;  5GLP A;  1FV3 A;  4I4X A;  2K8R A;  2NVH A;  3PG0 A;  2HW9 A;  1IJT A;  5JMC A;  3I2X A;  4I1E A;  1V6X A;  1W3A A;  2YFS A;  2KKI A;  1BAS A;  2OXB A;  4XKI A;  5I1B A;  1S0C A;  3VSF A;  2Q9X A;  3C7G A;  1PUU B;  2Y9X E;  1VCL A;  1ILR 1;  4G6J A;  5GLQ A;  1FN0 A;  4OWJ A;  3VSR A;  4FFF A;  1XZZ A;  3IM6 A;  4Z8S B;  3ZC9 A;  4N1I A;  2QQV A;  3BA5 A;  3POK A;  3WMV A;  4COT A;  4ZLB B;  5DSS B;  1XYF A;  1FQ9 A;  1PT2 A;  5BQU C;  3O4B A;  2X8S A;  4UDI A;  3FJB A;  3CRG A;  9ILB A;  1IOB A;  3ZXK A;  1WL7 A;  1M16 A;  5F8W A;  3WAS A;  3AH2 A;  4OEF A;  3UDA A;  3HAL A;  3Q7X A;  2AAI B;  4FGF A;  3TAW A;  4I7I A;  2D20 A;  2VLC A;  4R6U B;  1TIE A;  3ZXJ A;  3O44 A;  4CJM A;  1F31 A;  2NM1 A;  3C7F A;  2WBC A;  3NBC A;  4X38 A;  1Y4W A;  4J2X A;  5GLN A;  5FNX A;  4N4B A;  1R8O A;  4EFP A;  5GAQ A;  3WN2 A;  2DS0 A;  3NBD A;  2GZB A;  2ZQN A;  4I1B A;  2K43 A;  4JKX B;  31BI A;  3C9Z A;  4O8N A;  5GLR A;  3UJ0 A;  1EV2 A;  4I4V A;  4GOY A;  4D8H A;  3BRD A;  1QQK A;  3VT2 A;  4P0J A;  4QD2 B;  1YIF A;  5AYE A;  1W3G A;  2F2F A;  4USP A;  4LO2 A;  4IYB A;  3S8J A;  3NBN A;  5FMB A;  3D7W B;  2EXI A;  3IM5 A;  5B6T A;  2HZ9 A;  4ONZ A;  1NZK A;  3SNV A;  3R67 A;  4UDK A;  1ISX A;  2NTD A;  2ZQO A;  3RMX A;  4JKQ A;  3VT0 A;  4KCA A;  3FGM A;  2F8X C;  4FFI A;  3B9U A;  4QBC A;  2EXJ A;  4AK6 A;  1BLA A;  5F8Y A;  1IT0 A;  3OM5 A;  4Z9W B;  4FFG A;  1JLY A;  3A07 A;  3LIG A;  5ANN A;  1IIL A;  3N7L A;  1N4K A;  4OUJ A;  5BOW A;  4QO3 A;  3P53 A;  3D5Z A;  1YBI A;  2KI6 B;  3VT1 A;  3NQH A;  2IHO A;  1ONK B;  4I8M A;  1FMZ A;  1HIB A;  2Z49 A;  4KEK A;  4OWL A;  1QQL A;  3A22 A;  2DRY A;  1KNM A;  1S0E A;  3FJI A;  3UD7 A;  5A7V B;  5FKB A;  1DFQ A;  3QEF A;  1WBC A;  4A7K A;  3LF7 A;  4GAF A;  5FNW A;  3V0B B;  2YFR A;  3VWC A;  5BVP I;  2VXT I;  3BYL A;  1Q1U A;  4N2Z A;  2D43 A;  1K5U A;  1HCD A;  1S0L A;  7I1B A;  2QQU A;  3UGH A;  5EC5 A;  4N2R A;  4EFQ A;  1DJS B;  1DQG A;  1GYH A;  5GLO A;  2D1Z A;  1ISY A;  1JT7 A;  1PC8 B;  41BI A;  4KCB A;  1DQO A;  4HJJ A;  2ESU A;  2E4M C;  3AJ5 A;  4G6M A;  4ZKT B;  4D0T A;  1HWM B;  3FJ9 A;  5BP5 C;  4I4R A;  3PME A;  4EFR A;  4II0 A;  1FMM S;  5FIX A; 
#chains in the Genus database with same CATH topology
 2D24 A;  3BAD A;  1HCE A;  4GP3 A;  4QKS A;  3MPP G;  1J0S A;  4KC7 A;  4PC4 A;  2VXR A;  5DVH A;  1WD4 A;  3WA1 A;  4U6D A;  3FFZ A;  4QD2 C;  4I37 A;  4QQS A;  4U6B A;  3FJH A;  1V6V A;  4ZFW B;  5A8C A;  2ADE A;  1QXM A;  3AZW A;  2X8T A;  5A8D A;  1TWM A;  3CA1 A;  4G9M A;  2X2S A;  3EF2 A;  3HOM A;  3R4Y A;  2NS2 A;  3U75 A;  4F83 A;  3CA3 A;  5GLK A;  4ISQ A;  2HWA A;  3Q7W A;  5F8S A;  2D7I A;  1JY0 A;  2D44 A;  4UDK E;  5JOW A;  5DUY A;  1WBA A;  3WMZ A;  3O4A A;  3OJM A;  4LO1 C;  3BAU A;  1JLX A;  1AVX B;  1Z0H A;  4LO7 B;  3FUO A;  2NYY A;  4Q9P A;  4ZBV B;  3RTJ B;  3O49 A;  1HKN A;  4XFT A;  3H6R B;  5FLW A;  5FMD A;  4AK7 A;  3LDK A;  4LO0 C;  4J23 B;  4OWK A;  4I4S A;  1V6U A;  1SR4 C;  5BXT A;  3WPZ A;  3AJ6 A;  4I0Y A;  4DCK C;  3QR5 A;  4X39 A;  2FFV A;  1PWA A;  1YXW A;  3FJD A;  4FVV A;  1JT5 A;  1Q03 A;  1I1E A;  4XFS A;  4AN6 A;  4I4Y A;  3BA4 A;  1P63 A;  3BRF A;  3CA4 A;  3WAU A;  4PVI A;  4I4P A;  2XOA A;  3O4O A;  5FKC A;  3AH1 A;  3MAL A;  3HSM A;  3V0A A;  1BFF A;  2GO2 A;  3OBT A;  4PVA A;  4ISR A;  1BFC A;  2R9K B;  4P0K A;  1NUN A;  4X37 A;  3HMY A;  3IAG C;  3WPY A;  1JTC A;  4GOV A;  4I4O A;  3ZX7 A;  1A8D A;  21BI A;  3UD9 A;  1TWE A;  1SZ6 B;  4WBC A;  1S0G A;  3ZXG A;  3OM6 A;  2DRE A;  2NZ9 A;  1UPS A;  2K4A B;  2Y9F A;  3F1R A;  4GAI A;  2X8F A;  3WAT A;  3WIN C;  3FJF A;  1BAR A;  1FWV A;  1G9D A;  3C2U A;  1W3F A;  2LIQ A;  4FFH A;  1MD6 A;  5D62 A;  3PIJ A;  5FK8 A;  3NJ5 A;  1II4 A;  2BEB A;  4L4I A;  5BQU A;  2Z48 A;  4ZGR B;  5AYD A;  2EXH A;  1HWP B;  4OEG A;  2NP0 A;  3K1U A;  2QN4 A;  3AKF A;  3LFI A;  4KEJ A;  4HR6 C;  2IWT B;  5D61 A;  1UYP A;  3O3Q A;  4A7Z A;  3BB2 A;  4END A;  4LO7 C;  1XG6 A;  3OGG A;  4MLG A;  2RQ9 A;  1RY7 A;  3BAO A;  1AXM A;  3C7E A;  3U14 A;  4QAL A;  4JRA A;  1BFB A;  4G1R A;  4IHZ A;  3ZXD A;  1Z2V A;  4D0Z A;  3OJV A;  3C7H A;  4ZOT A;  2RG9 B;  2VUA A;  3D60 A;  2KH2 A;  3CA0 A;  1AVU A;  4KBB A;  1T9F A;  3FJE A;  2D7R A;  1PUM B;  3P6I A;  3RTI B;  3S8K A;  2ERM A;  4ZFY B;  1D0H A;  3VUO A;  2L5X A;  3WO3 A;  3RWK X;  4JP0 A;  3CA6 A;  5JOY A;  3WO4 A;  3BA7 A;  3KF5 A;  1Y9G A;  1FGA A;  3R4Z A;  3CRI A;  3LV4 A;  1IRP A;  4DEN A;  3JRR A;  3WN1 A;  4EEE B;  3PIG A;  2MIB A;  3AH4 A;  5BXP A;  3FJJ A;  5GLM A;  2P23 A;  3WIN A;  4HA2 A;  3BTA A;  2MLL B;  4YOL A;  2AC1 A;  2FDB M;  1TOO A;  4NOV A;  3BAG A;  1G9B A;  3BAH A;  4KC8 A;  4I4U A;  4IQP A;  4O8P A;  1RG8 A;  4UDJ A;  4ZFU B;  3LEM A;  1BFG A;  3CU1 B;  1HWO B;  1YI7 A;  3QEE A;  2AFG A;  2QYI B;  1PZZ A;  3Q7Y A;  1S0B A;  1YRZ A;  2MC2 A;  4IY8 A;  3IIR A;  2BEA A;  1OYG A;  4QKR A;  1ABR B;  3O4C A;  3WMY A;  4I3N A;  4I96 A;  3OM7 A;  4I4Q A;  3A23 A;  1I1B A;  4D47 A;  3BAQ A;  3LTQ A;  4UDG A;  2HWM A;  5FMC A;  3R4S A;  1V6W A;  1FV2 A;  3K1X A;  4DEP A;  3UD8 A;  3OBR A;  4MZH A;  3OM2 A;  3OJ2 A;  3HN1 A;  1Q04 A;  3CAH A;  2VU9 A;  3TC2 A;  1YYN A;  1ISW A;  3FJK A;  3D61 A;  4EKX B;  3JUT A;  1S0D A;  2ZR1 B;  3FJ8 A;  1DLL A;  1AVA C;  1Y9M A;  3I2A A;  1TFM B;  1G9C A;  4A7Y A;  3WPV A;  5AY9 A;  1AVW B;  1DZD A;  2Y9G A;  4LO3 C;  3N7K A;  3QZ4 A;  1AF9 A;  3VSZ A;  2QQW A;  5EHA A;  1OQL B;  3O4D A;  2F2F C;  1ISV A;  4J2Y A;  4LO2 C;  5G00 A;  4KMI A;  3UGF A;  3WPU A;  5FZU A;  3RMY A;  3RSJ A;  3VSS A;  3F62 B;  2E4M A;  2Y9W C;  1T4Q A;  2FFU A;  1JT4 A;  1TP0 A;  4AK5 A;  4QBV A;  5BP5 A;  2VSE A;  4H04 A;  4IY9 A;  5BXS A;  1XHB A;  3V79 C;  1BLD A;  1JQZ A;  1EPW A;  2FO1 A;  1RZO B;  5FZY A;  2B4W A;  1EYL A;  3AKH A;  3I29 B;  3OGF A;  1YF8 B;  4OW4 A;  2KI4 A;  3ZC8 A;  3BX1 C;  3H6Q A;  1G82 A;  2M49 A;  1HWN B;  5JLV A;  2J3P A;  3IM7 A;  3BYK A;  2DRZ A;  5DZU A;  1FWU A;  4Q9G A;  3QED A;  2VDT A;  4JPZ A;  3W9T A;  4IZX A;  4O8O A;  3AKG A;  5C2M A;  3NBE A;  5AYC A;  3P6J A;  1EVT A;  2I1B A;  1K5V A;  2VSA A;  3QC2 A;  3PHZ A;  4KC3 A;  1TTU A;  1S0F A;  4I2S A;  4LO1 A;  3SC7 X;  4JAW A;  1W18 A;  5JOX A;  1GGP B;  4JQ0 A;  2P39 A;  2WRY A;  1CE7 B;  4ION A;  3BRG C;  2LIE A;  1ITB A;  3BYJ A;  2UUS A;  3LLP A;  1IRA X;  2BFH A;  3WMU A;  1DFC A;  3QYD A;  3AZV A;  1GYE B;  4XFU A;  4LO0 A;  4J2S A;  4LO3 A;  1JT3 A;  3KF3 A;  1AFC A;  4LO8 B;  3V0A B;  1SR4 A;  5A7V A;  4I6I A;  2AEY A;  2YFT A;  3N7M A;  3T8S A;  1GYD B;  3C7O A;  4UY4 A;  5HPZ A;  3V0B A;  4QC4 A;  1DZC A;  1UV4 A;  4EQV A;  1G9A A;  3VEQ A;  1L2H A;  4L4H A;  5B6S A;  2X2T A;  3N7J A;  5BXR A;  4Q91 A;  6I1B A;  3O5W B;  1R8N A;  2Q3N B;  3E8L C;  4MZF B;  1E0O A;  4AN7 B;  1YTO A;  3CRH A;  3KST A;  4USO A;  4P0L A;  2ET2 A;  3LIH A;  5C0P A;  3FUQ A;  4IZE A;  1DIW A;  4P6A A;  4ZA3 B;  3HBW A;  3AKI A;  3CA5 A;  3R4U A;  2D23 A;  2AXM A;  1ISZ A;  3FJC A;  3UJ4 A;  5FK7 A;  4J2K A;  5JOZ A;  1Z4S A;  5B2H A;  1MC9 A;  2KLL A;  2AQZ A;  3KMV A;  5GLL A;  1WD3 A;  3P2N A;  4TLP A;  3PUB A;  3N0K A;  5EG6 C;  4X3A A;  1Y7B A;  2RST A;  2XQR A;  4H9W A;  3CU9 A;  5D63 A;  3OM4 A;  1RML A;  4F34 A;  4EB2 B;  3ZXL A;  1IHK A;  1VKD A;  1W2T A;  3BYN A;  5F90 A;  3FJA A;  4KEI A;  3A21 A;  1CVS A;  3LDR A;  3WN0 A;  2YUG A;  5FZZ A;  3ILA A;  4GP0 A;  3H6S E;  2D22 A;  1BA7 A;  3WO2 A;  5E24 E;  2AEZ A;  2EXK A;  3D5Y A;  4OEE A;  1M2T B;  4G9N A;  8I1B A;  1ST8 A;  3UGG A;  3H6R A;  2ADD A;  3BAV A;  2FGF A;  3CQA A;  5GLP A;  1FV3 A;  4I4X A;  2K8R A;  2NVH A;  3PG0 A;  2HW9 A;  1IJT A;  5JMC A;  3I2X A;  4I1E A;  1V6X A;  1W3A A;  2YFS A;  2KKI A;  1BAS A;  2OXB A;  4XKI A;  5I1B A;  1S0C A;  3VSF A;  2Q9X A;  3C7G A;  1PUU B;  2Y9X E;  1VCL A;  1ILR 1;  4G6J A;  5GLQ A;  1FN0 A;  4OWJ A;  3VSR A;  4FFF A;  1XZZ A;  3IM6 A;  4Z8S B;  3ZC9 A;  4N1I A;  2QQV A;  3BA5 A;  3POK A;  3WMV A;  4COT A;  4ZLB B;  5DSS B;  1XYF A;  1FQ9 A;  1PT2 A;  5BQU C;  3O4B A;  2X8S A;  4UDI A;  3FJB A;  3CRG A;  9ILB A;  1IOB A;  3ZXK A;  1WL7 A;  1M16 A;  5F8W A;  3WAS A;  3AH2 A;  4OEF A;  3UDA A;  3HAL A;  3Q7X A;  2AAI B;  4FGF A;  3TAW A;  4I7I A;  2D20 A;  2VLC A;  1TL2 A;  4R6U B;  1TIE A;  3ZXJ A;  3O44 A;  4CJM A;  1F31 A;  2NM1 A;  3C7F A;  2WBC A;  3NBC A;  4X38 A;  1Y4W A;  4J2X A;  5GLN A;  5FNX A;  4N4B A;  1R8O A;  4EFP A;  5GAQ A;  3WN2 A;  2DS0 A;  3NBD A;  2GZB A;  2ZQN A;  4I1B A;  2K43 A;  4JKX B;  31BI A;  3C9Z A;  4O8N A;  5GLR A;  3UJ0 A;  1EV2 A;  4I4V A;  4GOY A;  4D8H A;  3BRD A;  1QQK A;  3VT2 A;  4P0J A;  4QD2 B;  1YIF A;  5AYE A;  1W3G A;  2F2F A;  4USP A;  4LO2 A;  4IYB A;  3S8J A;  3NBN A;  5FMB A;  3D7W B;  2EXI A;  3IM5 A;  5B6T A;  2HZ9 A;  4ONZ A;  1NZK A;  3SNV A;  4H75 A;  3R67 A;  4UDK A;  1ISX A;  2NTD A;  2ZQO A;  3RMX A;  4JKQ A;  3VT0 A;  4KCA A;  3FGM A;  2F8X C;  4MZG B;  4FFI A;  3B9U A;  4QBC A;  2EXJ A;  4AK6 A;  1BLA A;  5F8Y A;  1IT0 A;  3OM5 A;  4Z9W B;  4FFG A;  1JLY A;  3A07 A;  3LIG A;  5ANN A;  1IIL A;  3N7L A;  1N4K A;  4OUJ A;  5BOW A;  4QO3 A;  3P53 A;  3D5Z A;  1YBI A;  2KI6 B;  3VT1 A;  3NQH A;  2IHO A;  1ONK B;  4I8M A;  1FMZ A;  1HIB A;  2Z49 A;  4KEK A;  4OWL A;  1QQL A;  3A22 A;  2DRY A;  1KNM A;  1S0E A;  3FJI A;  3UD7 A;  5A7V B;  5FKB A;  1DFQ A;  3QEF A;  1WBC A;  4A7K A;  3LF7 A;  4GAF A;  5FNW A;  3V0B B;  2YFR A;  3VWC A;  5BVP I;  2VXT I;  3BYL A;  1Q1U A;  4N2Z A;  2D43 A;  1K5U A;  1HCD A;  1S0L A;  7I1B A;  2QQU A;  3UGH A;  5EC5 A;  4N2R A;  4EFQ A;  1DJS B;  1DQG A;  1GYH A;  5GLO A;  2D1Z A;  1ISY A;  1JT7 A;  1PC8 B;  41BI A;  4KCB A;  1DQO A;  4HJJ A;  2ESU A;  2E4M C;  3AJ5 A;  4G6M A;  4ZKT B;  4D0T A;  1HWM B;  3FJ9 A;  5BP5 C;  4I4R A;  3PME A;  4EFR A;  4II0 A;  1FMM S;  5FIX A; 
#chains in the Genus database with same CATH homology
 2D24 A;  3BAD A;  1HCE A;  4GP3 A;  4QKS A;  3MPP G;  1J0S A;  4KC7 A;  4PC4 A;  2VXR A;  5DVH A;  1WD4 A;  3WA1 A;  4U6D A;  3FFZ A;  4QD2 C;  4I37 A;  4QQS A;  4U6B A;  3FJH A;  1V6V A;  4ZFW B;  5A8C A;  2ADE A;  1QXM A;  3AZW A;  2X8T A;  5A8D A;  1TWM A;  3CA1 A;  4G9M A;  2X2S A;  3EF2 A;  3HOM A;  3R4Y A;  2NS2 A;  3U75 A;  4F83 A;  3CA3 A;  5GLK A;  4ISQ A;  2HWA A;  3Q7W A;  5F8S A;  2D7I A;  1JY0 A;  2D44 A;  4UDK E;  5JOW A;  5DUY A;  1WBA A;  3WMZ A;  3O4A A;  3OJM A;  4LO1 C;  3BAU A;  1JLX A;  1AVX B;  1Z0H A;  4LO7 B;  3FUO A;  2NYY A;  4Q9P A;  4ZBV B;  3RTJ B;  3O49 A;  1HKN A;  4XFT A;  3H6R B;  5FLW A;  5FMD A;  4AK7 A;  3LDK A;  4LO0 C;  4J23 B;  4OWK A;  4I4S A;  1V6U A;  1SR4 C;  5BXT A;  3WPZ A;  3AJ6 A;  4I0Y A;  4DCK C;  3QR5 A;  4X39 A;  2FFV A;  1PWA A;  1YXW A;  3FJD A;  4FVV A;  1JT5 A;  1Q03 A;  1I1E A;  4XFS A;  4AN6 A;  4I4Y A;  3BA4 A;  1P63 A;  3BRF A;  3CA4 A;  3WAU A;  4PVI A;  4I4P A;  2XOA A;  3O4O A;  5FKC A;  3AH1 A;  3MAL A;  3HSM A;  3V0A A;  1BFF A;  2GO2 A;  3OBT A;  4PVA A;  4ISR A;  1BFC A;  2R9K B;  4P0K A;  1NUN A;  4X37 A;  3HMY A;  3IAG C;  3WPY A;  1JTC A;  4GOV A;  4I4O A;  3ZX7 A;  1A8D A;  21BI A;  3UD9 A;  1TWE A;  1SZ6 B;  4WBC A;  1S0G A;  3ZXG A;  3OM6 A;  2DRE A;  2NZ9 A;  1UPS A;  2K4A B;  2Y9F A;  3F1R A;  4GAI A;  2X8F A;  3WAT A;  3WIN C;  3FJF A;  1BAR A;  1FWV A;  1G9D A;  3C2U A;  1W3F A;  2LIQ A;  4FFH A;  1MD6 A;  5D62 A;  3PIJ A;  5FK8 A;  3NJ5 A;  1II4 A;  2BEB A;  4L4I A;  5BQU A;  2Z48 A;  4ZGR B;  5AYD A;  2EXH A;  1HWP B;  4OEG A;  2NP0 A;  3K1U A;  2QN4 A;  3AKF A;  3LFI A;  4KEJ A;  4HR6 C;  2IWT B;  5D61 A;  1UYP A;  3O3Q A;  4A7Z A;  3BB2 A;  4END A;  4LO7 C;  1XG6 A;  3OGG A;  4MLG A;  2RQ9 A;  1RY7 A;  3BAO A;  1AXM A;  3C7E A;  3U14 A;  4QAL A;  4JRA A;  1BFB A;  4G1R A;  4IHZ A;  3ZXD A;  1Z2V A;  4D0Z A;  3OJV A;  3C7H A;  4ZOT A;  2RG9 B;  2VUA A;  3D60 A;  2KH2 A;  3CA0 A;  1AVU A;  4KBB A;  1T9F A;  3FJE A;  2D7R A;  1PUM B;  3P6I A;  3RTI B;  3S8K A;  2ERM A;  4ZFY B;  1D0H A;  3VUO A;  2L5X A;  3WO3 A;  3RWK X;  4JP0 A;  3CA6 A;  5JOY A;  3WO4 A;  3BA7 A;  3KF5 A;  1Y9G A;  1FGA A;  3R4Z A;  3CRI A;  3LV4 A;  1IRP A;  4DEN A;  3JRR A;  3WN1 A;  4EEE B;  3PIG A;  2MIB A;  3AH4 A;  5BXP A;  3FJJ A;  5GLM A;  2P23 A;  3WIN A;  4HA2 A;  3BTA A;  2MLL B;  4YOL A;  2AC1 A;  2FDB M;  1TOO A;  4NOV A;  3BAG A;  1G9B A;  3BAH A;  4KC8 A;  4I4U A;  4IQP A;  4O8P A;  1RG8 A;  4UDJ A;  4ZFU B;  3LEM A;  1BFG A;  3CU1 B;  1HWO B;  1YI7 A;  3QEE A;  2AFG A;  2QYI B;  1PZZ A;  3Q7Y A;  1S0B A;  1YRZ A;  2MC2 A;  4IY8 A;  3IIR A;  2BEA A;  1OYG A;  4QKR A;  1ABR B;  3O4C A;  3WMY A;  4I3N A;  4I96 A;  3OM7 A;  4I4Q A;  3A23 A;  1I1B A;  4D47 A;  3BAQ A;  3LTQ A;  4UDG A;  2HWM A;  5FMC A;  3R4S A;  1V6W A;  1FV2 A;  3K1X A;  4DEP A;  3UD8 A;  3OBR A;  4MZH A;  3OM2 A;  3OJ2 A;  3HN1 A;  1Q04 A;  3CAH A;  2VU9 A;  3TC2 A;  1YYN A;  1ISW A;  3FJK A;  3D61 A;  4EKX B;  3JUT A;  1S0D A;  2ZR1 B;  3FJ8 A;  1DLL A;  1AVA C;  1Y9M A;  3I2A A;  1TFM B;  1G9C A;  4A7Y A;  3WPV A;  5AY9 A;  1AVW B;  1DZD A;  2Y9G A;  4LO3 C;  3N7K A;  3QZ4 A;  1AF9 A;  3VSZ A;  2QQW A;  5EHA A;  1OQL B;  3O4D A;  2F2F C;  1ISV A;  4J2Y A;  4LO2 C;  5G00 A;  4KMI A;  3UGF A;  3WPU A;  5FZU A;  3RMY A;  3RSJ A;  3VSS A;  3F62 B;  2E4M A;  2Y9W C;  1T4Q A;  2FFU A;  1JT4 A;  1TP0 A;  4AK5 A;  4QBV A;  5BP5 A;  2VSE A;  4H04 A;  4IY9 A;  5BXS A;  1XHB A;  3V79 C;  1BLD A;  1JQZ A;  1EPW A;  2FO1 A;  1RZO B;  5FZY A;  2B4W A;  1EYL A;  3AKH A;  3I29 B;  3OGF A;  1YF8 B;  4OW4 A;  2KI4 A;  3ZC8 A;  3BX1 C;  3H6Q A;  1G82 A;  2M49 A;  1HWN B;  5JLV A;  2J3P A;  3IM7 A;  3BYK A;  2DRZ A;  5DZU A;  1FWU A;  4Q9G A;  3QED A;  2VDT A;  4JPZ A;  3W9T A;  4IZX A;  4O8O A;  3AKG A;  3NBE A;  5AYC A;  3P6J A;  1EVT A;  2I1B A;  1K5V A;  2VSA A;  3QC2 A;  3PHZ A;  4KC3 A;  1TTU A;  1S0F A;  4I2S A;  4LO1 A;  3SC7 X;  4JAW A;  1W18 A;  5JOX A;  1GGP B;  4JQ0 A;  2P39 A;  2WRY A;  1CE7 B;  4ION A;  3BRG C;  2LIE A;  1ITB A;  3BYJ A;  2UUS A;  3LLP A;  1IRA X;  2BFH A;  3WMU A;  1DFC A;  3QYD A;  3AZV A;  1GYE B;  4XFU A;  4LO0 A;  4J2S A;  4LO3 A;  1JT3 A;  3KF3 A;  1AFC A;  4LO8 B;  3V0A B;  1SR4 A;  5A7V A;  4I6I A;  2AEY A;  2YFT A;  3N7M A;  3T8S A;  1GYD B;  3C7O A;  4UY4 A;  5HPZ A;  3V0B A;  4QC4 A;  1DZC A;  1UV4 A;  4EQV A;  1G9A A;  3VEQ A;  1L2H A;  4L4H A;  5B6S A;  2X2T A;  3N7J A;  5BXR A;  4Q91 A;  6I1B A;  3O5W B;  1R8N A;  2Q3N B;  3E8L C;  4MZF B;  1E0O A;  4AN7 B;  1YTO A;  3CRH A;  3KST A;  4USO A;  4P0L A;  2ET2 A;  3LIH A;  5C0P A;  3FUQ A;  4IZE A;  1DIW A;  4P6A A;  4ZA3 B;  3HBW A;  3AKI A;  3CA5 A;  3R4U A;  2D23 A;  2AXM A;  1ISZ A;  3FJC A;  3UJ4 A;  5FK7 A;  4J2K A;  5JOZ A;  1Z4S A;  5B2H A;  1MC9 A;  2KLL A;  2AQZ A;  3KMV A;  5GLL A;  1WD3 A;  3P2N A;  4TLP A;  3PUB A;  3N0K A;  5EG6 C;  4X3A A;  1Y7B A;  2RST A;  2XQR A;  4H9W A;  3CU9 A;  5D63 A;  3OM4 A;  1RML A;  4F34 A;  4EB2 B;  3ZXL A;  1IHK A;  1VKD A;  1W2T A;  3BYN A;  5F90 A;  3FJA A;  4KEI A;  3A21 A;  1CVS A;  3LDR A;  3WN0 A;  2YUG A;  5FZZ A;  3ILA A;  4GP0 A;  3H6S E;  2D22 A;  1BA7 A;  3WO2 A;  5E24 E;  2AEZ A;  2EXK A;  3D5Y A;  4OEE A;  1M2T B;  4G9N A;  8I1B A;  1ST8 A;  3UGG A;  3H6R A;  2ADD A;  3BAV A;  2FGF A;  3CQA A;  5GLP A;  1FV3 A;  4I4X A;  2K8R A;  2NVH A;  3PG0 A;  2HW9 A;  1IJT A;  5JMC A;  3I2X A;  4I1E A;  1V6X A;  1W3A A;  2YFS A;  2KKI A;  1BAS A;  2OXB A;  4XKI A;  5I1B A;  1S0C A;  3VSF A;  2Q9X A;  3C7G A;  1PUU B;  2Y9X E;  1VCL A;  1ILR 1;  4G6J A;  5GLQ A;  1FN0 A;  4OWJ A;  3VSR A;  4FFF A;  1XZZ A;  3IM6 A;  4Z8S B;  3ZC9 A;  4N1I A;  2QQV A;  3BA5 A;  3POK A;  3WMV A;  4COT A;  4ZLB B;  5DSS B;  1XYF A;  1FQ9 A;  1PT2 A;  5BQU C;  3O4B A;  2X8S A;  4UDI A;  3FJB A;  3CRG A;  9ILB A;  1IOB A;  3ZXK A;  1WL7 A;  1M16 A;  5F8W A;  3WAS A;  3AH2 A;  4OEF A;  3UDA A;  3HAL A;  3Q7X A;  2AAI B;  4FGF A;  3TAW A;  4I7I A;  2D20 A;  2VLC A;  4R6U B;  1TIE A;  3ZXJ A;  3O44 A;  4CJM A;  1F31 A;  2NM1 A;  3C7F A;  2WBC A;  3NBC A;  4X38 A;  1Y4W A;  4J2X A;  5GLN A;  5FNX A;  4N4B A;  1R8O A;  4EFP A;  5GAQ A;  3WN2 A;  2DS0 A;  3NBD A;  2GZB A;  2ZQN A;  4I1B A;  2K43 A;  4JKX B;  31BI A;  3C9Z A;  4O8N A;  5GLR A;  3UJ0 A;  1EV2 A;  4I4V A;  4GOY A;  4D8H A;  3BRD A;  1QQK A;  3VT2 A;  4P0J A;  4QD2 B;  1YIF A;  5AYE A;  1W3G A;  2F2F A;  4USP A;  4LO2 A;  4IYB A;  3S8J A;  3NBN A;  5FMB A;  3D7W B;  2EXI A;  3IM5 A;  5B6T A;  2HZ9 A;  4ONZ A;  1NZK A;  3SNV A;  4H75 A;  3R67 A;  4UDK A;  1ISX A;  2NTD A;  2ZQO A;  3RMX A;  4JKQ A;  3VT0 A;  4KCA A;  3FGM A;  2F8X C;  4MZG B;  4FFI A;  3B9U A;  4QBC A;  2EXJ A;  4AK6 A;  1BLA A;  5F8Y A;  1IT0 A;  3OM5 A;  4Z9W B;  4FFG A;  1JLY A;  3A07 A;  3LIG A;  5ANN A;  1IIL A;  3N7L A;  1N4K A;  4OUJ A;  5BOW A;  4QO3 A;  3P53 A;  3D5Z A;  1YBI A;  2KI6 B;  3VT1 A;  3NQH A;  2IHO A;  1ONK B;  4I8M A;  1FMZ A;  1HIB A;  2Z49 A;  4KEK A;  4OWL A;  1QQL A;  3A22 A;  2DRY A;  1KNM A;  1S0E A;  3FJI A;  3UD7 A;  5A7V B;  5FKB A;  1DFQ A;  3QEF A;  1WBC A;  4A7K A;  3LF7 A;  4GAF A;  5FNW A;  3V0B B;  2YFR A;  3VWC A;  5BVP I;  2VXT I;  3BYL A;  1Q1U A;  4N2Z A;  2D43 A;  1K5U A;  1HCD A;  1S0L A;  7I1B A;  2QQU A;  3UGH A;  5EC5 A;  4N2R A;  4EFQ A;  1DJS B;  1DQG A;  1GYH A;  5GLO A;  2D1Z A;  1ISY A;  1JT7 A;  1PC8 B;  41BI A;  4KCB A;  1DQO A;  4HJJ A;  2ESU A;  2E4M C;  3AJ5 A;  4G6M A;  4ZKT B;  4D0T A;  1HWM B;  3FJ9 A;  5BP5 C;  4I4R A;  3PME A;  4EFR A;  4II0 A;  1FMM S;  5FIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...