3VT1A

Crystal structure of ct1,3gal43a in complex with galactose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
461
structure length
461
Chain Sequence
b'EGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYYYLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLVNKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDESKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSDAGGTNQHWKLVLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ricin B lectin
publication title Crystal structure of 1,3Gal43A, an exo-beta-1,3-galactanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 128
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vt1A02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vt1A01
3UGGA 1WD4A 4P0JA 4Q91A 4FVVA 1ILR1 1JT5A 1VCLA 1XHBA 3F1RA 2D43A 4ZA3B 1Y9MA 2WRYA 3FJEA 4O8OA 1ISZA 3VEQA 4HR6C 1JLYA 3WINC 3BAUA 3RMXA 1K5UA 3Q7WA 2Z48A 3LTQA 3WMVA 3QYDA 1XZZA 1FN0A 2GO2A 2B4WA 4I4VA 4DENA 1CE7B 3FJ8A 5BXPA 2Y9XE 3BRFA 1W3GA 1EYLA 1DQGA 4USOA 4G9NA 5D63A 3LIHA 3EF2A 1JT4A 4IY8A 5JMCA 5GLOA 3FJIA 2P23A 2D7IA 2VU9A 1JT3A 1S0LA 3BADA 2EXKA 5FZUA 2QYIB 5GLNA 4LO3A 2J3PA 1UPSA 3WPYA 3RTIB 5F8SA 1S0CA 4HA2A 2LIEA 1W2TA 2AEYA 4OUJA 2Y9WC 3CAHA 1N4KA 3R67A 3KMVA 2FDBM 4FGFA 4X3AA 1FMZA 1GGPB 2F8XC 1G9AA 4ZFYB 4UDGA 1DLLA 1ISVA 4LO2A 1DZDA 2K8RA 3VT0A 3IAGC 4Z8SB 2YFRA 3PG0A 4LO1A 4I3NA 4KEIA 3AJ5A 4OW4A 2KKIA 4DCKC 4ENDA 5A7VA 4I6IA 2R9KB 2BEBA 1BLAA 4OEGA 4J2XA 2QQUA 3OBTA 2NYYA 2D20A 3T8SA 5B2HA 3OBRA 1SZ6B 4X38A 1V6WA 3ZC9A 3RSJA 1WBCA 3CA6A 5JLVA 3OM6A 5GLMA 1BLDA 3FJAA 1AVUA 3TC2A 1T9FA 5BVPI 4QALA 1RG8A 4IQPA 3FGMA 3ILAA 2ZQNA 2DREA 3RTJB 8I1BA 1S0BA 1ITBA 4OEFA 3CRHA 1ISWA 3QZ4A 5A8CA 3WMUA 2Y9FA 1HWPB 3O4AA 3A22A 1Z4SA 1AFCA 2HZ9A 4OWLA 3ZXDA 3CA0A 3VSZA 5A8DA 3FJFA 2YFSA 3R4SA 1Y4WA 1RZOB 4TLPA 1II4A 1TFMB 4F34A 4PVAA 3I2AA 1IRAX 5A7VB 2NZ9A 4IY9A 3OJMA 2ZQOA 3LF7A 2GZBA 2AC1A 4JKXB 3MPPG 1UYPA 1BFCA 1WD3A 4O8PA 2VUAA 3S8JA 4QQSA 1HCEA 3LEMA 3ZXJA 3O3QA 3QEDA 3WN0A 3C2UA 3K1XA 4LO8B 5FLWA 3OGGA 1AVAC 1DFQA 4UDJA 3AZVA 3AKFA 41BIA 4I96A 2X8SA 3WPZA 2IHOA 5GLLA 2E4MC 4QC4A 1TWMA 2VDTA 3WO3A 4GAIA 3P2NA 4A7ZA 3MALA 5BQUC 5GLPA 1R8NA 1HIBA 2D1ZA 3IM6A 3P53A 2XOAA 4P0LA 1EVTA 2FGFA 3VT1A 3C9ZA 3ZXLA 1BFGA 4J2KA 1YTOA 3P6JA 4IHZA 3BRGC 5DUYA 4DEPA 1BARA 4A7YA 1MC9A 1TWEA 4AK7A 1SR4A 5BXSA 4FFIA 4I4RA 3O5WB 5EC5A 1IRPA 1PUMB 3SC7X 3BYNA 2DRYA 4N2RA 5GLQA 4EFRA 5JOZA 1K5VA 2EXIA 1S0FA 3FJ9A 3VSFA 3R4YA 4N1IA 3SNVA 21BIA 2VXTI 2D24A 3IM7A 2KI4A 3H6QA 5BP5C 3JUTA 1HWOB 3E8LC 2D44A 3CA3A 4G6MA 4JRAA 3WATA 5DZUA 4I4UA 5EHAA 3V79C 3O4OA 1DIWA 3JRRA 4LO7C 4GOVA 3UJ0A 2ET2A 2F2FA 3HOMA 1D0HA 5BXRA 1S0DA 1YI7A 1M16A 2KLLA 4D0ZA 2YUGA 1FWVA 3CU1B 1Q04A 2X2TA 3FJCA 3O4CA 1TIEA 2VXRA 4JP0A 1JLXA 3BAHA 1QQLA 4KCAA 2RSTA 3UGFA 4EEEB 3V0BA 3BA5A 3WN2A 3BA7A 3HSMA 3D60A 1IHKA 1FWUA 4G6JA 3WO4A 3KSTA 3KF5A 3N7JA 3BYKA 3Q7XA 1IJTA 4I1BA 5AYCA 2DS0A 1EV2A 1IOBA 4I2SA 5JOYA 1R8OA 7I1BA 4D8HA 4ZOTA 3WMYA 3CQAA 4QO3A 2XQRA 4I4XA 3V0AA 3QEFA 4KMIA 5F8WA 3R4UA 4IYBA 3BRDA 3KF3A 4ISRA 3O4DA 5GLKA 4P6AA 3BAVA 3PIJA 4YOLA 4I4PA 1ISYA 4JAWA 3NBDA 1GYHA 5FZYA 3TAWA 1W3FA 4P0KA 3VT2A 1GYEB 1M2TB 3NBEA 3CA1A 4I1EA 3LDKA 4EFPA 1QXMA 4XFSA 4LO2C 1G9DA 3PIGA 4J2SA 5DSSB 3V0BB 3A07A 1ABRB 3AJ6A 5AYEA 3NQHA 3O4BA 4QD2C 1ST8A 1S0GA 2ZR1B 3LIGA 2QQVA 1S0EA 4GP3A 1Q1UA 2LIQA 3BYLA 2AEZA 3OGFA 1NZKA 2VSAA 3H6RA 4N4BA 5GLRA 1BA7A 1JT7A 1HCDA 3OJ2A 3P6IA 5C0PA 4G1RA 4QKSA 1G9CA 4LO0C 2AXMA 1E0OA 4CJMA 5FK8A 4HJJA 1AF9A 2Z49A 4XKIA 4L4IA 3WASA 2E4MA 4ZBVB 4KCBA 1V6XA 3AZWA 5BQUA 4I7IA 3V0AB 4A7KA 2K43A 4GAFA 3C7OA 2UUSA 1FQ9A 1AVXB 4JQ0A 1XG6A 1YBIA 2MLLB 3C7EA 5FMDA 4WBCA 1WBAA 1BFFA 2FFVA 1XYFA 2EXJA 1IILA 1CVSA 2WBCA 4J23B 1PT2A 2FO1A 3LDRA 3BAOA 4JKQA 4U6BA 3WAUA 5I1BA 5D61A 1QQKA 3OM5A 4KBBA 3Q7YA 4OWJA 4QKRA 1BASA 5FKBA 3UJ4A 4IZXA 3N0KA 3RMYA 3C7HA 3CRIA 5E24E 3B9UA 5F90A 1A8DA 3BB2A 3CA5A 4KEJA 1JY0A 3IIRA 2RG9B 4I4OA 2HW9A 2I1BA 2ERMA 1F31A 3H6RB 4JPZA 2AFGA 4KC7A 4OEEA 3WINA 1YYNA 3A23A 3OM2A 1HKNA 3UGHA 1W18A 1Z0HA 4X37A 3ZXKA 4QBVA 1PWAA 3QC2A 4OWKA 5D62A 4ONZA 4KC8A 1BFBA 1DQOA 2YFTA 2ADEA 4N2ZA 2NVHA 1T4QA 4O8NA 4D47A 3AH2A 3WMZA 4AK5A 3VUOA 1NUNA 1DZCA 3PUBA 1Q03A 4KEKA 1ISXA 5FNXA 3CU9A 4G9MA 3NBNA 1W3AA 4UDIA 1OQLB 1V6VA 3PMEA 1EPWA 3LLPA 4GOYA 1WL7A 3ZX7A 2KI6B 3OM7A 1FGAA 1YIFA 3IM5A 1HWNB 1PUUB 4GP0A 3W9TA 1Y7BA 1SR4C 1PZZA 3D7WB 3I29B 4IZEA 1I1BA 2KH2A 3AH4A 4AN7B 4COTA 5B6TA 5FMBA 3ZC8A 1DFCA 4II0A 1L2HA 1Y9GA 3U14A 3BTAA 3N7LA 3D5YA 5ANNA 3RWKX 2RQ9A 1RMLA 3FFZA 1MD6A 2MIBA 4EKXB 5B6SA 1FV2A 2OXBA 3AH1A 3HALA 1ONKB 3FUOA 4LO7B 2IWTB 3NBCA 2DRZA 5JOWA 1TP0A 31BIA 4Q9GA 3CA4A 5FIXA 2F2FC 2X8FA 3R4ZA 2BEAA 3AKGA 1G9BA 4LO3C 4ZFUB 2X8TA 1Z2VA 3WPVA 1IT0A 4QBCA 2L5XA 3S8KA 1P63A 1JTCA 4EQVA 3A21A 2FFUA 5FKCA 2ESUA 3O49A 4I4YA 3H6SE 1HWMB 4XFUA 2QQWA 5FMCA 4ISQA 2NM1A 4ZKTB 1JQZA 3VSSA 3N7KA 4LO1C 3POKA 4USPA 3UD9A 3WO2A 4I37A 3N7MA 3OJVA 4LO0A 4U6DA 5DVHA 1J0SA 4I4QA 5FNWA 3K1UA 2AQZA 1FV3A 4PVIA 2BFHA 4I8MA 4KC3A 2P39A 3UD7A 3UDAA 3WA1A 2VSEA 3BYJA 3D61A 4EFQA 4MLGA 5FK7A 3C7GA 3FJBA 3FJJA 3D5ZA 2Y9GA 4IONA 4AK6A 3O44A 3HMYA 1AVWB 3BX1C 3PHZA 5F8YA 4F83A 1GYDB 4X39A 3AKIA 1UV4A 3BA4A 2AAIB 5JOXA 3LFIA 1TOOA 5BOWA 2NP0A 6I1BA 4H04A 3BAQA 3VWCA 2HWAA 4EB2B 2D23A 3QR5A 4D0TA 5GAQA 3CRGA 4Z9WB 3ZXGA 5BXTA 1OYGA 3HBWA 4J2YA 2MC2A 4PC4A 2ADDA 4QD2B 5EG6C 2D22A 3FJKA 4UDKA 3VSRA 3WN1A 2X2SA 1V6UA 1KNMA 4I4SA 1PC8B 2K4AB 4NOVA 4H9WA 3LV4A 1YXWA 3HN1A 4I0YA 1TTUA 3C7FA 3WPUA 4R6UB 4ZLBB 3I2XA 5AYDA 4AN6A 4FFFA 4FFHA 2HWMA 5AY9A 1YF8B 4ZFWB 3BAGA 4XFTA 2QN4A 1RY7A 5BP5A 2VLCA 1I1EA 4UDKE 5HPZA 2M49A 1G82A 4Q9PA 5FZZA 4ZGRB 3FJHA 1AXMA 2NTDA 3AKHA 3UD8A 2Q3NB 5G00A 3U75A 3OM4A 1DJSB 3FJDA 9ILBA 2D7RA 1VKDA 1YRZA 4L4HA 3FUQA 2Q9XA 1FMMS 4FFGA 3NJ5A 3QEEA 3F62B 2EXHA
chains in the Genus database with same CATH superfamily
3UGGA 1WD4A 4P0JA 4Q91A 4FVVA 1ILR1 1JT5A 1VCLA 1XHBA 3F1RA 2D43A 4ZA3B 1Y9MA 2WRYA 3FJEA 4O8OA 1ISZA 3VEQA 4HR6C 1JLYA 3WINC 3BAUA 3RMXA 1K5UA 3Q7WA 2Z48A 3LTQA 3WMVA 3QYDA 1XZZA 1FN0A 2GO2A 2B4WA 4I4VA 4DENA 1CE7B 3FJ8A 5BXPA 2Y9XE 3BRFA 1W3GA 1EYLA 1DQGA 4USOA 4G9NA 5D63A 3LIHA 3EF2A 1JT4A 4IY8A 5JMCA 5GLOA 3FJIA 2P23A 2D7IA 2VU9A 1JT3A 1S0LA 3BADA 2EXKA 5FZUA 2QYIB 5GLNA 4LO3A 2J3PA 1UPSA 3WPYA 3RTIB 5F8SA 1S0CA 4HA2A 2LIEA 1W2TA 2AEYA 4OUJA 2Y9WC 3CAHA 1N4KA 3R67A 3KMVA 2FDBM 4FGFA 4X3AA 1FMZA 1GGPB 2F8XC 1G9AA 4ZFYB 4UDGA 1DLLA 1ISVA 4LO2A 1DZDA 2K8RA 3VT0A 3IAGC 4Z8SB 2YFRA 3PG0A 4LO1A 4I3NA 4KEIA 3AJ5A 4OW4A 2KKIA 4DCKC 4MZFB 4ENDA 5A7VA 4I6IA 2R9KB 2BEBA 1BLAA 4OEGA 4J2XA 2QQUA 3OBTA 2NYYA 2D20A 3T8SA 5B2HA 3OBRA 1SZ6B 4X38A 1V6WA 3ZC9A 3RSJA 1WBCA 3CA6A 5JLVA 4MZHA 3OM6A 5GLMA 1BLDA 3FJAA 1AVUA 3TC2A 1T9FA 5BVPI 4QALA 1RG8A 2NS2A 4IQPA 3FGMA 3ILAA 2ZQNA 2DREA 3RTJB 8I1BA 1S0BA 1ITBA 4OEFA 3CRHA 1ISWA 3QZ4A 5A8CA 3WMUA 2Y9FA 1HWPB 3O4AA 3A22A 1Z4SA 1AFCA 4H75A 2HZ9A 4OWLA 3ZXDA 3CA0A 3VSZA 5A8DA 3FJFA 2YFSA 3R4SA 1Y4WA 1RZOB 4TLPA 1II4A 1TFMB 4F34A 4PVAA 3I2AA 1IRAX 5A7VB 2NZ9A 4IY9A 3OJMA 2ZQOA 3LF7A 2GZBA 2AC1A 4JKXB 3MPPG 1UYPA 1BFCA 1WD3A 4O8PA 2VUAA 3S8JA 4QQSA 1HCEA 3LEMA 3ZXJA 3O3QA 3QEDA 3WN0A 3C2UA 3K1XA 4LO8B 5FLWA 3OGGA 1AVAC 1DFQA 4UDJA 3AZVA 3AKFA 41BIA 4I96A 2X8SA 3WPZA 2IHOA 5GLLA 2E4MC 4QC4A 1TWMA 2VDTA 3WO3A 4GAIA 3P2NA 4A7ZA 3MALA 5BQUC 5GLPA 1R8NA 1HIBA 2D1ZA 3IM6A 3P53A 2XOAA 4P0LA 1EVTA 2FGFA 3VT1A 3C9ZA 3ZXLA 1BFGA 4J2KA 1YTOA 3P6JA 4IHZA 3BRGC 5DUYA 4DEPA 1BARA 4A7YA 1MC9A 1TWEA 4AK7A 1SR4A 5BXSA 4FFIA 4I4RA 3O5WB 5EC5A 1IRPA 1PUMB 3SC7X 3BYNA 2DRYA 4N2RA 5GLQA 4EFRA 5JOZA 1K5VA 2EXIA 1S0FA 3FJ9A 3VSFA 3R4YA 4N1IA 3SNVA 21BIA 2VXTI 2D24A 3IM7A 2KI4A 3H6QA 5BP5C 3JUTA 1HWOB 3E8LC 2D44A 3CA3A 4G6MA 4JRAA 3WATA 5DZUA 4I4UA 1TL2A 5EHAA 3V79C 3O4OA 1DIWA 3JRRA 4LO7C 5C2MA 4GOVA 3UJ0A 2ET2A 2F2FA 3HOMA 1D0HA 5BXRA 1S0DA 1YI7A 1M16A 2KLLA 4D0ZA 2YUGA 1FWVA 3CU1B 1Q04A 2X2TA 3FJCA 3O4CA 1TIEA 2VXRA 4JP0A 1JLXA 3BAHA 1QQLA 4KCAA 2RSTA 3UGFA 4EEEB 3V0BA 3BA5A 3WN2A 3BA7A 3HSMA 3D60A 1IHKA 1FWUA 4G6JA 3WO4A 3KSTA 3KF5A 3N7JA 3BYKA 3Q7XA 1IJTA 4I1BA 5AYCA 2DS0A 1EV2A 1IOBA 4I2SA 5JOYA 1R8OA 7I1BA 4D8HA 4ZOTA 3WMYA 3CQAA 4QO3A 2XQRA 4I4XA 3V0AA 3QEFA 4KMIA 4MZGB 3R4UA 4IYBA 5F8WA 3BRDA 3KF3A 4ISRA 3O4DA 5GLKA 4P6AA 3BAVA 3PIJA 4YOLA 4I4PA 1ISYA 4JAWA 3NBDA 1GYHA 5FZYA 3TAWA 1W3FA 4P0KA 3VT2A 1GYEB 1M2TB 3NBEA 3CA1A 4I1EA 3LDKA 4EFPA 1QXMA 4XFSA 4LO2C 1G9DA 3PIGA 4J2SA 5DSSB 3V0BB 3A07A 1ABRB 3AJ6A 5AYEA 3NQHA 3O4BA 4QD2C 1ST8A 1S0GA 2ZR1B 3LIGA 2QQVA 1S0EA 4GP3A 1Q1UA 2LIQA 3BYLA 2AEZA 3OGFA 1NZKA 2VSAA 3H6RA 4N4BA 5GLRA 1BA7A 1JT7A 1HCDA 3OJ2A 3P6IA 5C0PA 4G1RA 4QKSA 1G9CA 4LO0C 2AXMA 1E0OA 4CJMA 5FK8A 4HJJA 1AF9A 2Z49A 4XKIA 4L4IA 3WASA 2E4MA 4ZBVB 4KCBA 1V6XA 3AZWA 5BQUA 4I7IA 3V0AB 4A7KA 2K43A 4GAFA 3C7OA 2UUSA 1FQ9A 1AVXB 4JQ0A 1XG6A 1YBIA 2MLLB 3C7EA 5FMDA 4WBCA 1WBAA 1BFFA 2FFVA 1XYFA 2EXJA 1IILA 1CVSA 2WBCA 4J23B 1PT2A 2FO1A 3LDRA 3BAOA 4JKQA 4U6BA 3WAUA 5I1BA 5D61A 1QQKA 3OM5A 4KBBA 3Q7YA 4OWJA 4QKRA 1BASA 5FKBA 3UJ4A 4IZXA 3N0KA 3RMYA 3C7HA 3CRIA 5E24E 3B9UA 5F90A 1A8DA 3BB2A 3CA5A 4KEJA 1JY0A 3IIRA 2RG9B 4I4OA 2HW9A 2I1BA 2ERMA 1F31A 3H6RB 4JPZA 2AFGA 4KC7A 4OEEA 3WINA 1YYNA 3A23A 3OM2A 1HKNA 3UGHA 1W18A 1Z0HA 4X37A 3ZXKA 4QBVA 1PWAA 3QC2A 4OWKA 5D62A 4ONZA 4KC8A 1BFBA 1DQOA 2YFTA 2ADEA 4N2ZA 2NVHA 1T4QA 4O8NA 4D47A 3AH2A 3WMZA 4AK5A 3VUOA 1NUNA 1DZCA 3PUBA 1Q03A 4KEKA 1ISXA 5FNXA 3CU9A 4G9MA 3NBNA 1W3AA 4UDIA 1OQLB 1V6VA 3PMEA 1EPWA 3LLPA 4GOYA 1WL7A 3ZX7A 2KI6B 3OM7A 1FGAA 1YIFA 3IM5A 1HWNB 1PUUB 4GP0A 3W9TA 1Y7BA 1SR4C 1PZZA 3D7WB 3I29B 4IZEA 1I1BA 2KH2A 3AH4A 4AN7B 4COTA 5B6TA 5FMBA 3ZC8A 1DFCA 4II0A 1L2HA 1Y9GA 3U14A 3BTAA 3N7LA 3D5YA 5ANNA 3RWKX 2RQ9A 1RMLA 3FFZA 1MD6A 2MIBA 4EKXB 5B6SA 1FV2A 2OXBA 3AH1A 3HALA 1ONKB 3FUOA 4LO7B 2IWTB 3NBCA 2DRZA 5JOWA 1TP0A 31BIA 4Q9GA 3CA4A 5FIXA 2F2FC 2X8FA 3R4ZA 2BEAA 3AKGA 1G9BA 4LO3C 4ZFUB 2X8TA 1Z2VA 3WPVA 1IT0A 4QBCA 2L5XA 4UY4A 3S8KA 1P63A 1JTCA 4EQVA 3A21A 2FFUA 5FKCA 2ESUA 3O49A 4I4YA 3H6SE 1HWMB 4XFUA 2QQWA 5FMCA 4ISQA 2NM1A 4ZKTB 1JQZA 3VSSA 3N7KA 4LO1C 3POKA 4USPA 3UD9A 3WO2A 4I37A 3N7MA 3OJVA 4LO0A 4U6DA 5DVHA 1J0SA 4I4QA 5FNWA 3K1UA 2AQZA 1FV3A 4PVIA 2BFHA 4I8MA 4KC3A 2P39A 3UD7A 3UDAA 3WA1A 2VSEA 3BYJA 3D61A 4EFQA 4MLGA 5FK7A 3C7GA 3FJBA 3FJJA 3D5ZA 2Y9GA 4IONA 4AK6A 3O44A 3HMYA 1AVWB 3BX1C 3PHZA 5F8YA 4F83A 1GYDB 4X39A 3AKIA 1UV4A 3BA4A 2AAIB 5JOXA 3LFIA 1TOOA 5BOWA 2NP0A 6I1BA 4H04A 3BAQA 3VWCA 2HWAA 4EB2B 2D23A 3QR5A 4D0TA 5GAQA 3CRGA 4Z9WB 3ZXGA 5BXTA 1OYGA 3HBWA 4J2YA 2MC2A 4PC4A 2ADDA 4QD2B 5EG6C 2D22A 3FJKA 4UDKA 3VSRA 3WN1A 2X2SA 1V6UA 1KNMA 4I4SA 1PC8B 2K4AB 4NOVA 4H9WA 3LV4A 1YXWA 3HN1A 4I0YA 1TTUA 3C7FA 3WPUA 4R6UB 4ZLBB 3I2XA 5AYDA 4AN6A 4FFFA 4FFHA 2HWMA 5AY9A 1YF8B 4ZFWB 3BAGA 4XFTA 2QN4A 1RY7A 5BP5A 2VLCA 1I1EA 4UDKE 5HPZA 2M49A 1G82A 4Q9PA 5FZZA 4ZGRB 3FJHA 1AXMA 2NTDA 3AKHA 3UD8A 2Q3NB 5G00A 3U75A 3OM4A 1DJSB 3FJDA 9ILBA 2D7RA 1VKDA 1YRZA 4L4HA 3FUQA 2Q9XA 1FMMS 4FFGA 3NJ5A 3QEEA 3F62B 2EXHA
chains in the Genus database with same CATH topology
3UGGA 1WD4A 4P0JA 4Q91A 4FVVA 1ILR1 1JT5A 1VCLA 1XHBA 3F1RA 2D43A 4ZA3B 1Y9MA 2WRYA 3FJEA 4O8OA 1ISZA 3VEQA 4HR6C 1JLYA 3WINC 3BAUA 3RMXA 1K5UA 3Q7WA 2Z48A 3LTQA 3WMVA 3QYDA 1XZZA 1FN0A 2GO2A 2B4WA 4I4VA 4DENA 1CE7B 3FJ8A 5BXPA 2Y9XE 3BRFA 1W3GA 1EYLA 1DQGA 4USOA 4G9NA 5D63A 3LIHA 3EF2A 1JT4A 4IY8A 5JMCA 5GLOA 3FJIA 2P23A 2D7IA 2VU9A 1JT3A 1S0LA 3BADA 2EXKA 5FZUA 2QYIB 5GLNA 4LO3A 2J3PA 1UPSA 3WPYA 3RTIB 5F8SA 1S0CA 4HA2A 2LIEA 1W2TA 2AEYA 4OUJA 2Y9WC 3CAHA 1N4KA 3R67A 3KMVA 2FDBM 4FGFA 4X3AA 1FMZA 1GGPB 2F8XC 1G9AA 4ZFYB 4UDGA 1DLLA 1ISVA 4LO2A 1DZDA 2K8RA 3VT0A 3IAGC 4Z8SB 2YFRA 3PG0A 4LO1A 4I3NA 4KEIA 3AJ5A 4OW4A 2KKIA 4DCKC 4MZFB 4ENDA 5A7VA 4I6IA 2R9KB 2BEBA 1BLAA 4OEGA 4J2XA 2QQUA 3OBTA 2NYYA 2D20A 3T8SA 5B2HA 3OBRA 1SZ6B 4X38A 1V6WA 3ZC9A 3RSJA 1WBCA 3CA6A 5JLVA 4MZHA 3OM6A 5GLMA 1BLDA 3FJAA 1AVUA 3TC2A 1T9FA 5BVPI 4QALA 1RG8A 2NS2A 4IQPA 3FGMA 3ILAA 2ZQNA 2DREA 3RTJB 8I1BA 1S0BA 1ITBA 4OEFA 3CRHA 1ISWA 3QZ4A 5A8CA 3WMUA 2Y9FA 1HWPB 3O4AA 3A22A 1Z4SA 1AFCA 4H75A 2HZ9A 4OWLA 3ZXDA 3CA0A 3VSZA 5A8DA 3FJFA 2YFSA 3R4SA 1Y4WA 1RZOB 4TLPA 1II4A 1TFMB 4F34A 4PVAA 3I2AA 1IRAX 5A7VB 2NZ9A 4IY9A 3OJMA 2ZQOA 3LF7A 2GZBA 2AC1A 4JKXB 3MPPG 1UYPA 1BFCA 1WD3A 4O8PA 2VUAA 3S8JA 4QQSA 1HCEA 3LEMA 3ZXJA 3O3QA 3QEDA 3WN0A 3C2UA 3K1XA 4LO8B 5FLWA 3OGGA 1AVAC 1DFQA 4UDJA 3AZVA 3AKFA 41BIA 4I96A 2X8SA 3WPZA 2IHOA 5GLLA 2E4MC 4QC4A 1TWMA 2VDTA 3WO3A 4GAIA 3P2NA 4A7ZA 3MALA 5BQUC 5GLPA 1R8NA 1HIBA 2D1ZA 3IM6A 3P53A 2XOAA 4P0LA 1EVTA 2FGFA 3VT1A 3C9ZA 3ZXLA 1BFGA 4J2KA 1YTOA 3P6JA 4IHZA 3BRGC 5DUYA 4DEPA 1BARA 4A7YA 1MC9A 1TWEA 4AK7A 1SR4A 5BXSA 4FFIA 4I4RA 3O5WB 5EC5A 1IRPA 1PUMB 3SC7X 3BYNA 2DRYA 4N2RA 5GLQA 4EFRA 5JOZA 1K5VA 2EXIA 1S0FA 3FJ9A 3VSFA 3R4YA 4N1IA 3SNVA 21BIA 2VXTI 2D24A 3IM7A 2KI4A 3H6QA 5BP5C 3JUTA 1HWOB 3E8LC 2D44A 3CA3A 4G6MA 4JRAA 3WATA 5DZUA 4I4UA 5EHAA 3V79C 3O4OA 1DIWA 3JRRA 4LO7C 4GOVA 3UJ0A 2ET2A 2F2FA 3HOMA 1D0HA 5BXRA 1S0DA 1YI7A 1M16A 2KLLA 4D0ZA 2YUGA 1FWVA 3CU1B 1Q04A 2X2TA 3FJCA 3O4CA 1TIEA 2VXRA 4JP0A 1JLXA 3BAHA 1QQLA 4KCAA 2RSTA 3UGFA 4EEEB 3V0BA 3BA5A 3WN2A 3BA7A 3HSMA 3D60A 1IHKA 1FWUA 4G6JA 3WO4A 3KSTA 3KF5A 3N7JA 3BYKA 3Q7XA 1IJTA 4I1BA 5AYCA 2DS0A 1EV2A 1IOBA 4I2SA 5JOYA 1R8OA 7I1BA 4D8HA 4ZOTA 3WMYA 3CQAA 4QO3A 2XQRA 4I4XA 3V0AA 3QEFA 4KMIA 4MZGB 3R4UA 4IYBA 5F8WA 3BRDA 3KF3A 4ISRA 3O4DA 5GLKA 4P6AA 3BAVA 3PIJA 4YOLA 4I4PA 1ISYA 4JAWA 3NBDA 1GYHA 5FZYA 3TAWA 1W3FA 4P0KA 3VT2A 1GYEB 1M2TB 3NBEA 3CA1A 4I1EA 3LDKA 4EFPA 1QXMA 4XFSA 4LO2C 1G9DA 3PIGA 4J2SA 5DSSB 3V0BB 3A07A 1ABRB 3AJ6A 5AYEA 3NQHA 3O4BA 4QD2C 1ST8A 1S0GA 2ZR1B 3LIGA 2QQVA 1S0EA 4GP3A 1Q1UA 2LIQA 3BYLA 2AEZA 3OGFA 1NZKA 2VSAA 3H6RA 4N4BA 5GLRA 1BA7A 1JT7A 1HCDA 3OJ2A 3P6IA 5C0PA 4G1RA 4QKSA 1G9CA 4LO0C 2AXMA 1E0OA 4CJMA 5FK8A 4HJJA 1AF9A 2Z49A 4XKIA 4L4IA 3WASA 2E4MA 4ZBVB 4KCBA 1V6XA 3AZWA 5BQUA 4I7IA 3V0AB 4A7KA 2K43A 4GAFA 3C7OA 2UUSA 1FQ9A 1AVXB 4JQ0A 1XG6A 1YBIA 2MLLB 3C7EA 5FMDA 4WBCA 1WBAA 1BFFA 2FFVA 1XYFA 2EXJA 1IILA 1CVSA 2WBCA 4J23B 1PT2A 2FO1A 3LDRA 3BAOA 4JKQA 4U6BA 3WAUA 5I1BA 5D61A 1QQKA 3OM5A 4KBBA 3Q7YA 4OWJA 4QKRA 1BASA 5FKBA 3UJ4A 4IZXA 3N0KA 3RMYA 3C7HA 3CRIA 5E24E 3B9UA 5F90A 1A8DA 3BB2A 3CA5A 4KEJA 1JY0A 3IIRA 2RG9B 4I4OA 2HW9A 2I1BA 2ERMA 1F31A 3H6RB 4JPZA 2AFGA 4KC7A 4OEEA 3WINA 1YYNA 3A23A 3OM2A 1HKNA 3UGHA 1W18A 1Z0HA 4X37A 3ZXKA 4QBVA 1PWAA 3QC2A 4OWKA 5D62A 4ONZA 4KC8A 1BFBA 1DQOA 2YFTA 2ADEA 4N2ZA 2NVHA 1T4QA 4O8NA 4D47A 3AH2A 3WMZA 4AK5A 3VUOA 1NUNA 1DZCA 3PUBA 1Q03A 4KEKA 1ISXA 5FNXA 3CU9A 4G9MA 3NBNA 1W3AA 4UDIA 1OQLB 1V6VA 3PMEA 1EPWA 3LLPA 4GOYA 1WL7A 3ZX7A 2KI6B 3OM7A 1FGAA 1YIFA 3IM5A 1HWNB 1PUUB 4GP0A 3W9TA 1Y7BA 1SR4C 1PZZA 3D7WB 3I29B 4IZEA 1I1BA 2KH2A 3AH4A 4AN7B 4COTA 5B6TA 5FMBA 3ZC8A 1DFCA 4II0A 1L2HA 1Y9GA 3U14A 3BTAA 3N7LA 3D5YA 5ANNA 3RWKX 2RQ9A 1RMLA 3FFZA 1MD6A 2MIBA 4EKXB 5B6SA 1FV2A 2OXBA 3AH1A 3HALA 1ONKB 3FUOA 4LO7B 2IWTB 3NBCA 2DRZA 5JOWA 1TP0A 31BIA 4Q9GA 3CA4A 5FIXA 2F2FC 2X8FA 3R4ZA 2BEAA 3AKGA 1G9BA 4LO3C 4ZFUB 2X8TA 1Z2VA 3WPVA 1IT0A 4QBCA 2L5XA 4UY4A 3S8KA 1P63A 1JTCA 4EQVA 3A21A 2FFUA 5FKCA 2ESUA 3O49A 4I4YA 3H6SE 1HWMB 4XFUA 2QQWA 5FMCA 4ISQA 2NM1A 4ZKTB 1JQZA 3VSSA 3N7KA 4LO1C 3POKA 4USPA 3UD9A 3WO2A 4I37A 3N7MA 3OJVA 4LO0A 4U6DA 5DVHA 1J0SA 4I4QA 5FNWA 3K1UA 2AQZA 1FV3A 4PVIA 2BFHA 4I8MA 4KC3A 2P39A 3UD7A 3UDAA 3WA1A 2VSEA 3BYJA 3D61A 4EFQA 4MLGA 5FK7A 3C7GA 3FJBA 3FJJA 3D5ZA 2Y9GA 4IONA 4AK6A 3O44A 3HMYA 1AVWB 3BX1C 3PHZA 5F8YA 4F83A 1GYDB 4X39A 3AKIA 1UV4A 3BA4A 2AAIB 5JOXA 3LFIA 1TOOA 5BOWA 2NP0A 6I1BA 4H04A 3BAQA 3VWCA 2HWAA 4EB2B 2D23A 3QR5A 4D0TA 5GAQA 3CRGA 4Z9WB 3ZXGA 5BXTA 1OYGA 3HBWA 4J2YA 2MC2A 4PC4A 2ADDA 4QD2B 5EG6C 2D22A 3FJKA 4UDKA 3VSRA 3WN1A 2X2SA 1V6UA 1KNMA 4I4SA 1PC8B 2K4AB 4NOVA 4H9WA 3LV4A 1YXWA 3HN1A 4I0YA 1TTUA 3C7FA 3WPUA 4R6UB 4ZLBB 3I2XA 5AYDA 4AN6A 4FFFA 4FFHA 2HWMA 5AY9A 1YF8B 4ZFWB 3BAGA 4XFTA 2QN4A 1RY7A 5BP5A 2VLCA 1I1EA 4UDKE 5HPZA 2M49A 1G82A 4Q9PA 5FZZA 4ZGRB 3FJHA 1AXMA 2NTDA 3AKHA 3UD8A 2Q3NB 5G00A 3U75A 3OM4A 1DJSB 3FJDA 9ILBA 2D7RA 1VKDA 1YRZA 4L4HA 3FUQA 2Q9XA 1FMMS 4FFGA 3NJ5A 3QEEA 3F62B 2EXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGG A;  1WD4 A;  4P0J A;  4Q91 A;  4FVV A;  1ILR 1;  1JT5 A;  1VCL A;  1XHB A;  3F1R A;  2D43 A;  4ZA3 B;  1Y9M A;  2WRY A;  3FJE A;  4O8O A;  1ISZ A;  3VEQ A;  4HR6 C;  1JLY A;  3WIN C;  3BAU A;  3RMX A;  1K5U A;  3Q7W A;  2Z48 A;  3LTQ A;  3WMV A;  3QYD A;  1XZZ A;  1FN0 A;  2GO2 A;  2B4W A;  4I4V A;  4DEN A;  1CE7 B;  3FJ8 A;  5BXP A;  2Y9X E;  3BRF A;  1W3G A;  1EYL A;  1DQG A;  4USO A;  4G9N A;  5D63 A;  3LIH A;  3EF2 A;  1JT4 A;  4IY8 A;  5JMC A;  5GLO A;  3FJI A;  2P23 A;  2D7I A;  2VU9 A;  1JT3 A;  1S0L A;  3BAD A;  2EXK A;  5FZU A;  2QYI B;  5GLN A;  4LO3 A;  2J3P A;  1UPS A;  3WPY A;  3RTI B;  5F8S A;  1S0C A;  4HA2 A;  2LIE A;  1W2T A;  2AEY A;  4OUJ A;  2Y9W C;  3CAH A;  1N4K A;  3R67 A;  3KMV A;  2FDB M;  4FGF A;  4X3A A;  1FMZ A;  1GGP B;  2F8X C;  1G9A A;  4ZFY B;  4UDG A;  1DLL A;  1ISV A;  4LO2 A;  1DZD A;  2K8R A;  3VT0 A;  3IAG C;  4Z8S B;  2YFR A;  3PG0 A;  4LO1 A;  4I3N A;  4KEI A;  3AJ5 A;  4OW4 A;  2KKI A;  4DCK C;  4END A;  5A7V A;  4I6I A;  2R9K B;  2BEB A;  1BLA A;  4OEG A;  4J2X A;  2QQU A;  3OBT A;  2NYY A;  2D20 A;  3T8S A;  5B2H A;  3OBR A;  1SZ6 B;  4X38 A;  1V6W A;  3ZC9 A;  3RSJ A;  1WBC A;  3CA6 A;  5JLV A;  3OM6 A;  5GLM A;  1BLD A;  3FJA A;  1AVU A;  3TC2 A;  1T9F A;  5BVP I;  4QAL A;  1RG8 A;  4IQP A;  3FGM A;  3ILA A;  2ZQN A;  2DRE A;  3RTJ B;  8I1B A;  1S0B A;  1ITB A;  4OEF A;  3CRH A;  1ISW A;  3QZ4 A;  5A8C A;  3WMU A;  2Y9F A;  1HWP B;  3O4A A;  3A22 A;  1Z4S A;  1AFC A;  2HZ9 A;  4OWL A;  3ZXD A;  3CA0 A;  3VSZ A;  5A8D A;  3FJF A;  2YFS A;  3R4S A;  1Y4W A;  1RZO B;  4TLP A;  1II4 A;  1TFM B;  4F34 A;  4PVA A;  3I2A A;  1IRA X;  5A7V B;  2NZ9 A;  4IY9 A;  3OJM A;  2ZQO A;  3LF7 A;  2GZB A;  2AC1 A;  4JKX B;  3MPP G;  1UYP A;  1BFC A;  1WD3 A;  4O8P A;  2VUA A;  3S8J A;  4QQS A;  1HCE A;  3LEM A;  3ZXJ A;  3O3Q A;  3QED A;  3WN0 A;  3C2U A;  3K1X A;  4LO8 B;  5FLW A;  3OGG A;  1AVA C;  1DFQ A;  4UDJ A;  3AZV A;  3AKF A;  41BI A;  4I96 A;  2X8S A;  3WPZ A;  2IHO A;  5GLL A;  2E4M C;  4QC4 A;  1TWM A;  2VDT A;  3WO3 A;  4GAI A;  3P2N A;  4A7Z A;  3MAL A;  5BQU C;  5GLP A;  1R8N A;  1HIB A;  2D1Z A;  3IM6 A;  3P53 A;  2XOA A;  4P0L A;  1EVT A;  2FGF A;  3VT1 A;  3C9Z A;  3ZXL A;  1BFG A;  4J2K A;  1YTO A;  3P6J A;  4IHZ A;  3BRG C;  5DUY A;  4DEP A;  1BAR A;  4A7Y A;  1MC9 A;  1TWE A;  4AK7 A;  1SR4 A;  5BXS A;  4FFI A;  4I4R A;  3O5W B;  5EC5 A;  1IRP A;  1PUM B;  3SC7 X;  3BYN A;  2DRY A;  4N2R A;  5GLQ A;  4EFR A;  5JOZ A;  1K5V A;  2EXI A;  1S0F A;  3FJ9 A;  3VSF A;  3R4Y A;  4N1I A;  3SNV A;  21BI A;  2VXT I;  2D24 A;  3IM7 A;  2KI4 A;  3H6Q A;  5BP5 C;  3JUT A;  1HWO B;  3E8L C;  2D44 A;  3CA3 A;  4G6M A;  4JRA A;  3WAT A;  5DZU A;  4I4U A;  5EHA A;  3V79 C;  3O4O A;  1DIW A;  3JRR A;  4LO7 C;  4GOV A;  3UJ0 A;  2ET2 A;  2F2F A;  3HOM A;  1D0H A;  5BXR A;  1S0D A;  1YI7 A;  1M16 A;  2KLL A;  4D0Z A;  2YUG A;  1FWV A;  3CU1 B;  1Q04 A;  2X2T A;  3FJC A;  3O4C A;  1TIE A;  2VXR A;  4JP0 A;  1JLX A;  3BAH A;  1QQL A;  4KCA A;  2RST A;  3UGF A;  4EEE B;  3V0B A;  3BA5 A;  3WN2 A;  3BA7 A;  3HSM A;  3D60 A;  1IHK A;  1FWU A;  4G6J A;  3WO4 A;  3KST A;  3KF5 A;  3N7J A;  3BYK A;  3Q7X A;  1IJT A;  4I1B A;  5AYC A;  2DS0 A;  1EV2 A;  1IOB A;  4I2S A;  5JOY A;  1R8O A;  7I1B A;  4D8H A;  4ZOT A;  3WMY A;  3CQA A;  4QO3 A;  2XQR A;  4I4X A;  3V0A A;  3QEF A;  4KMI A;  5F8W A;  3R4U A;  4IYB A;  3BRD A;  3KF3 A;  4ISR A;  3O4D A;  5GLK A;  4P6A A;  3BAV A;  3PIJ A;  4YOL A;  4I4P A;  1ISY A;  4JAW A;  3NBD A;  1GYH A;  5FZY A;  3TAW A;  1W3F A;  4P0K A;  3VT2 A;  1GYE B;  1M2T B;  3NBE A;  3CA1 A;  4I1E A;  3LDK A;  4EFP A;  1QXM A;  4XFS A;  4LO2 C;  1G9D A;  3PIG A;  4J2S A;  5DSS B;  3V0B B;  3A07 A;  1ABR B;  3AJ6 A;  5AYE A;  3NQH A;  3O4B A;  4QD2 C;  1ST8 A;  1S0G A;  2ZR1 B;  3LIG A;  2QQV A;  1S0E A;  4GP3 A;  1Q1U A;  2LIQ A;  3BYL A;  2AEZ A;  3OGF A;  1NZK A;  2VSA A;  3H6R A;  4N4B A;  5GLR A;  1BA7 A;  1JT7 A;  1HCD A;  3OJ2 A;  3P6I A;  5C0P A;  4G1R A;  4QKS A;  1G9C A;  4LO0 C;  2AXM A;  1E0O A;  4CJM A;  5FK8 A;  4HJJ A;  1AF9 A;  2Z49 A;  4XKI A;  4L4I A;  3WAS A;  2E4M A;  4ZBV B;  4KCB A;  1V6X A;  3AZW A;  5BQU A;  4I7I A;  3V0A B;  4A7K A;  2K43 A;  4GAF A;  3C7O A;  2UUS A;  1FQ9 A;  1AVX B;  4JQ0 A;  1XG6 A;  1YBI A;  2MLL B;  3C7E A;  5FMD A;  4WBC A;  1WBA A;  1BFF A;  2FFV A;  1XYF A;  2EXJ A;  1IIL A;  1CVS A;  2WBC A;  4J23 B;  1PT2 A;  2FO1 A;  3LDR A;  3BAO A;  4JKQ A;  4U6B A;  3WAU A;  5I1B A;  5D61 A;  1QQK A;  3OM5 A;  4KBB A;  3Q7Y A;  4OWJ A;  4QKR A;  1BAS A;  5FKB A;  3UJ4 A;  4IZX A;  3N0K A;  3RMY A;  3C7H A;  3CRI A;  5E24 E;  3B9U A;  5F90 A;  1A8D A;  3BB2 A;  3CA5 A;  4KEJ A;  1JY0 A;  3IIR A;  2RG9 B;  4I4O A;  2HW9 A;  2I1B A;  2ERM A;  1F31 A;  3H6R B;  4JPZ A;  2AFG A;  4KC7 A;  4OEE A;  3WIN A;  1YYN A;  3A23 A;  3OM2 A;  1HKN A;  3UGH A;  1W18 A;  1Z0H A;  4X37 A;  3ZXK A;  4QBV A;  1PWA A;  3QC2 A;  4OWK A;  5D62 A;  4ONZ A;  4KC8 A;  1BFB A;  1DQO A;  2YFT A;  2ADE A;  4N2Z A;  2NVH A;  1T4Q A;  4O8N A;  4D47 A;  3AH2 A;  3WMZ A;  4AK5 A;  3VUO A;  1NUN A;  1DZC A;  3PUB A;  1Q03 A;  4KEK A;  1ISX A;  5FNX A;  3CU9 A;  4G9M A;  3NBN A;  1W3A A;  4UDI A;  1OQL B;  1V6V A;  3PME A;  1EPW A;  3LLP A;  4GOY A;  1WL7 A;  3ZX7 A;  2KI6 B;  3OM7 A;  1FGA A;  1YIF A;  3IM5 A;  1HWN B;  1PUU B;  4GP0 A;  3W9T A;  1Y7B A;  1SR4 C;  1PZZ A;  3D7W B;  3I29 B;  4IZE A;  1I1B A;  2KH2 A;  3AH4 A;  4AN7 B;  4COT A;  5B6T A;  5FMB A;  3ZC8 A;  1DFC A;  4II0 A;  1L2H A;  1Y9G A;  3U14 A;  3BTA A;  3N7L A;  3D5Y A;  5ANN A;  3RWK X;  2RQ9 A;  1RML A;  3FFZ A;  1MD6 A;  2MIB A;  4EKX B;  5B6S A;  1FV2 A;  2OXB A;  3AH1 A;  3HAL A;  1ONK B;  3FUO A;  4LO7 B;  2IWT B;  3NBC A;  2DRZ A;  5JOW A;  1TP0 A;  31BI A;  4Q9G A;  3CA4 A;  5FIX A;  2F2F C;  2X8F A;  3R4Z A;  2BEA A;  3AKG A;  1G9B A;  4LO3 C;  4ZFU B;  2X8T A;  1Z2V A;  3WPV A;  1IT0 A;  4QBC A;  2L5X A;  3S8K A;  1P63 A;  1JTC A;  4EQV A;  3A21 A;  2FFU A;  5FKC A;  2ESU A;  3O49 A;  4I4Y A;  3H6S E;  1HWM B;  4XFU A;  2QQW A;  5FMC A;  4ISQ A;  2NM1 A;  4ZKT B;  1JQZ A;  3VSS A;  3N7K A;  4LO1 C;  3POK A;  4USP A;  3UD9 A;  3WO2 A;  4I37 A;  3N7M A;  3OJV A;  4LO0 A;  4U6D A;  5DVH A;  1J0S A;  4I4Q A;  5FNW A;  3K1U A;  2AQZ A;  1FV3 A;  4PVI A;  2BFH A;  4I8M A;  4KC3 A;  2P39 A;  3UD7 A;  3UDA A;  3WA1 A;  2VSE A;  3BYJ A;  3D61 A;  4EFQ A;  4MLG A;  5FK7 A;  3C7G A;  3FJB A;  3FJJ A;  3D5Z A;  2Y9G A;  4ION A;  4AK6 A;  3O44 A;  3HMY A;  1AVW B;  3BX1 C;  3PHZ A;  5F8Y A;  4F83 A;  1GYD B;  4X39 A;  3AKI A;  1UV4 A;  3BA4 A;  2AAI B;  5JOX A;  3LFI A;  1TOO A;  5BOW A;  2NP0 A;  6I1B A;  4H04 A;  3BAQ A;  3VWC A;  2HWA A;  4EB2 B;  2D23 A;  3QR5 A;  4D0T A;  5GAQ A;  3CRG A;  4Z9W B;  3ZXG A;  5BXT A;  1OYG A;  3HBW A;  4J2Y A;  2MC2 A;  4PC4 A;  2ADD A;  4QD2 B;  5EG6 C;  2D22 A;  3FJK A;  4UDK A;  3VSR A;  3WN1 A;  2X2S A;  1V6U A;  1KNM A;  4I4S A;  1PC8 B;  2K4A B;  4NOV A;  4H9W A;  3LV4 A;  1YXW A;  3HN1 A;  4I0Y A;  1TTU A;  3C7F A;  3WPU A;  4R6U B;  4ZLB B;  3I2X A;  5AYD A;  4AN6 A;  4FFF A;  4FFH A;  2HWM A;  5AY9 A;  1YF8 B;  4ZFW B;  3BAG A;  4XFT A;  2QN4 A;  1RY7 A;  5BP5 A;  2VLC A;  1I1E A;  4UDK E;  5HPZ A;  2M49 A;  1G82 A;  4Q9P A;  5FZZ A;  4ZGR B;  3FJH A;  1AXM A;  2NTD A;  3AKH A;  3UD8 A;  2Q3N B;  5G00 A;  3U75 A;  3OM4 A;  1DJS B;  3FJD A;  9ILB A;  2D7R A;  1VKD A;  1YRZ A;  4L4H A;  3FUQ A;  2Q9X A;  1FMM S;  4FFG A;  3NJ5 A;  3QEE A;  3F62 B;  2EXH A; 
#chains in the Genus database with same CATH topology
 3UGG A;  1WD4 A;  4P0J A;  4Q91 A;  4FVV A;  1ILR 1;  1JT5 A;  1VCL A;  1XHB A;  3F1R A;  2D43 A;  4ZA3 B;  1Y9M A;  2WRY A;  3FJE A;  4O8O A;  1ISZ A;  3VEQ A;  4HR6 C;  1JLY A;  3WIN C;  3BAU A;  3RMX A;  1K5U A;  3Q7W A;  2Z48 A;  3LTQ A;  3WMV A;  3QYD A;  1XZZ A;  1FN0 A;  2GO2 A;  2B4W A;  4I4V A;  4DEN A;  1CE7 B;  3FJ8 A;  5BXP A;  2Y9X E;  3BRF A;  1W3G A;  1EYL A;  1DQG A;  4USO A;  4G9N A;  5D63 A;  3LIH A;  3EF2 A;  1JT4 A;  4IY8 A;  5JMC A;  5GLO A;  3FJI A;  2P23 A;  2D7I A;  2VU9 A;  1JT3 A;  1S0L A;  3BAD A;  2EXK A;  5FZU A;  2QYI B;  5GLN A;  4LO3 A;  2J3P A;  1UPS A;  3WPY A;  3RTI B;  5F8S A;  1S0C A;  4HA2 A;  2LIE A;  1W2T A;  2AEY A;  4OUJ A;  2Y9W C;  3CAH A;  1N4K A;  3R67 A;  3KMV A;  2FDB M;  4FGF A;  4X3A A;  1FMZ A;  1GGP B;  2F8X C;  1G9A A;  4ZFY B;  4UDG A;  1DLL A;  1ISV A;  4LO2 A;  1DZD A;  2K8R A;  3VT0 A;  3IAG C;  4Z8S B;  2YFR A;  3PG0 A;  4LO1 A;  4I3N A;  4KEI A;  3AJ5 A;  4OW4 A;  2KKI A;  4DCK C;  4MZF B;  4END A;  5A7V A;  4I6I A;  2R9K B;  2BEB A;  1BLA A;  4OEG A;  4J2X A;  2QQU A;  3OBT A;  2NYY A;  2D20 A;  3T8S A;  5B2H A;  3OBR A;  1SZ6 B;  4X38 A;  1V6W A;  3ZC9 A;  3RSJ A;  1WBC A;  3CA6 A;  5JLV A;  4MZH A;  3OM6 A;  5GLM A;  1BLD A;  3FJA A;  1AVU A;  3TC2 A;  1T9F A;  5BVP I;  4QAL A;  1RG8 A;  2NS2 A;  4IQP A;  3FGM A;  3ILA A;  2ZQN A;  2DRE A;  3RTJ B;  8I1B A;  1S0B A;  1ITB A;  4OEF A;  3CRH A;  1ISW A;  3QZ4 A;  5A8C A;  3WMU A;  2Y9F A;  1HWP B;  3O4A A;  3A22 A;  1Z4S A;  1AFC A;  4H75 A;  2HZ9 A;  4OWL A;  3ZXD A;  3CA0 A;  3VSZ A;  5A8D A;  3FJF A;  2YFS A;  3R4S A;  1Y4W A;  1RZO B;  4TLP A;  1II4 A;  1TFM B;  4F34 A;  4PVA A;  3I2A A;  1IRA X;  5A7V B;  2NZ9 A;  4IY9 A;  3OJM A;  2ZQO A;  3LF7 A;  2GZB A;  2AC1 A;  4JKX B;  3MPP G;  1UYP A;  1BFC A;  1WD3 A;  4O8P A;  2VUA A;  3S8J A;  4QQS A;  1HCE A;  3LEM A;  3ZXJ A;  3O3Q A;  3QED A;  3WN0 A;  3C2U A;  3K1X A;  4LO8 B;  5FLW A;  3OGG A;  1AVA C;  1DFQ A;  4UDJ A;  3AZV A;  3AKF A;  41BI A;  4I96 A;  2X8S A;  3WPZ A;  2IHO A;  5GLL A;  2E4M C;  4QC4 A;  1TWM A;  2VDT A;  3WO3 A;  4GAI A;  3P2N A;  4A7Z A;  3MAL A;  5BQU C;  5GLP A;  1R8N A;  1HIB A;  2D1Z A;  3IM6 A;  3P53 A;  2XOA A;  4P0L A;  1EVT A;  2FGF A;  3VT1 A;  3C9Z A;  3ZXL A;  1BFG A;  4J2K A;  1YTO A;  3P6J A;  4IHZ A;  3BRG C;  5DUY A;  4DEP A;  1BAR A;  4A7Y A;  1MC9 A;  1TWE A;  4AK7 A;  1SR4 A;  5BXS A;  4FFI A;  4I4R A;  3O5W B;  5EC5 A;  1IRP A;  1PUM B;  3SC7 X;  3BYN A;  2DRY A;  4N2R A;  5GLQ A;  4EFR A;  5JOZ A;  1K5V A;  2EXI A;  1S0F A;  3FJ9 A;  3VSF A;  3R4Y A;  4N1I A;  3SNV A;  21BI A;  2VXT I;  2D24 A;  3IM7 A;  2KI4 A;  3H6Q A;  5BP5 C;  3JUT A;  1HWO B;  3E8L C;  2D44 A;  3CA3 A;  4G6M A;  4JRA A;  3WAT A;  5DZU A;  4I4U A;  1TL2 A;  5EHA A;  3V79 C;  3O4O A;  1DIW A;  3JRR A;  4LO7 C;  5C2M A;  4GOV A;  3UJ0 A;  2ET2 A;  2F2F A;  3HOM A;  1D0H A;  5BXR A;  1S0D A;  1YI7 A;  1M16 A;  2KLL A;  4D0Z A;  2YUG A;  1FWV A;  3CU1 B;  1Q04 A;  2X2T A;  3FJC A;  3O4C A;  1TIE A;  2VXR A;  4JP0 A;  1JLX A;  3BAH A;  1QQL A;  4KCA A;  2RST A;  3UGF A;  4EEE B;  3V0B A;  3BA5 A;  3WN2 A;  3BA7 A;  3HSM A;  3D60 A;  1IHK A;  1FWU A;  4G6J A;  3WO4 A;  3KST A;  3KF5 A;  3N7J A;  3BYK A;  3Q7X A;  1IJT A;  4I1B A;  5AYC A;  2DS0 A;  1EV2 A;  1IOB A;  4I2S A;  5JOY A;  1R8O A;  7I1B A;  4D8H A;  4ZOT A;  3WMY A;  3CQA A;  4QO3 A;  2XQR A;  4I4X A;  3V0A A;  3QEF A;  4KMI A;  4MZG B;  3R4U A;  4IYB A;  5F8W A;  3BRD A;  3KF3 A;  4ISR A;  3O4D A;  5GLK A;  4P6A A;  3BAV A;  3PIJ A;  4YOL A;  4I4P A;  1ISY A;  4JAW A;  3NBD A;  1GYH A;  5FZY A;  3TAW A;  1W3F A;  4P0K A;  3VT2 A;  1GYE B;  1M2T B;  3NBE A;  3CA1 A;  4I1E A;  3LDK A;  4EFP A;  1QXM A;  4XFS A;  4LO2 C;  1G9D A;  3PIG A;  4J2S A;  5DSS B;  3V0B B;  3A07 A;  1ABR B;  3AJ6 A;  5AYE A;  3NQH A;  3O4B A;  4QD2 C;  1ST8 A;  1S0G A;  2ZR1 B;  3LIG A;  2QQV A;  1S0E A;  4GP3 A;  1Q1U A;  2LIQ A;  3BYL A;  2AEZ A;  3OGF A;  1NZK A;  2VSA A;  3H6R A;  4N4B A;  5GLR A;  1BA7 A;  1JT7 A;  1HCD A;  3OJ2 A;  3P6I A;  5C0P A;  4G1R A;  4QKS A;  1G9C A;  4LO0 C;  2AXM A;  1E0O A;  4CJM A;  5FK8 A;  4HJJ A;  1AF9 A;  2Z49 A;  4XKI A;  4L4I A;  3WAS A;  2E4M A;  4ZBV B;  4KCB A;  1V6X A;  3AZW A;  5BQU A;  4I7I A;  3V0A B;  4A7K A;  2K43 A;  4GAF A;  3C7O A;  2UUS A;  1FQ9 A;  1AVX B;  4JQ0 A;  1XG6 A;  1YBI A;  2MLL B;  3C7E A;  5FMD A;  4WBC A;  1WBA A;  1BFF A;  2FFV A;  1XYF A;  2EXJ A;  1IIL A;  1CVS A;  2WBC A;  4J23 B;  1PT2 A;  2FO1 A;  3LDR A;  3BAO A;  4JKQ A;  4U6B A;  3WAU A;  5I1B A;  5D61 A;  1QQK A;  3OM5 A;  4KBB A;  3Q7Y A;  4OWJ A;  4QKR A;  1BAS A;  5FKB A;  3UJ4 A;  4IZX A;  3N0K A;  3RMY A;  3C7H A;  3CRI A;  5E24 E;  3B9U A;  5F90 A;  1A8D A;  3BB2 A;  3CA5 A;  4KEJ A;  1JY0 A;  3IIR A;  2RG9 B;  4I4O A;  2HW9 A;  2I1B A;  2ERM A;  1F31 A;  3H6R B;  4JPZ A;  2AFG A;  4KC7 A;  4OEE A;  3WIN A;  1YYN A;  3A23 A;  3OM2 A;  1HKN A;  3UGH A;  1W18 A;  1Z0H A;  4X37 A;  3ZXK A;  4QBV A;  1PWA A;  3QC2 A;  4OWK A;  5D62 A;  4ONZ A;  4KC8 A;  1BFB A;  1DQO A;  2YFT A;  2ADE A;  4N2Z A;  2NVH A;  1T4Q A;  4O8N A;  4D47 A;  3AH2 A;  3WMZ A;  4AK5 A;  3VUO A;  1NUN A;  1DZC A;  3PUB A;  1Q03 A;  4KEK A;  1ISX A;  5FNX A;  3CU9 A;  4G9M A;  3NBN A;  1W3A A;  4UDI A;  1OQL B;  1V6V A;  3PME A;  1EPW A;  3LLP A;  4GOY A;  1WL7 A;  3ZX7 A;  2KI6 B;  3OM7 A;  1FGA A;  1YIF A;  3IM5 A;  1HWN B;  1PUU B;  4GP0 A;  3W9T A;  1Y7B A;  1SR4 C;  1PZZ A;  3D7W B;  3I29 B;  4IZE A;  1I1B A;  2KH2 A;  3AH4 A;  4AN7 B;  4COT A;  5B6T A;  5FMB A;  3ZC8 A;  1DFC A;  4II0 A;  1L2H A;  1Y9G A;  3U14 A;  3BTA A;  3N7L A;  3D5Y A;  5ANN A;  3RWK X;  2RQ9 A;  1RML A;  3FFZ A;  1MD6 A;  2MIB A;  4EKX B;  5B6S A;  1FV2 A;  2OXB A;  3AH1 A;  3HAL A;  1ONK B;  3FUO A;  4LO7 B;  2IWT B;  3NBC A;  2DRZ A;  5JOW A;  1TP0 A;  31BI A;  4Q9G A;  3CA4 A;  5FIX A;  2F2F C;  2X8F A;  3R4Z A;  2BEA A;  3AKG A;  1G9B A;  4LO3 C;  4ZFU B;  2X8T A;  1Z2V A;  3WPV A;  1IT0 A;  4QBC A;  2L5X A;  4UY4 A;  3S8K A;  1P63 A;  1JTC A;  4EQV A;  3A21 A;  2FFU A;  5FKC A;  2ESU A;  3O49 A;  4I4Y A;  3H6S E;  1HWM B;  4XFU A;  2QQW A;  5FMC A;  4ISQ A;  2NM1 A;  4ZKT B;  1JQZ A;  3VSS A;  3N7K A;  4LO1 C;  3POK A;  4USP A;  3UD9 A;  3WO2 A;  4I37 A;  3N7M A;  3OJV A;  4LO0 A;  4U6D A;  5DVH A;  1J0S A;  4I4Q A;  5FNW A;  3K1U A;  2AQZ A;  1FV3 A;  4PVI A;  2BFH A;  4I8M A;  4KC3 A;  2P39 A;  3UD7 A;  3UDA A;  3WA1 A;  2VSE A;  3BYJ A;  3D61 A;  4EFQ A;  4MLG A;  5FK7 A;  3C7G A;  3FJB A;  3FJJ A;  3D5Z A;  2Y9G A;  4ION A;  4AK6 A;  3O44 A;  3HMY A;  1AVW B;  3BX1 C;  3PHZ A;  5F8Y A;  4F83 A;  1GYD B;  4X39 A;  3AKI A;  1UV4 A;  3BA4 A;  2AAI B;  5JOX A;  3LFI A;  1TOO A;  5BOW A;  2NP0 A;  6I1B A;  4H04 A;  3BAQ A;  3VWC A;  2HWA A;  4EB2 B;  2D23 A;  3QR5 A;  4D0T A;  5GAQ A;  3CRG A;  4Z9W B;  3ZXG A;  5BXT A;  1OYG A;  3HBW A;  4J2Y A;  2MC2 A;  4PC4 A;  2ADD A;  4QD2 B;  5EG6 C;  2D22 A;  3FJK A;  4UDK A;  3VSR A;  3WN1 A;  2X2S A;  1V6U A;  1KNM A;  4I4S A;  1PC8 B;  2K4A B;  4NOV A;  4H9W A;  3LV4 A;  1YXW A;  3HN1 A;  4I0Y A;  1TTU A;  3C7F A;  3WPU A;  4R6U B;  4ZLB B;  3I2X A;  5AYD A;  4AN6 A;  4FFF A;  4FFH A;  2HWM A;  5AY9 A;  1YF8 B;  4ZFW B;  3BAG A;  4XFT A;  2QN4 A;  1RY7 A;  5BP5 A;  2VLC A;  1I1E A;  4UDK E;  5HPZ A;  2M49 A;  1G82 A;  4Q9P A;  5FZZ A;  4ZGR B;  3FJH A;  1AXM A;  2NTD A;  3AKH A;  3UD8 A;  2Q3N B;  5G00 A;  3U75 A;  3OM4 A;  1DJS B;  3FJD A;  9ILB A;  2D7R A;  1VKD A;  1YRZ A;  4L4H A;  3FUQ A;  2Q9X A;  1FMM S;  4FFG A;  3NJ5 A;  3QEE A;  3F62 B;  2EXH A; 
#chains in the Genus database with same CATH homology
 3UGG A;  1WD4 A;  4P0J A;  4Q91 A;  4FVV A;  1ILR 1;  1JT5 A;  1VCL A;  1XHB A;  3F1R A;  2D43 A;  4ZA3 B;  1Y9M A;  2WRY A;  3FJE A;  4O8O A;  1ISZ A;  3VEQ A;  4HR6 C;  1JLY A;  3WIN C;  3BAU A;  3RMX A;  1K5U A;  3Q7W A;  2Z48 A;  3LTQ A;  3WMV A;  3QYD A;  1XZZ A;  1FN0 A;  2GO2 A;  2B4W A;  4I4V A;  4DEN A;  1CE7 B;  3FJ8 A;  5BXP A;  2Y9X E;  3BRF A;  1W3G A;  1EYL A;  1DQG A;  4USO A;  4G9N A;  5D63 A;  3LIH A;  3EF2 A;  1JT4 A;  4IY8 A;  5JMC A;  5GLO A;  3FJI A;  2P23 A;  2D7I A;  2VU9 A;  1JT3 A;  1S0L A;  3BAD A;  2EXK A;  5FZU A;  2QYI B;  5GLN A;  4LO3 A;  2J3P A;  1UPS A;  3WPY A;  3RTI B;  5F8S A;  1S0C A;  4HA2 A;  2LIE A;  1W2T A;  2AEY A;  4OUJ A;  2Y9W C;  3CAH A;  1N4K A;  3R67 A;  3KMV A;  2FDB M;  4FGF A;  4X3A A;  1FMZ A;  1GGP B;  2F8X C;  1G9A A;  4ZFY B;  4UDG A;  1DLL A;  1ISV A;  4LO2 A;  1DZD A;  2K8R A;  3VT0 A;  3IAG C;  4Z8S B;  2YFR A;  3PG0 A;  4LO1 A;  4I3N A;  4KEI A;  3AJ5 A;  4OW4 A;  2KKI A;  4DCK C;  4MZF B;  4END A;  5A7V A;  4I6I A;  2R9K B;  2BEB A;  1BLA A;  4OEG A;  4J2X A;  2QQU A;  3OBT A;  2NYY A;  2D20 A;  3T8S A;  5B2H A;  3OBR A;  1SZ6 B;  4X38 A;  1V6W A;  3ZC9 A;  3RSJ A;  1WBC A;  3CA6 A;  5JLV A;  4MZH A;  3OM6 A;  5GLM A;  1BLD A;  3FJA A;  1AVU A;  3TC2 A;  1T9F A;  5BVP I;  4QAL A;  1RG8 A;  2NS2 A;  4IQP A;  3FGM A;  3ILA A;  2ZQN A;  2DRE A;  3RTJ B;  8I1B A;  1S0B A;  1ITB A;  4OEF A;  3CRH A;  1ISW A;  3QZ4 A;  5A8C A;  3WMU A;  2Y9F A;  1HWP B;  3O4A A;  3A22 A;  1Z4S A;  1AFC A;  4H75 A;  2HZ9 A;  4OWL A;  3ZXD A;  3CA0 A;  3VSZ A;  5A8D A;  3FJF A;  2YFS A;  3R4S A;  1Y4W A;  1RZO B;  4TLP A;  1II4 A;  1TFM B;  4F34 A;  4PVA A;  3I2A A;  1IRA X;  5A7V B;  2NZ9 A;  4IY9 A;  3OJM A;  2ZQO A;  3LF7 A;  2GZB A;  2AC1 A;  4JKX B;  3MPP G;  1UYP A;  1BFC A;  1WD3 A;  4O8P A;  2VUA A;  3S8J A;  4QQS A;  1HCE A;  3LEM A;  3ZXJ A;  3O3Q A;  3QED A;  3WN0 A;  3C2U A;  3K1X A;  4LO8 B;  5FLW A;  3OGG A;  1AVA C;  1DFQ A;  4UDJ A;  3AZV A;  3AKF A;  41BI A;  4I96 A;  2X8S A;  3WPZ A;  2IHO A;  5GLL A;  2E4M C;  4QC4 A;  1TWM A;  2VDT A;  3WO3 A;  4GAI A;  3P2N A;  4A7Z A;  3MAL A;  5BQU C;  5GLP A;  1R8N A;  1HIB A;  2D1Z A;  3IM6 A;  3P53 A;  2XOA A;  4P0L A;  1EVT A;  2FGF A;  3VT1 A;  3C9Z A;  3ZXL A;  1BFG A;  4J2K A;  1YTO A;  3P6J A;  4IHZ A;  3BRG C;  5DUY A;  4DEP A;  1BAR A;  4A7Y A;  1MC9 A;  1TWE A;  4AK7 A;  1SR4 A;  5BXS A;  4FFI A;  4I4R A;  3O5W B;  5EC5 A;  1IRP A;  1PUM B;  3SC7 X;  3BYN A;  2DRY A;  4N2R A;  5GLQ A;  4EFR A;  5JOZ A;  1K5V A;  2EXI A;  1S0F A;  3FJ9 A;  3VSF A;  3R4Y A;  4N1I A;  3SNV A;  21BI A;  2VXT I;  2D24 A;  3IM7 A;  2KI4 A;  3H6Q A;  5BP5 C;  3JUT A;  1HWO B;  3E8L C;  2D44 A;  3CA3 A;  4G6M A;  4JRA A;  3WAT A;  5DZU A;  4I4U A;  5EHA A;  3V79 C;  3O4O A;  1DIW A;  3JRR A;  4LO7 C;  4GOV A;  3UJ0 A;  2ET2 A;  2F2F A;  3HOM A;  1D0H A;  5BXR A;  1S0D A;  1YI7 A;  1M16 A;  2KLL A;  4D0Z A;  2YUG A;  1FWV A;  3CU1 B;  1Q04 A;  2X2T A;  3FJC A;  3O4C A;  1TIE A;  2VXR A;  4JP0 A;  1JLX A;  3BAH A;  1QQL A;  4KCA A;  2RST A;  3UGF A;  4EEE B;  3V0B A;  3BA5 A;  3WN2 A;  3BA7 A;  3HSM A;  3D60 A;  1IHK A;  1FWU A;  4G6J A;  3WO4 A;  3KST A;  3KF5 A;  3N7J A;  3BYK A;  3Q7X A;  1IJT A;  4I1B A;  5AYC A;  2DS0 A;  1EV2 A;  1IOB A;  4I2S A;  5JOY A;  1R8O A;  7I1B A;  4D8H A;  4ZOT A;  3WMY A;  3CQA A;  4QO3 A;  2XQR A;  4I4X A;  3V0A A;  3QEF A;  4KMI A;  4MZG B;  3R4U A;  4IYB A;  5F8W A;  3BRD A;  3KF3 A;  4ISR A;  3O4D A;  5GLK A;  4P6A A;  3BAV A;  3PIJ A;  4YOL A;  4I4P A;  1ISY A;  4JAW A;  3NBD A;  1GYH A;  5FZY A;  3TAW A;  1W3F A;  4P0K A;  3VT2 A;  1GYE B;  1M2T B;  3NBE A;  3CA1 A;  4I1E A;  3LDK A;  4EFP A;  1QXM A;  4XFS A;  4LO2 C;  1G9D A;  3PIG A;  4J2S A;  5DSS B;  3V0B B;  3A07 A;  1ABR B;  3AJ6 A;  5AYE A;  3NQH A;  3O4B A;  4QD2 C;  1ST8 A;  1S0G A;  2ZR1 B;  3LIG A;  2QQV A;  1S0E A;  4GP3 A;  1Q1U A;  2LIQ A;  3BYL A;  2AEZ A;  3OGF A;  1NZK A;  2VSA A;  3H6R A;  4N4B A;  5GLR A;  1BA7 A;  1JT7 A;  1HCD A;  3OJ2 A;  3P6I A;  5C0P A;  4G1R A;  4QKS A;  1G9C A;  4LO0 C;  2AXM A;  1E0O A;  4CJM A;  5FK8 A;  4HJJ A;  1AF9 A;  2Z49 A;  4XKI A;  4L4I A;  3WAS A;  2E4M A;  4ZBV B;  4KCB A;  1V6X A;  3AZW A;  5BQU A;  4I7I A;  3V0A B;  4A7K A;  2K43 A;  4GAF A;  3C7O A;  2UUS A;  1FQ9 A;  1AVX B;  4JQ0 A;  1XG6 A;  1YBI A;  2MLL B;  3C7E A;  5FMD A;  4WBC A;  1WBA A;  1BFF A;  2FFV A;  1XYF A;  2EXJ A;  1IIL A;  1CVS A;  2WBC A;  4J23 B;  1PT2 A;  2FO1 A;  3LDR A;  3BAO A;  4JKQ A;  4U6B A;  3WAU A;  5I1B A;  5D61 A;  1QQK A;  3OM5 A;  4KBB A;  3Q7Y A;  4OWJ A;  4QKR A;  1BAS A;  5FKB A;  3UJ4 A;  4IZX A;  3N0K A;  3RMY A;  3C7H A;  3CRI A;  5E24 E;  3B9U A;  5F90 A;  1A8D A;  3BB2 A;  3CA5 A;  4KEJ A;  1JY0 A;  3IIR A;  2RG9 B;  4I4O A;  2HW9 A;  2I1B A;  2ERM A;  1F31 A;  3H6R B;  4JPZ A;  2AFG A;  4KC7 A;  4OEE A;  3WIN A;  1YYN A;  3A23 A;  3OM2 A;  1HKN A;  3UGH A;  1W18 A;  1Z0H A;  4X37 A;  3ZXK A;  4QBV A;  1PWA A;  3QC2 A;  4OWK A;  5D62 A;  4ONZ A;  4KC8 A;  1BFB A;  1DQO A;  2YFT A;  2ADE A;  4N2Z A;  2NVH A;  1T4Q A;  4O8N A;  4D47 A;  3AH2 A;  3WMZ A;  4AK5 A;  3VUO A;  1NUN A;  1DZC A;  3PUB A;  1Q03 A;  4KEK A;  1ISX A;  5FNX A;  3CU9 A;  4G9M A;  3NBN A;  1W3A A;  4UDI A;  1OQL B;  1V6V A;  3PME A;  1EPW A;  3LLP A;  4GOY A;  1WL7 A;  3ZX7 A;  2KI6 B;  3OM7 A;  1FGA A;  1YIF A;  3IM5 A;  1HWN B;  1PUU B;  4GP0 A;  3W9T A;  1Y7B A;  1SR4 C;  1PZZ A;  3D7W B;  3I29 B;  4IZE A;  1I1B A;  2KH2 A;  3AH4 A;  4AN7 B;  4COT A;  5B6T A;  5FMB A;  3ZC8 A;  1DFC A;  4II0 A;  1L2H A;  1Y9G A;  3U14 A;  3BTA A;  3N7L A;  3D5Y A;  5ANN A;  3RWK X;  2RQ9 A;  1RML A;  3FFZ A;  1MD6 A;  2MIB A;  4EKX B;  5B6S A;  1FV2 A;  2OXB A;  3AH1 A;  3HAL A;  1ONK B;  3FUO A;  4LO7 B;  2IWT B;  3NBC A;  2DRZ A;  5JOW A;  1TP0 A;  31BI A;  4Q9G A;  3CA4 A;  5FIX A;  2F2F C;  2X8F A;  3R4Z A;  2BEA A;  3AKG A;  1G9B A;  4LO3 C;  4ZFU B;  2X8T A;  1Z2V A;  3WPV A;  1IT0 A;  4QBC A;  2L5X A;  4UY4 A;  3S8K A;  1P63 A;  1JTC A;  4EQV A;  3A21 A;  2FFU A;  5FKC A;  2ESU A;  3O49 A;  4I4Y A;  3H6S E;  1HWM B;  4XFU A;  2QQW A;  5FMC A;  4ISQ A;  2NM1 A;  4ZKT B;  1JQZ A;  3VSS A;  3N7K A;  4LO1 C;  3POK A;  4USP A;  3UD9 A;  3WO2 A;  4I37 A;  3N7M A;  3OJV A;  4LO0 A;  4U6D A;  5DVH A;  1J0S A;  4I4Q A;  5FNW A;  3K1U A;  2AQZ A;  1FV3 A;  4PVI A;  2BFH A;  4I8M A;  4KC3 A;  2P39 A;  3UD7 A;  3UDA A;  3WA1 A;  2VSE A;  3BYJ A;  3D61 A;  4EFQ A;  4MLG A;  5FK7 A;  3C7G A;  3FJB A;  3FJJ A;  3D5Z A;  2Y9G A;  4ION A;  4AK6 A;  3O44 A;  3HMY A;  1AVW B;  3BX1 C;  3PHZ A;  5F8Y A;  4F83 A;  1GYD B;  4X39 A;  3AKI A;  1UV4 A;  3BA4 A;  2AAI B;  5JOX A;  3LFI A;  1TOO A;  5BOW A;  2NP0 A;  6I1B A;  4H04 A;  3BAQ A;  3VWC A;  2HWA A;  4EB2 B;  2D23 A;  3QR5 A;  4D0T A;  5GAQ A;  3CRG A;  4Z9W B;  3ZXG A;  5BXT A;  1OYG A;  3HBW A;  4J2Y A;  2MC2 A;  4PC4 A;  2ADD A;  4QD2 B;  5EG6 C;  2D22 A;  3FJK A;  4UDK A;  3VSR A;  3WN1 A;  2X2S A;  1V6U A;  1KNM A;  4I4S A;  1PC8 B;  2K4A B;  4NOV A;  4H9W A;  3LV4 A;  1YXW A;  3HN1 A;  4I0Y A;  1TTU A;  3C7F A;  3WPU A;  4R6U B;  4ZLB B;  3I2X A;  5AYD A;  4AN6 A;  4FFF A;  4FFH A;  2HWM A;  5AY9 A;  1YF8 B;  4ZFW B;  3BAG A;  4XFT A;  2QN4 A;  1RY7 A;  5BP5 A;  2VLC A;  1I1E A;  4UDK E;  5HPZ A;  2M49 A;  1G82 A;  4Q9P A;  5FZZ A;  4ZGR B;  3FJH A;  1AXM A;  2NTD A;  3AKH A;  3UD8 A;  2Q3N B;  5G00 A;  3U75 A;  3OM4 A;  1DJS B;  3FJD A;  9ILB A;  2D7R A;  1VKD A;  1YRZ A;  4L4H A;  3FUQ A;  2Q9X A;  1FMM S;  4FFG A;  3NJ5 A;  3QEE A;  3F62 B;  2EXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...