2ADDA

Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with sucrose
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
537
structure length
537
Chain Sequence
QIEQPYRTGYHFQPPSNWMNDPNGPMLYQGVYHFFYQYNPYAATFGDVIIWGHAVSYDLVNWIHLDPAIYPTQEADSKSCWSGSATILPGNIPAMLYTGSDSKSRQVQDLAWPKNLSDPFLREWVKHPKNPLITPPEGVKDDCFRDPSTAWLGPDGVWRIVVGGDRDNNGMAFLYQSTDFVNWKRYDQPLSSADATGTWECPDFYPVPLNSTNGLDTSVYGGSVRHVMKAGFEGHDWYTIGTYSPDRENFLPQNGLSLTGSTLDLRYDYGQFYASKSFFDDAKNRRVLWAWVPETDSQADDIEKGWAGLQSFPRALWIDRNGKQLIQWPVEEIEELRQNQVNLQNKNLKPGSVLEIHGIAASQADVTISFKLEGLKEAEVLDTTLVDPQALCNERGASSRGALGPFGLLAMASKDLKEQSAIFFRVFQNQLGRYSVLMCSDLSRSTVRSNIDTTSYGAFVDIDPRSEEISLRNLIDHSIIESFGAGGKTCITSRIYPKFVNNEEAHLFVFNNGTQNVKISEMSAWSMKNAKFVVDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords fructan 1-exohydrolase IIa
publication title Insights into the fine architecture of the active site of chicory fructan 1-exohydrolase: 1-kestose as substrate vs sucrose as inhibitor.
pubmed doi rcsb
source organism Cichorium intybus
total genus 147
structure length 537
sequence length 537
ec nomenclature ec 3.2.1.153: Fructan beta-(2,1)-fructosidase.
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 2addA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2addA01
3OM7A 3LIGA 1OYGA 4N4BA 4UFIA 5FIXA 5GLQA 4KC7A 3R67A 3PIGA 2YFRA 4ONZA 3U75A 3C7GA 5GLRA 3R4ZA 3AKHA 2AEYA 3WN0A 3VSRA 4KMIA 5FKBA 3KSTA 3C7HA 3KF5A 4O8NA 3ZXJA 5A8DA 3VSSA 3LEMA 3C7FA 3C2UA 3D61A 1YIFA 3AKIA 3WPYA 4FFHA 4U6DA 5GLKA 4O8PA 3LDKA 3D5YA 2XQRA 5A8CA 5AYDA 1Y9MA 4UDIA 3D60A 4B1LA 3KF3A 5JOWA 3U1XA 3QEEA 3WN2A 5B6SA 4U6BA 4UDJA 1YRZA 5FMCA 1UV4A 1UYPA 4CCEA 5FKCA 4AZZA 1GYDB 4UFKA 5FK7A 4CCDA 3RWKX 3AKGA 3QC2A 3QEDA 3WATA 4AK5A 3OSDA 3IMMA 5FMBA 4O8OA 3WPUA 4N2ZA 3OM4A 2YFTA 5FLWA 4COTA 1PT2A 3QEFA 5FMDA 1Y7BA 4QQSA 5GLOA 2EXIA 2X8FA 1Y9GA 4UFJA 4KCAA 4PVAA 3ZXKA 3WN1A 3LIHA 4AK7A 2EXJA 4UDKA 3OM2A 4UFHA 1GYEB 5AYEA 2X8TA 3C7OA 3LFIA 3BYKA 3PIJA 3BYNA 3WMYA 3NMBA 3H3LA 3SC7X 3VT2A 3K1UA 3S5QA 4D47A 2EXKA 3UGHA 3P2NA 4N1IA 4FFGA 3WPVA 2ADEA 3TAWA 5GLPA 3LDRA 2EXHA 2VDTA 3LF7A 3QZ4A 3VT1A 3WPZA 3VT0A 4NOVA 2B4WA 4UFMA 5A7VA 1WL7A 5FK8A 4N2RA 3D5ZA 3HBKA 2YFSA 3OM5A 4MLGA 3NQHA 3LV4A 4PVIA 1VKDA 4KCBA 1W2TA 5AY9A 4EQVA 2AC1A 3UGGA 3WASA 1ST8A 1YI7A 4UDKE 4KC8A 5JOYA 2QQWA 1Y4WA 2X8SA 3ZXLA 3AKFA 4JQTA 4B1MA 3VSZA 2QQVA 2OXBA 5C0PA 1GYHA 5GLMA 3WMZA 3ZR6A 4CCCA 3ZR5A 5AYCA 3R4YA 4UFLA 1W18A 2AEZA 3C7EA 2QQUA 3VSFA 3OM6A 4QHZA 5GLNA 4AK6A 3BYJA 5A7VB 3BYLA 4UDGA 5JOXA 5GLLA 4FFFA 5B6TA 3UGFA 4FFIA 4HXCA 3CU9A 3WAUA 5JOZA 3U14A 2ADDA 5ANNA
chains in the Genus database with same CATH superfamily
1SPPA 2Q4SA 1HJGA 1I3HA 2WRAA 1VBC3 4XFIA 1UY4A 1RUH1 2D6KA 3BCWA 4UFIA 3SISA 4IUGA 2P34A 2NMOA 4ZU5A 5FLIA 4AAPA 1GUIA 5LA9A 5CFDB 1JU4A 2PHUA 1EP0A 1HQWA 2RS51 1YJKA 3ZFGA 2G19A 4XJZA 4O7XA 1W9YA 5FZHA 3WF2A 3ZXJA 1REDA 2GNDA 3I3DA 1A8DA 4JTOA 5C4WB 4GMP1 5D8AB 3N9MA 1HIXA 1MZEA 3QD6A 4BQXA 2O1QA 3NO8A 3WPYA 4OZOA 3ACIA 3OY8A 2Y33A 2PHXA 4N43C 2WAOA 1CAXA 2K0GA 5ABJA 1JUIA 5BY5A 4GB32 4XQDA 3UYJA 4ZS3A 4O8PA 3LDKA 1FAYA 3N9QA 3VHPA 4OHWA 1RYYA 3N7LA 2VUCA 1AX2A 1XPWA 1NCQC 3V0BB 5JZGB 2RMU3 2VVEA 1RUD1 1K5JA 3A23A 4OUMA 1W3VA 2AACA 3ZFEB 1W90A 4MV2A 2E51A 1GBGA 2X53S 4A45A 1KITA 2HWC1 4AZZA 4TXWA 1KFUL 4BOWA 1Q5OA 3QEDA 2IUWA 5EJZB 3H42B 1W8TA 3H8RA 4OZXA 4Q4Y3 1D4M2 3KCCA 2Y6GA 2YFUA 1XSRA 1HB1A 4XAEA 5F3GA 4I0BA 1WUVA 1XOYA 2XGXA 2VCBA 1RL3A 3M3IA 4QQOA 3WDWA 4IEVA 4XZPA 2JICA 4LHKA 4UDKA 1OT5A 1V70A 4MGKE 5JSOA 1KS5A 3AMHA 1LGBA 2HWE2 2JB8A 3H3LA 3NAPA 5DDJ2 5FLHA 1H1IA 1W2UA 2KR2A 2ZEZA 4P9JA 4L9BA 3SC7X 3FHIB 3N36A 4CDUB 1FOD3 4D47A 1QH7A 2D7FA 3E5QA 1ZM1A 3M3OA 3WPVA 4WM7A 1QNYA 2RS33 2ZGTA 3DXTA 3OF1A 4E4ZA 2R0HA 3DYMA 3RYRA 1QMJA 4BZ4A 3WQ0A 5FY5A 2LTNA 4XF0A 3RNSA 1LENA 1RHI3 4IEYA 1E5RA 1YC61 3O12A 4DXZA 2P5BA 5IYYA 3VBUC 4I09A 4Y3OA 1RUJ2 5J37A 1IPJA 4E8DA 3LV4A 1R1A3 3OJBA 3VDCA 4AVAA 3J8F2 3NJXA 4DRRA 4MXVA 1PZ7A 3BIEA 5IW0A 4FQZA 4QD2A 2QQWA 3SNMA 1S2BA 4M0NA 1I6XA 4O65A 5C3PA 1X9PA 2QQKA 3WR0A 2ZHNA 4UT5A 4UOJA 1CAWB 2OT7A 1GZWA 1W9TA 4MADA 4ONUA 4Q4W3 3VKLA 4BDVB 3OPTA 3TEXA 5H9RA 3PVBB 1DGLA 2EIBA 3MIGA 5BNOC 3M7AA 4QHZA 4RHV3 4RQPC 1IS4A 5J7MA 1MVQA 3BYLA 1W6MB 3VBOB 5IT6A 2ATFA 4KBZA 2PHFA 4FFIA 2VOXA 4DZGA 3ZN6B 1NQDA 4NIGA 4XJAA 1WD3A 2RM22 1EV12 5JPMB 1OYGA 2GMPA 4IESA 2BOIA 1Q8VA 1AXKA 2LM3A 3BVCA 3IAQA 4QHBA 2HWB1 1PO22 1SBEA 2JG9B 3FBYA 4JGZA 4D7TA 3WLUA 4QB1A 2F17A 1JH5A 1I9RA 4DXRA 1RC6A 1C8M1 5A7PA 4GMP0 4KMIA 1REFA 5FKBA 1H2LA 3KSTA 4UF0B 1XYPA 1J84A 1HV0A 1RMU2 3FLPA 1W2NA 3LEMA 1ZBA2 1WW4A 2IXKA 4DMIA 2WDBA 4PF1A 3D61A 5IWFA 1UD1A 4LT5A 4YVSA 1VRBA 2W2IA 3SITA 2WNOA 4HLTA 3O0XA 4CDWC 4N90A 1YIPA 4FFHA 3VZMA 1QF3A 4J6GA 3SEEA 2HKXA 2WWUA 2GDFA 4AAXA 1R64A 1OLME 4FPYA 2A6XA 1ND3C 3THPA 4AQ2A 3O1OA 4C1WA 4N7IA 4QKDA 4NHXA 2PLV3 3VZKA 2EALA 4Y1XA 1GP6A 5LRSA 4PF5A 4UFKA 1BEV3 4YW7A 2E7TA 1O5UA 4NN0A 4XMIA 1K45A 1AR91 5DZEA 1GSLA 2RVAA 2XJTA 2GN7A 2D3RA 5LY2A 3N7JA 5D1IA 2FCUA 2W1SA 1LHOA 2YU2A 5JXGA 1AYM1 5L7OA 4Q4X1 4JGYA 3SH4A 4N53A 2DU1A 2GZWA 4UW6A 3WOGA 4XDQA 2LALA 4AFBA 4BIOA 1VBE3 2XXZA 1H9PA 1TE1B 2BGPA 1OF3A 3FZ3A 4RL7A 1JYVA 4YVWC 2DU0A 2W39A 5DAVA 1V6KA 2CAVA 1Z7S1 3AKQA 4NHKA 3R4DB 4P14A 4C8DA 4Z92B 4CP2A 2GALA 2VR4A 4LMFA 1RUF1 2KD7A 1S0DA 1URXA 3Q8CA 2ENRA 5FJKA 1IS3A 2A3WA 1QY4A 2Y6FA 1FI2A 3PTYA 3KV4A 4JDNA 3N3HA 4MGIE 2YFSA 3NV4A 2ARCA 1I5ZA 4FP2A 4TLFA 4CU8A 4KL1A 2ZA9A 3CJIC 4AQTA 4YGBA 3B94A 2YB7A 4AEDC 4QX0A 5FY9A 2Q8CA 3H7YA 2VO5A 2YYOA 3W9AA 1PMJX 3PHMA 4XETA 5K0UC 2ZAAA 4PI0A 4Y4YA 2ET7A 1UOBA 3VSZA 5FBZA 1DZRA 2TBVA 4P5YA 2QJVA 4IV1A 5A3UA 4XFFA 4Z2AA 1JZ6A 5AYCA 3ZPOA 3VZNA 3WW1A 1S2EA 1XNTA 3VDDC 1D4M3 1YXWA 1O4ZA 2QDRA 2P1BA 2Y0IA 4GKYA 5LBBA 3OYWA 3PVOA 3RG0A 5AFBA 4UDGA 2E31A 2PAEA 5JOXA 5FUIA 2V5YA 3WY6A 3GM8A 5B6TA 1ZVFA 1ZBE2 1YCIA 2DUQA 3PU3A 1SPPB 2VU9A 4QXCA 3AK0A 1XNCA 3WHTA 4N8MA 1H1AA 3ZDVA 2ZGKA 2Y6HA 5GLQA 3VKMA 4N9HA 3SXWA 3HWJA 1MACA 4PCRA 3PIGA 1GWKA 4BQ2A 2DCTA 4YGDA 3ZXDA 1NZCA 1QJX2 2XWJB 4XMAA 2RE9A 1BMV2 2R6QA 1WMDA 2WLQA 4IGOA 4FCAA 3ZFGB 3NWKA 4GWIA 5F8PA 1SDWA 4LUKA 4UAPA 4AHYA 4L8QA 5GM0A 5CAZA 3P5BA 5FPLA 5GJ6A 3CNAA 1MS5A 5HV0A 4WM8A 3HPNA 5HCFA 5JXHA 4FT8A 5A8DA 2JDPA 1RUJ3 1W0OA 3CL1A 3AXEA 2C0ZA 4YZ4A 4GB31 3DN7A 3RZZA 4GAZA 4PLMA 2VCMA 2JDZA 3WP5A 1RUI2 4QB2A 5ABJB 3KB5A 1TME1 2V73A 1LJ7A 3IZOA 3SCGA 4CCOA 5LW9A 4TSVA 4LO5B 3ZSJA 1X7NA 3THTA 5FPUA 1QGLA 3N4MA 4CDXB 3KF3A 2J42A 2FDFA 3RZGA 1POV3 4R8HA 3LEIA 3RDIA 3WDUA 1TL2A 4W6YA 4F8AA 2WJSA 5FY7A 1ULGA 4ASMB 1PHMA 1UZWA 1AR62 2BVVA 1OD3A 3OGGA 5FQ0B 5KWRA 3H1YA 5JIAA 1NQJA 2XLGA 4D7SA 1VB2A 3ZFFC 3ALQA 2MPFA 4XZUG 2W91A 3ZOIA 3VKNA 1LAJA 2WWJA 5L19A 1Y7BA 4QQSA 5LATA 4OULA 1YQ2A 3M3EA 2ZGRA 3AMMA 1G9FA 5A7QA 3H3ZA 4CEYC 2RM23 1J1TA 4C0HA 3ROUA 4R9CA 5GLZA 1VBA2 2D93A 3N9OA 3WNMA 1D0GA 1NE4A 4GZ9A 4QPIC 2E6VA 3NAPB 3WMYA 3MYXA 5LK5A 3K1UA 3A22A 3S5QA 2PQSA 2YC2A 1KRIA 1XYNA 3MIEA 4WM7B 1WW6A 5A6XA 3UJQA 3U0ZA 1HX6A 3MW2A 2D5FA 5GALA 2UURA 4YZ1A 1RMU3 5HBAA 2JE7A 1W8NA 4XUOA 4LLFA 1UXZA 2HYXA 1LGNA 1C8NA 3HBKA 4AFCA 3J8F1 4DY3A 4MLGA 1ND2A 4Y5SA 2VBBA 4QHOA 4YGEA 2JECA 3NVCA 4MXWB 1SEFA 4HBNA 5JXJA 3H1MA 3GZUC 4Q27A 1J58A 3WG1A 3WNNA 2Y8KA 1N3PA 1OH3A 4OMDA 1VIWB 1WCUA 2WFF1 3U10A 2B46X 2ET1A 5BNQA 3E5UA 3GBFA 2QBXA 2ZKNA 5FZBA 4MG2A 3WMZA 5BNPC 2E26A 1MS4A 2Y6KA 3P3NA 3ZR6A 5BNNA 2MNGA 5FYBA 4CRQA 2RJKA 2Q1ZB 1SZBA 2X10A 1CGPA 2WS93 3JD73 2Y6LA 3IDEA 3HQXA 1CVNA 4FPHA 1O6UA 2VBPA 3AVSA 4NR1A 1MS9A 1XC6A 2VW0A 3FE5A 3IDBB 3CZJA 1XU1A 3GBWA 4XBQA 5GKAC 1AR73 4DUWA 3UKTA 3KGZA 2IXJA 4R9AA 2DUOA 4RS5A 2CWSA 2ADDA 3D4KA 2JG8C 3R05A 3JZVA 3I3MA 2NM1A 2WZEA 1BKZA 1LHUA 3BOPA 4ZS2A 2E7QA 3VD9A 1QH6A 4I01A 4S2GA 2J7MA 4TWTA 1SLTA 4I0AA 3ME2A 3SHRA 3VHNA 3WZ1A 2VE1A 2GNMA 2KA3A 3K3NA 3BKZA 1UXXX 4CP1A 3MF9A 5C9AB 1B09A 1IOAA 2PQQA 3RRDA 3CDZB 1HN1A 4ZY9A 2BGOA 1UCXA 1WLWA 3HJRA 3HN1A 1VE0A 3LB9A 5FXWA 3U07A 1B35B 4B29A 4BMBA 1YYNA 4BLJA 4DUVA 1V0AA 4MGSA 4B3NA 2KXLA 3OGVA 1R1ZA 5M0TA 1PGW1 4YVSB 5JLVA 2EAAA 1D2SA 3M3QA 1JYWA 1T6GC 2XJPA 4P08A 3JQWA 1W03A 4BQ1A 4CXYA 2ID4A 1UAIA 2XUMA 3HNMA 1IPSA 1OBNA 1DZTA 2AR6A 2XQRA 3IN9A 3D60A 5JWPA 3E6DA 1OOPB 4FTEA 1OOPC 3Q8BA 2ZKLA 4LXLA 4P9XA 3DPRB 5F5QA 4E2GA 4UDJA 2A6YA 2WNVA 1DGRA 1OA4A 4EN7B 3R4UA 3VZJA 1PGSA 4H14A 1QDCA 3MPBA 2ZACA 2YZ4A 3RVHA 5AC93 5D21A 3I2HA 2WQZC 2JWPA 1ZBE3 3SQOA 1Y9GA 1J1LA 4BXFA 3ZXKA 2P17A 3WN1A 2Y60A 2FD8A 4LE3A 1AL22 3HNYM 1DQ5A 4Q1PA 3RZMA 3CIHA 2W9XA 4JRLA 2CDPA 3AKPA 4LK6A 4YW6A 5FBJA 5G05L 2FDKA 1PMHX 3R4SA 1E5HA 1F35A 3NL1A 1VRH2 4TN7A 4NHMA 1QJX3 4MSVA 2WO7A 4YLZA 3UT0A 4M4RA 2TNFA 1RGSA 3I97A 3PUQA 4FFGA 4DEQA 4PIZA 4RA0A 4XFGA 5T5OA 2ADEA 2CGPA 3TRSB 4QPWA 2VD7A 3LDRA 2F4LA 2WSVA 3ACLA 1UKRA 1F31A 2Y64A 3OD0A 5L73A 2AENA 3VB9A 4EV0A 4OI0A 1SCSA 1PGL2 4NOVA 1FPN2 4XURA 5DQ0A 1UOGA 2XJUA 2B8MA 2OIIA 2R041 1RUI3 4AEJA 4YRDA 2OS2A 1VBD2 4N43A 2VQAA 4AYUA 1XJAA 2BQPA 1WBLA 4QPGC 2ORZA 3ELNA 3FUOA 3T1MA 1FNZA 4FP3A 1G9BA 1NCQA 4ES8A 5HCHA 1KQRA 1RB8G 5A3OA 4PIYA 1Y3TA 4QKNA 3WV6A 3ZYRA 2VW2A 4B1MA 2OPWA 1VBC2 2VMIA 3WW4A 3AYDA 1WGPA 1W6OB 4C0BA 4XTPA 2PHRA 4ZPIA 2VNVA 3U11A 1K5MB 5FZ9A 2IXHA 1BHGA 3UKNA 5LASA 1WMEA 3WG4A 4Y1UA 5A7WB 1A3KA 5DAXA 5F3IA 3USSA 5F32A 1UZVA 4JDMA 3VDBA 1JOBA 5C8CB 2Y6JA 3ZSKA 4CTEA 2WINB 4CPBD 3BTAA 4U36A 1OD5A 4LE4A 3TN91 3WW2A 1VBA3 1CAVB 2A70A 2OQ7A 4LO7A 4FPGA 2UY9A 1GOHA 4I0WB 5F39A 1AHSA 5IVYA 5SV5A 1K12A 4HFSA 4IQPA 1YFYA 3KVAA 4XUPA 3FLRA 3LKJA 4KC7A 1DZQA 2HWF2 4IE0A 1YUDA 4XC9A 5DAQA 3JBG1 4PQ9A 4Y33A 4L11A 4G9SB 5C33A 1PIV1 1T6BX 1STMA 1UPIA 2RDQA 2RMU2 1W28A 4GWMA 4Y24A 1HN0A 4CDQA 1DP0A 3VSRA 4DRVA 2A5ZA 2B42B 4AFMA 2Q0AA 3FJSA 4IE7A 2P6CA 5FZOA 5IK5A 3VSSA 4OLLA 1CJPA 4Q0SA 4YWAA 5FZGA 4UI9L 3WQ1A 4HK9A 2BNOA 5F7UA 1COV2 4ZXEA 3DCQA 2UYBA 4HPKB 3VGIA 4GD4A 4LTAA 1NCRC 1XNKA 3MIBA 5DAPA 4D3WA 1HQLA 1Q8PA 2IVIB 3E5XA 2VCCA 4QT6A 2WR9A 4B4RA 2OZ6A 2O0OA 4Y1ZA 5FOJB 5EJ1B 5IK8A 2X29A 5FP8A 2SBAA 1HV1A 1UF2C 2W52A 3UNPA 2G9ZA 1GMMA 3L2HA 4LBKA 1VMJA 4AK5A 5BNOA 1I5PA 3POIA 5CFCB 2WNUA 4O8OA 3AZVA 2EVXA 2CL2A 3KM5A 2RS32 2D6OX 5IAVA 2R072 4UW5A 3M8LA 5J36A 3E97A 4PVAA 1RHI2 5DXDA 5AFEA 1PK6C 5FV3A 1PO11 4HOOA 1R1A2 3LFIA 2B7YA 1X8EA 5FXZA 3N9LA 1PVC2 2E9QA 3POGA 4XUQA 4IERA 4Y26A 5F6KA 3GJAA 2PHTA 1AZDA 2OQ6A 2QQNA 4XXAA 5FYTA 4Y1YA 1VAMA 3RSJA 4E4SA 4W65A 2VZOA 1RUC1 3GBGA 3HQRA 3T2QA 5I8YA 2P6HA 2VQUA 4LEJA 2GMMA 2BGCA 4FPKA 1ND2B 4HKOA 1Q8QA 2WT0A 4D6RA 2QQMA 2CGNA 5ACA2 4CDWA 3WUCA 2R0FA 1VR3A 1YHFA 3CJXA 4RHV2 1V6IA 1UYZA 3FMGA 3OGSA 1LRHA 1QQP1 5FJHA 1TMF3 3MV11 2AC1A 1H8VA 3LAGA 5CKNA 2VZ3A 1XBFA 1ND3A 1QNWA 4W4ZA 5JOYA 1LCLA 3BYWA 3UJOA 4CEWA 3JUUA 1XU2A 2DVAA 2VGDA 3ATGA 4LKEA 4Y20A 4Q2FA 4BQ4A 1S55A 4K8RB 3LA7A 5BNNB 4XYXA 1OPMA 1PMIA 2ARAA 5E6HA 4XAAA 3S0MA 2JD9A 2AH2A 2AEZA 2AUYA 1F5FA 3VBFB 1SBFA 2DVGA 4RGAA 1CZVA 2QVSB 3VBFC 4O9EA 4HKWA 4EWAA 5LBCA 1K42A 1WA4A 2VXJA 1BZWA 1UL9A 2JENA 5FWEA 5FZFA 1UZYA 4RS5B 2E33A 1MR5A 5FP3A 1MQTB 2VVDA 4Y4RA 4YARA 4YG0A 1MQTC 4IDZA 5IFPA 1JYTA 3BGAA 3ON7A 4H3WA 2Q8OA 5F3CA 5I0SA 2D3PA 1X8MA 4YVWA 5DZFA 3UV9A 4JKKA 4COWA 1JU3A 2EAKA 5FYHA 3K75B 1O59A 5GLRA 1YQ6A 2YMZA 3KT4A 4NPMA 4W50A 4XVHA 3IMNA 5FZ7A 1KFXL 4XJUA 2C5DA 1JOJA 2W08A 5JMOA 1NY71 4IGPA 4LO8A 1VBD3 2YV8A 1BEV2 2Y26A 5CG8A 2A7AA 5FXXA 3CJIA 4LK7A 4HVRA 5GZFA 3PVEA 3QH7A 4PDWC 4AEDA 2VNRA 3GHNA 4U6DA 5CKMA 5E8AA 1WMXA 1NE6A 3RWNA 4DPNA 1ENQA 1RUD3 3GCXA 4XFCA 4XFHA 4A7YA 2ZX1A 3K46A 3T2OA 4YZ5A 2JB4A 4GJYA 1VBE2 1JZ2A 4M00A 5FMCA 4GWNA 2HWC3 1Q8SA 5CFDC 5I93A 1LHNA 1ZZ6A 3WATA 3N7KA 1IZ3A 1GV9A 5EJ3A 5FO9B 3ZSMA 4NUBA 2D6LX 4N2ZA 2ZMKA 2J1EA 4FPLA 5EV7A 4AHWA 4OMCA 4FOWA 1G9CA 5B6SA 2BBAA 2O8OA 2EXIA 3LSDA 3POEA 4OI4A 4Q29A 5D8AC 3ZYGA 1QJU1 1ZRRA 5C4WC 2E63A 3H7JA 3I49A 1V6NA 3K4AA 4M4PA 1FMD2 1VRH1 3IBMA 5T5LA 3I54A 3RPQA 1WCDJ 2HWF3 5LWBA 4FXKB 5JR7B 1GYEB 1LOBA 2W5FA 1O5LA 1BK1A 1RXGA 4LBQA 2L9LA 2XBO1 3ZMOA 1HXS2 3NMBA 3NW4A 5JZGC 2UYAA 4Z2WA 4FVVA 3V0AA 2ZEYA 3M4FA 2XJQA 1LEDA 1R081 2ZCWA 4NJ4A 3ZFEC 2WQ8A 3LQCA 1MZFA 4COVA 3DKWA 2RS11 2VMDA 3PL0A 5F1RA 1ASJ1 2MEV3 3G7DA 3TYJA 1UNBA 3LF7A 3MIHA 3QZ4A 1RUG2 1PZ9A 3MUZ1 3E6BA 1COV3 4EN9B 2NLRA 3OB8A 4BQ3A 2WAAA 2ZHMA 1AX1A 4FTSA 1S0CA 1A6CA 2G9FA 4IE6A 1OVPA 2YBSA 3I2KA 2QNKA 2D5HA 2XG3A 3UGGA 1QWRA 3WINE 1GYKA 4A41A 4N9IA 1GWMA 3MHZA 3B9CA 3AKFA 4JTNA 4YFZA 2ERFA 2XONA 1JXNA 4D6QA 3BU7A 4Q4V1 2P3YA 5K8SA 3VD3A 1Q8OA 3S7EA 5A32B 4P9WA 3ZR5A 4CDUC 2AGSA 4JCKA 3ZFFA 3AZZA 1OUSA 2R073 2XJRA 2BUKA 1MEC2 2J1SA 5CIRA 4NIAA 3VBHB 4QDRA 5J48A 4XHXA 2DCJA 4CEYA 3M1HA 4AFDA 4K1YA 4LOTA 4Y1VA 5E1RA 3CU9A 5ANNA 2ZGNA 3VUOA 2JDUA 3QCWA 5IATA 5KXCA 4PQQA 2BOJA 4JZRA 4TTGA 1NOVA 1PVC3 1LODA 2K2SA 2VUJA 4E2SA 2HWB3 3K3OA 1CX4A 3RYKA 3WT3A 3AYEA 1PX4A 4LPLA 1O7FA 1WW7A 4CDQB 3Q8FA 4QGLA 2V09A 2CDOA 2VMGA 3OPWA 5FZOB 1A8MA 4Q4Y1 3ZXGA 1OQEA 5JDBA 5ACA3 4O8NA 1JZ7A 2DUPA 4PI2A 4P5HA 4Q0UA 4ZONA 3WXPA 3K4ZA 3VBOC 3MLKA 1IG3A 1QXRA 3DL3A 1QJZA 2XVGA 3I2DA 5DABA 5JMCA 3KWVA 1O3TA 2FBEA 2C9KA 2WSUA 2C6SA 3DV8A 3H1WA 5KHHA 1DCSA 4ZZ5A 4H7LA 1RJ7A 1CESA 2JE8A 4EJRA 5FO8B 2HWD2 4RGGA 4R9DA 1H6XA 1FOD1 1CONA 1O4YA 1ULCA 2JG9C 3MICA 4NHLA 5FK7A 4C90A 4C91A 4EZ4A 1VB4A 3IT8A 4XEZA 4AOCA 1N1SA 3VBRB 1ZRFA 1PNGA 3VBRC 5LA0A 1QJEA 3ES1A 1KDMA 1WW5A 1S2KA 1VBB1 5A6YA 5FZCA 2AYHA 2R062 3CF6E 2JG8A 5EPAA 3TWIA 5GZGA 4TYSA 1OKQA 1S0FA 2JX9A 3J7LA 4MHRA 2XDVA 4XCBA 4BB3A 4DO0A 5F9TA 3H9AA 3J7NA 5A3NA 5AYEA 2X8TA 4BQYA 1JS9A 3T08A 3DYPA 4XIOA 5CG9A 3ZIWA 1OHFA 4B4QA 4XFBA 3W21A 3INAA 4FPFA 5A33A 4XJ9A 1Z7S3 4INDA 2JIGA 1HRI1 2ZS6B 4Q4W1 2B39A 5C3QA 1GR3A 2JE9A 4LIVA 3ZKYA 2NQYA 1DYOA 4ORFA 4M0HA 4KGGA 3TB0A 4GH4B 1DQ4A 3USUA 1L7RA 1ZZCA 1E5SA 4GH4C 1DQ0A 4XF3A 1JMUB 1SMVA 2WS92 1BK0A 1PX3A 2D3SA 3JD72 4JAAA 1Z0HA 4LUMA 3ZYJB 4Z8BA 1BXHA 5EYYA 4PVIA 1OUXA 5AY9A 2JDHA 3OBTA 1AR72 4QM8A 4ZU7A 4B8EA 3KCXA 2CAUA 1BBT1 4LIUA 4CEWB 1APNA 1Y4WA 5B4XA 1XRUA 4C1XA 4Y20B 1OC1A 1JHJA 4ZKTB 1UU5A 4YM1A 3TEWA 5C0PA 2GNTA 1UKGA 1GYHA 2BTVC 4L2NA 1F9KA 4MYEA 4WZFA 3VBSA 5IVEA 3LOBA 4IV3B 1JODA 3T30A 4CA9A 4R9BA 5A3MA 2A73B 2ZGLA 3OM6A 1AR63 4AK6A 3MEPA 3LD8A 1N47A 4JC1A 5I8TA 1L7QA 1OQ1A 3POWA 4XDPA 4BPZA 5FFOC 1FMD3 3ZN5A 2PMWB 1RUNA 5FZ6A 2FDHA 1FV3A 1H8TB 5JAXA 1FX5A 1D0HA 1AX0A 4JX0A 2C26A 3ZN4A 2ZOEB 5FZKA 5K9YA 1HRV3 5C8WA 1CD3G 2ORXA 3RZJA 5FZ8A 3TAYA 1HXS3 1I1EA 4BIFA 3N9NA 1NA1A 3HAGA 3I59B 5FIXA 3ZVXA 2LRPA 2BJSA 4RN5A 2XJVA 4YZ2A 4DOUA 2YFRA 4CP9A 2PLV1 2VVFA 4CU6A 5FREA 2ZEWA 3U75A 3PDQA 5TSWA 1HB3A 5CADA 4AWDA 3R4ZA 5CU1A 2PFWA 1QOTA 1RUG3 5ANQA 4MGZE 5LA1A 1XE0A 2LW8A 1LOFC 2YROA 4L99A 4XILA 3WQ7A 4MGYE 2RDRA 4D69A 2XL9A 2Y38A 3KD4A 3BTXA 3URFA 3WDTA 1WLDA 4EYUA 3W58A 2JDYA 4PJYA 5AC92 3AKIA 1UPSA 4NRMA 4QPGA 5CEHA 1W8UA 1ZZ9A 4QQ2A 1LOCA 2W92A 2Z2SB 2OYZA 1RUOA 3B69A 4URAA 4AQSA 2IXLA 5A6ZA 1ENXA 2EIEA 3HN3A 1TQ5A 1GNHA 3W20A 1GNYA 3OGRA 4TLGA 1UY1A 4HANA 4YG6A 2H0BA 1JHNA 3AKSA 4U6BA 1V00A 2RG4A 1DLLA 2CGOA 3ETPA 1AYN2 3V56A 2XVKA 5K7PA 4NIIA 3AKGA 3QC2A 2ZXQA 5A7NA 1MEC3 2I07B 2XH6A 3ZFGC 2W94A 3O7OA 2YG0A 4NAOA 4CUCA 1N3QA 1SLIA 1WKYA 2VZQA 3NV3A 1C28A 1LGCA 3NKTA 4DEVA 3OY8B 1UMIA 4XOGA 3WVJA 1O3QA 1CAXB 3LA2A 4WVZA 4OFGA 3W5MA 4ZZ8A 5ABJC 3I3BA 2PN5A 4AVSA 5IFTA 2PAMA 1SLAA 3SKJE 5C7GA 1MS3A 1SCRA 3X29B 5HV4A 1AR82 3MZHA 4CDXC 3POJA 3V0AB 2EXKA 1S0EA 1MS1A 3UGHA 4XABA 4V1PA 1DDLA 1ODMA 2F6BA 3B93A 2WZR2 4H7MA 4Y22A 1YJLA 4QU1A 2CSGA 1D4M1 3JQXA 1DYKA 3AM2A 4OYUA 4CUAA 1RUE2 1UW8A 4RR3A 4ZXKA 2VJXA 1RXFA 2PXJA 1GNZA 5EIYB 2A1XA 1ZRIA 4DXSA 3RFRA 3OM5A 2YBKA 4META 1SHWB 1NCRA 2WYSA 2BWCA 4E4HA 5I91A 1PNFA 1S0BA 4NOTA 4XXPA 4WVMA 2HWE1 5DDJ1 1REEA 1ZNPA 1RJ8A 2V5DA 3EHKA 2HWD3 4UDKE 1Q43A 1ZZ7A 1HJFA 2AREA 2X8SA 5KHJA 3ZXEA 3O1UA 1X36A 2QQVA 2VNOA 3NAPC 3ZPYA 3T0AA 5T52A 2QQJA 4WVVA 5DZGA 1U5ZA 4P00B 4I3PA 3UL2A 2WL1A 3DECA 4CCCA 4HVQA 2HH9A 2BRTA 3I2GA 4WM7C 1VLNA 2QE3A 1SDDB 2VTXJ 4IE4A 5B4NA 5L9BA 1NX9A 1RUJ1 1X82A 1QJY2 2H0VA 1OVSA 3ACFA 3AJZA 2R063 1QKQA 4FPEA 4EN0A 3GALA 4YM0A 1PK6A 4IEWA 3VL9A 4NIDA 4X8PA 4JKMA 2P3IA 2RHPA 2W3JA 1D4VB 1KJLA 1YNAA 1YIFA 1EAH3 4P02B 4UW4A 2DVFA 3WNPA 2VC9A 5T3NA 5EXOA 4I2OA 1DYPA 3MDPA 4I3GA 3R67A 2VMHA 1POV1 1QXJA 3OEAA 5A1LA 3WDXA 4AE2A 4D7YA 4BM8A 4IW3A 4LHNA 1GZWB 3POBA 4QX8A 5BPXA 5GZCA 3IM0A 4LORA 1ACCA 1H30A 4ES9A 4BQWA 3NRUA 5J98B 2ZABA 2KM2A 2Y34A 3NSTA 2Y0OA 4P9IA 1CJDA 2GN3A 4LO4B 4G3YC 1IKPA 1GU3A 3AJYA 3BOWA 2WWSA 1OKOA 3VDAA 1W8HA 3IIIA 4URTA 2RM21 1EV11 3RI8A 4KG8A 1NLQA 1N1TA 1W6NA 2R30A 4Q8LA 5FP9A 5KHKA 1E5IA 1ZA7A 2K46A 2GC1A 2VZPA 1NYWA 4JHZA 4NWVA 2BV4A 1WMFA 1PO21 1U0AA 2DVBA 5JOWA 4K9SA 5LBEA 4JKLA 1ENRA 1GP5A 1VAVA 3ACHA 4KGQA 2G9GA 3RMYA 4EROA 2Z69A 5DMYA 4FBFA 3N9PA 4JGZB 1H4GA 2GC3A 5LK7B 2A71A 2IWGB 3LZZA 4HONA 1RMU1 2X5IA 4DXTA 1ZBA1 5C9AC 3BPSA 3IMMA 3BTYA 3ECQA 3QH6A 5IVFA 1OH4A 1R093 3PUHA 4CXXA 1LTEA 1X9TA 3NV1A 1RVF2 1B35C 3VLBB 3AFGA 2GNBA 1RITA 4LNVA 2BPA2 2RR12 5BXXA 3LDBA 1UIJA 4YVSC 3HOBA 2IFWA 1PVXA 3THCA 5FYIA 2EXJA 1UZZA 2QZ2A 4Q5OA 1C5HA 1ZYBA 2ARBA 4M01A 1TMF2 4F7ZA 1OPOA 3BYNA 5C3SA 5C5TA 4BHPA 1YQ5A 3WNLA 3F2ZA 2IFRA 1U12A 3FBMA 1OSGA 3FUQA 4G4FA 4AHZA 4O9GA 4EE2A 3DPRC 1P8JA 2HBUA 2W46A 4CVUA 3BUCA 3KHCA 2WIIB 2Q5TA 4LBJA 4KU7A 2CWMA 4YZ3A 1LOEA 3SCFA 3AP9A 3SH5A 1LU2A 5A7VA 1WL7A 1CWPA 2R043 4PDWA 2Q8DA 1AR71 4CCJA 3K51A 5FOBB 1GZ9A 3THDA 2WFPA 3JCIA 5L7OB 4GIQA 5JI9A 4MX3A 3N7MA 3T3YA 1C57A 4JGYB 5IUQA 1XNAA 1V9U2 2CHHA 4HZFA 3O1VA 4N53B 3S57A 4N53C 3ZMNA 1CAUA 1Z78A 3C8XA 5I0DA 1AYN3 3IWZA 4LOSA 1RUH2 4Y5Z0 3S7IA 1OURA 2ZJCA 3ZO0B 2UY8A 4A7KA 2XPJA 4DS0A 2EA7A 4AGGA 3VV1A 3EO6A 3GF6A 4K6BA 5L9VA 4MVTA 3HNBM 2RS52 5IVCA 3AB0A 4HG6B 2OZJA 4Z82A 5C4WA 5D8AA 3BYJA 3QLQA 2E7AA 3KQ4B 1UQXA 3AMQA 5FYUA 4AVTA 3U4XA 3AXDA 3SLIA 5DAWA 5J3UA 4BXSV 2VW1A 1J3QA 5CBLA 4K20A 1AJOA 1IS6A 1NA1B 1POV0 1AR83 2Q30A 3OTFA 1CZSA 5DUUA 3U78A 4N4BA 2FZ2A 5FPAA 3V0BA 1W2AX 3L9JT 5KC6A 1IG0A 4CP9B 2VZRA 2WZR3 1W6QA 3D3AA 5CYYA 1CR7A 3CQOA 1RUD2 4IV1B 3C7GA 1WLTA 2JKBA 1JYNA 2AEYA 1RUE3 2VZSA 4RYDA 2FQPA 2WT1A 2V4AA 1VJ2A 1K5MC 2RJLA 1EUTA 3RS6A 5AC91 1M4WA 1W04A 2HWC2 1JOPA 5HXVA 3C7HA 5BYNA 1ODNA 3OYWB 3PMSA 3C2UA 1ZBE1 4W8JA 3LPFA 1ZA4A 3VHRA 2R32A 2VMFA 2Q1MA 3ZYHA 5C8CC 5JSRA 4QDQA 2RV9A 4HVOA 1UY3A 4IE5A 3I7DA 2VY0A 4GJZA 5JCTA 2VOTA 3HD8B 3WW3A 2P3JA 4OI2A 4X6QB 3D5YA 1W0PA 3BALA 2ZGUA 1N3OA 2GC2A 3D6EA 4NE9A 2NMNA 2QQPA 2DF7A 2Z5WA 1QJX1 1KEXA 4QX1A 5FYYA 3ST7A 4D8MA 1BMV1 3ZIXA 1OQDA 3TNQA 4CDUA 1YRZA 1UV4A 2YBPA 3RWKX 3ZLIA 2YDEA 3U4SA 2ZHKA 1QJY3 4JDOA 2Z4FA 5FMBA 1ULDA 1H9WA 4LR4A 3EBRA 4WM8B 2YFTA 4MGQA 3R6SA 1PT2A 5EQUA 4NVPA 2TEPA 3VBUA 3QEFA 1GFF2 1RUI1 2MEV2 2X8FA 1GANA 1EUUA 1HLCA 1MVEA 5A6QA 1PO13 2ZGOA 3A7QA 5DPNA 2YPJA 2GC0A 3H0OA 4OVEA 4QX5A 5FPVA 2CY6A 1F4HA 3O5SA 4CCLA 3PUAA 2LROA 4XCAA 1CAWA 1EY2A 1IKQA 5FY0A 5JIUA 3IDAA 4QMAA 2CNAA 1RUC3 4RR3B 1LU1A 2QZ3A 4V2WA 3VN4A 4RQPA 2VH9A 5CFCC 2DVDA 2B4WA 4N2RA 5A3TA 1S0GA 3ZM8A 3ILNA 3LWCA 1UX7A 5J96B 1VBA1 3ZN6A 5A3LA 2FCVA 4N7UA 4QXBA 1F15A 1IGOA 2OW4A 2W68A 5LZ6A 4MH0E 3MIFA 1W6PA 1V6JA 3IIAA 4XTMA 5FMOL 4FOQA 4AI2A 2RDSA 2YPDA 2NP0A 3ZX7A 2JG9A 3ZSEA 5FUPA 4ZU4A 3AZYA 1SLCA 1V6OA 3K77A 5JUVA 2HWB2 3MBWA 1OLQA 4OHZA 3DUIA 4KBBA 3AMPA 5FPZA 2WQ4A 1RVF3 2B45X 3TOJA 1DQ1A 4UF0A 2VG9A 2RR13 3IB3A 4FXGB 1C8M2 2A75A 4AL9A 3WDVA 2H6BA 3D8CA 4NRQA 1ND2C 2WZ8A 3EXUA 1S1AA 1UYXA 2FDJA 4KWKA 5DG1A 2QQIA 3TEZA 3H8OA 1TZOA 2Q1FA 4HXCA 4LKFA 4CXWA 1OLMA 2VOWA 3P3PA 3ZYPA 2DV9A 4QXHA 3M70A 3O1SA 5FZLA 5A7OA 5A80A 5T54A 1UU6A 2BERA 4PHZA 2Z42A 2VECA 1GOFA 3UKVA 2IVJA 4XE9A 1GICA 1GLHA 1N1YA 2Z79A 3DGTA 3FL7A 5E16A 4BLIA 5BNNC 2I2SA 4ZHNA 5FPBA 5KBFA 1GQPA 4SBVA 4AR2A 1GP4A 1GKBA 4LKDA 5E88A 4DFSA 3WP4A 5H9PA 1AR92 2NYYA 4XQ4A 1POQA 2XKPA 2WC2A 1W6NB 1O8SA 1V9U3 3A0NA 5HI0A 4RS5C 1AYM2 4Z07A 2IZWA 2A3XA 4JRAA 2D98A 4Q4X2 1Y9MA 1RUH3 1MS0A 2P37A 5F2SA 1ZZ8A 3LOIA 5T55A 4YW2A 4OHYA 3MPPG 5E89A 3QEEA 3T4HB 3WF4A 1V6LA 2PELA 4QU2A 1L3JA 2I45A 2HYKA 1OF4A 3DXUA 3AP4A 3FFZA 3KVBA 4KWLA 3VKOA 2X5IB 5A7SA 2RS53 3PNAA 5EFUA 4AVCA 1QDOA 1Z7S2 4ISQA 1XE8A 2E32A 1O91A 3I2IA 4X6RB 3RZLA 1DFQA 2VBDA 1RUF2 1LHVA 3WNXA 4GMP3 1QXPA 1H2NA 3H3UA 3OD4A 3QBQA 4K1ZA 2YFZA 4OUSA 3VKFC 4LJHA 2DCKA 4K40A 3KS7A 3ASIA 2ZAHA 2OX0A 4J1WA 5G04L 2MHFA 3C7OA 5K0UA 3FC0A 3D0SA 4UW3A 5F5CA 3IPVA 1J3RA 1WA6X 3WEZA 3A0KA 5ISLA 2QTWB 1R083 3B7MA 2WNVB 2ZHLA 4DB5A 1UU4A 2RS13 3VDDA 1LOFA 2GP3A 1YFXA 5FZMA 4IEUA 1TG7A 5HCBA 2BNNA 1XE7A 5KXBA 4NAMA 3KMHA 2W0XA 4Q8KA 5FK8A 4V2VA 1ZRDA 3D5ZA 5CB7A 1AL21 2B4KA 4XBNA 5FZ4A 1UMHA 3WDYA 1VKDA 1W8WA 2PHWA 2VZTA 3OG2A 4BISA 1CAUB 4TZDA 4RGKA 3A4UA 3NNLA 3RMXA 4AQ6A 4CCKA 1HRV2 4J1XA 1C4RA 2N7GA 3NNMA 5FP7A 3HT2A 1UMZA 3KHBA 4MZUA 4Q4V3 3UK9A 2K9ZA 1L7LA 4GWJA 4AFAA 2GAUA 3ZXFA 2R49A 1F8VA 1W99A 1YWKA 5APAA 1PGL1 2D43A 3LE0A 1FPN1 4OCTA 2YUEA 3HR9A 3LA3A 1VBD1 5FZEA 2BVBA 1FYUA 2JJ6A 3CU7A 5DUWA 3G6JB 2VM9A 4LHLA 4N43B 5L36A 5GLLA 1KD7A 3UGFA 1C1LA 4J25A 5IHRA 4JHTA 2P2KA 4EZHA 3H8UA 3VD5A 2ZGMA 1O3RA 2VOVA 5KHGA 1NCQB 2GSYA 2QQLA 1VBC1 4HT1T 1TME2 5FRAA 1CQ9A 4JVAA 2J1VA 5DUXA 5F5IA 4CDXA 3JU9A 4L0PA 4DY5A 5FDBA 1W6QB 4U2AA 3OUJA 4E4DX 4ONZA 5FTTC 2ZX2A 4BMEA 5LEKA 2ZPXA 3AKHA 1JYCA 4H2AA 2VQ0A 3D82A 3MI8A 2EF6A 4QKFA 4IGQA 4QXKA 3WP3A 5FQ0A 5I0RA 2EICA 1H6YA 2EIGA 4XF9A 4QX3A 3HT1A 2BDRA 3O1RA 2RDNA 3FLTA 4KH9A 3VBHC 4GQ7A 5EYXA 1DQ6A 1CIWA 2DBNA 5GLTA 1UY2A 4KI5M 5GLKA 4O61A 1TNFA 2HWF1 3OCPA 3RYPA 3T0DA 1LEMA 3JB8A 1GZTA 3CHXA 4NPRA 1QU0A 2UWAA 4MHUA 4QPIA 4XJWA 4B1LA 3KV6A 2RMU1 4E9KA 4QQPA 2JKXA 3GZAA 3EYPA 5DG2A 4YYOA 4CE8A 2WO2A 3PVNA 1BVVA 4LLOA 5CKQA 5CNAA 5FKCA 1FATA 4MGTA 1CN1A 1W9FA 2MEV1 2XUEA 3OSDA 5EZWA 4CDQC 5A70A 1C8M3 3QACA 3SKVA 3LGRA 2X09A 5FY8A 5FZ0A 1Q56A 1NT0A 1W06A 3OUIA 1COV1 4YGCA 2X8KA 3VBUB 5HPOA 2WA3A 2GU9A 3P6BA 4MO3M 2D6NA 1VBB3 3JXSA 2WUHA 1YI9A 2ZX0A 3LIHA 3ETQA 4MXWA 4NPLA 2ZTNA 4XF4A 3VZLA 4P9GA 4AK7A 1DBNA 3HBZA 3PJYA 3DYOA 5F3EA 1GOGA 3RZHA 4FQ4A 4R4ZA 3WF3A 1DF0A 4I02A 3B02A 2VZVA 1JZ8A 1JZ3A 3VT2A 4NIHA 2WFF2 4QB6A 1CPNA 4R52A 5BNPA 2HEYF 2DDUA 2VUAA 4XHBA 1HRI3 2JD4A 3HEIA 5A3WA 3WCSA 1SLLA 3MV01 3FFQA 5FLJA 4OI1A 2WN3A 3ZKUA 4DQAA 2RS31 5BUVA 1A34A 2ZMLA 2EXHA 4QM9A 2WYFA 2R071 4RQPB 2WNUB 4LBQD 5BNOB 2WNUC 1AR93 5A1AA 3UETA 2V72A 1RHI1 2WABA 4E2QA 1F2NA 2D97A 4LQRA 1BCXA 2J1RA 4AI9A 5GLUA 3W59A 3PTRB 3RJ2X 2G1MA 1AYM3 1W05A 3I2OA 2R7EB 1JZ5A 1R1A1 1W2TA 1RIRA 5SV8A 4Q4X3 1DGRN 4QQHA 3PLQA 1SLBA 5JR2A 1NXMA 3RQ0A 3O1PA 1BBT3 1W6PB 3TBDA 1EAH2 2LUWA 1PVC1 1VPHA 4CZSA 1OA2A 2JIJA 3I8TA 4OHXA 1UOJA 1J3PA 3I2FA 4QX2A 2OXBA 3K2OA 1W3XA 2X05A 1FNYA 4SLIA 5GLMA 4D0QA 4XF1A 1QHDA 3ENRA 4GA9A 5C9AA 1YQCA 2CYFA 1W8FA 1HW5A 1RUF3 1WLCA 1CIYA 5ACA1 1B35A 5FO7B 1OXCA 4RHV1 3ZYBA 5B2GB 2OUJA 5I0UA 4S2HA 4WZCA 5CISA 5IVBA 2WN2A 4B7EA 3OBZA 3OOXA 4CDWB 3KV5A 1K3IA 4YG3A 3LFMA 1PGW2 3FX3A 4NRPA 5FYVA 2ZZJA 3KZ4C 5FXVA 3OM7A 3LIGA 3AFKA 2DBIA 4K7JA 1ND3B 3DF0A 1EPZA 4M3CA 1OOPA 1WCSA 2B9VA 3AYAA 2O14A 4CEWC 3DEMA 4WVWA 3DPRA 2W95A 3PJQA 4QPYA 5IJRA 3OEBA 5F2WA 2XLAA 3POYA 5AVPA 5IVVA 4FOVA 3MW4A 4IV3C 2VMEA 3PUSA 5FZ3A 2ARXA 4EN6B 2FCTA 2D40A 3AVRA 4ARXA 3OUHA 2C1FA 1W2OA 4DNYA 1R092 1AXZA 2QQOA 1GQHA 2YC0A 3KCYA 5H9QA 2A6VA 4KU8A 5F6LB 4BE3A 2FMYA 1H8TC 2J1AA 1U5YA 1BVP1 1UO9A 3POFA 2BWAA 4MLOA 5BV6A 4YVWB 5CZKA 3RGBA 1UOFA 4HETA 5FMOS 3U1XA 3WN2A 1X50A 2SLIA 2XB6C 3MUY1 1ULPA 1MZ6A 5LBFA 5D2AA 2VZ1A 4B7KA 3D5OA 2F4PA 1CZTA 1XB9A 1H4HA 1BEV1 2CU5A 2XOMA 4YM3A 1H0BA 1TEIA 3AYCA 5A1FA 3QOPA 1V6MA 1VMHA 3M2MA 1LECA 3KQRA 3NJYA 4W6WA 5IAXA 3CJIB 5FWJA 4GB33 3F95A 4AEDB 3AX4A 2R042 1W8OA 4YW1A 3GXUA 3Q8AA 3I3EA 1TME3 1XXNA 4XW3A 1U5IA 5K4LA 2ZX3A 5K0UB 4UFHA 1BLZA 1DG6A 3R0RA 3OM2A 3O14A 5IK7A 1VBE1 3B01A 3IPVB 3PIJA 4NO4A 4LBNA 1IQDC 2WT2A 3T0BA 1ONAA 1W6OA 3NJZA 5LRRA 3P2NA 4N1IA 1JW6A 1F4AA 3VDDB 4CYDA 2AZ5A 1K5MA 2R1BA 2PHDA 1WBFA 2VOKA 4CCNA 1G9AA 4COZA 3ABZA 1H2MA 5A7WA 2VDTA 1AR61 3WPZA 3BN6A 3FN9A 3VT0A 4UFMA 1QIQA 1QEXA 4P9LA 3SEPA 5C8CA 1FMD1 1O8PA 4BYYA 4Y5TA 5DN2A 1YLLA 4W6XA 4BH9A 3D0JA 3S5AA 2VULA 1CAVA 5C3OA 3FHAA 5KXEA 4XACA 1HRV1 1WWYA 4QDSA 1KDKA 4HN1A 5DDJ3 2HWE3 1HXS1 2VMCA 2VUDA 2OUHA 3TN92 1ST8A 1YI7A 3OBAA 4AVVA 4LBQB 4D94A 3IAPA 4QGNA 3ZYFA 1O3SA 3HMYA 3ZXLA 4DIQA 5FYZA 1OA3A 2W1WA 4CUBA 1DGWA 1NLRA 3IDCB 5FZDA 3JBG2 5FY4A 4QAWA 3R4YA 4UFLA 1RUG1 4A6OA 1PIV2 3WX5A 4BQ5A 2R1DA 3EJKA 1ALYA 4IEPA 4ARYA 1S0IA 2XQXA 3H50A 2RJ2A 2JDAA 1ZREA 2UWCA 3CLPA 1DLCA 1H2KA 4XUNA 4XDOA 3WSOA 3AL5A 3J8F3 1SACA 2YGMA 4FFFA 4XPVA 1HKDA 4CUGA 4HPKA 2ZZQA 3EQEA 3U14A 1HB4A 2B9UA 4PLNA 1W9SA 4QWNA 3SH3A 5JXIA 1IS5A 4AVBA 3M3CA 3B3QE 2WFF3 4PBOA 3E6CC 4AI0A 1JUHA 1JYIA 4Q26A 1CPMA 3T09A 2PA7A 3I3QA 2XMLA 1A78A 4AI1A 3WF0A 4FSJA 2FZ1A 1G7YA 3ZFFB 1MEC1 4YSFA 3RZKA 2ETEA 1UN1A 3WNKA 1C1FA 2A6ZA 5CFCA 4CCMA 4ET7A 2HJIA 4AF9A 3EMRA 1PM7A 1SBDA 2BEOA 3N35A 3KF5A 3VD7A 1J59A 1W8ZA 1LKNA 2XVLA 2XHKA 1QOSA 3ZDSA 1MS8A 2ZGSA 3J9SA 3POSA 2FHRA 3C3VA 3HIFA 4NHYA 4ATFA 4PIXA 4A2UA 4CEYB 2B5HA 3GZEA 4UBHA 5CVRA 4YW5A 1EV13 4CU9A 2PYTA 3LPGA 4E27A 3LEGA 3KT1A 4QPIB 2FMDA 2G4IA 1PO12 4Z1VA 1YQ8A 1JYXA 1LR5A 4UDIA 1PO23 5AYDA 3V65A 5GLWA 2VPVA 3CZUA 3MFAA 4OQ9A 1KJRA 4OHVA 2J1TA 4ASKA 1UYPA 1AUYA 2ZEXA 4CCEA 5C2MA 1HDKA 1MZ5A 3VL8A 3GHMA 2CV6A 4LKSA 4CP0A 1ZBA3 4XQWA 3CMGA 2ZBJA 1AF9A 4IL7A 5FYSA 1AJKA 4HKLA 4ASLA 3WPUA 2W87A 1VMFA 3ILFA 4AI8A 4XIKA 3OM4A 2BFUL 1E57A 3ORJA 3BI3A 5FLWA 1RUC2 3A21A 4LO6B 3AC0A 2R16A 5C3RA 1UY0A 4S2DA 1XNDA 3SMHA 3J26N 4IEOA 1SFPA 4BWOA 3GNEA 1QQP2 2HWD1 3KT7A 1JTZX 3AKRA 4AI3A 5BNPB 3DKQA 1W9WA 5GZEA 3GGLA 2WA4A 4A3ZA 1KGYA 1NXD1 2DTWA 1UX6A 3AKTA 4JGZC 2JXAA 3LCPA 1LOGA 4BU2A 2DCZA 1BJQA 2OVUA 3VBFA 1FXZA 1LHWA 2R061 3ILRA 4AGRA 3W5NA 2ZGPA 3E1F1 5JSPA 1XSQA 2DYCA 2JG8B 1Y9QA 5KXDA 4KCBA 1EAH1 4FO9A 1MQTA 5EP9A 1ULEA 4DINB 5KR7A 3O0WA 1D2QA 2XL7A 2OPKA 3ES4A 3ZSLA 3NNGA 4CU7A 1JI6A 1IHMA 5A33B 1U5XA 1EYBA 2BNMA 4CPBA 1XNBA 4QX7A 4KG0A 4ISRA 4YFWA 1NZIA 5LCWL 1W18A 4MOAA 5T50A 1N1VA 4FPCA 2UU8A 3VSFA 3AP5A 4COUA 4XJ8A 1HQNA 2WS91 3JD71 3WP6A 5GLNA 3T4VA 1GZCA 1RINA 3USUB 1NY72 4LHSA 3AMNA 2OA2A 4LBOA 3GCWA 5JOZA 4F83A 5L7OC 4A3XA 3AL6A 5T5JA 4JGYC 2WO3A 4M3CB 2XR4A 3OPZA 4LA2A 4L97A 2WO1A 4M3CE 3WF1A 3ITQA 4AXOA 3I4IA 2P4EA 4CSWA 1J83A 5CFDA 5IK4A 2XLFA 1CX1A 3VBSB 2VTXA 3VBSC 1QJFA 3KGLA 2DCYA 2YU1A 1R091 4EN8B 4NMIA 1FT9A 2HLEA 2QDNA 1SFNA 4IEXA 4D6SA 2JDMA 3NKGA 2C4XA 1AVBA 2C9AA 1W39A 4A44A 3TN93 1C3HA 2D44A 1UYYA 5T5PA 4B4PA 2YGLA 1QJU2 1X33A 1TNRA 3O0VA 2YHJA 2W47A 3AP6A 3ZYIB 2XJSA 5A8CA 1LOAA 2JEMA 5CA6A 4FI9A 1NA1C 2VL4A 1JBCA 1MPXA 2ZMNA 3P1IA 4UWDA 4P9YA 5JZGA 3JBG3 3MIDA 1C5IA 1DQ2A 1UIKA 2PHLA 5A3PA 3ZFEA 2XBO2 4AK3A 1PIV3 1JZ4A 1BYHA 3O1MA 1XYOA 4KQ7A 4DUXA 3GZTB 3ACGA 1DGWX 1GYDB 3K4DA 4IV1C 2QKDA 2WKKA 5FYCA 4LITA 1R082 3ZXAC 1PM4A 1WZXA 4AEKA 2VZUA 2RS12 3GDBA 4HSLA 4COTA 1ASJ2 3B00A 3FWEA 1IPKA 1IQAA 4YM2A 1Y43B 1SFYA 1WD4A 5FMDA 1OI6A 4PBPA 4NROA 2J1UA 4QPGB 4LBMA 5LB6A 4EWEA 3MF6A 5FUNA 1LB2A 3T1LA 3TNPB 4JQRA 1US2A 3MLLA 4FOYA 4IXLA 4IEQA 3WD5A 1XQNA 1G9DA 5FPXA 4H55A 4FTBA 1AYN1 2P3KA 1VAKA 4WV8A 4YW4A 4X8NA 5J1XA 5LEJA 1RTVA 3WNOA 5FCCA 4OUEA 5A32A 1KS4A 4KNCA 1G6NA 2I74A 3V64A 4BK4A 3TAWA 3J4UH 5GLPA 1QOOA 4Q4V2 2WZPP 2GH8A 4WBBA 4F3JA 1VALA 2OKXA 3I2JA 2YXSA 4IETA 2ILMA 4WM8C 1YFWA 3VBHA 1S0JA 1OMIA 3FHQA 3TEYA 1WCQA 5HCAA 1LNSA 3NV2A 4XFAA 1T2XA 3MW3A 1W0NA 4QQLA 3VHOA 1YO8A 4RSUA 4L92A 2ES3A 4K21A 1US3A 1AR81 2GMEA 3WASA 2JDNA 3T2PA 2W1UA 4YW3A 3EB7A 4JQTA 3AZXA 1DU3D 2WBKA 2WZR1 2GH2A 4A7ZA 2TUNA 2D6MA 3JB4C 2D6PA 3Q8EA 3WQBA 3NJVA 3PMEA 4HMZA 2Q8EA 5AVAA 3BTZA 4NWWA 1RUE1 1TVGA 2O8QA 4Y22B 3O1TA 1NLSA 3AZWA 2HEVF 2YY1A 3C7EA 3WCRA 4LA3A 5EWSA 1G86A 4RR3C 4S2FA 1G8WA 3BU0A 2DURA 1W6MA 4Q4Y2 2LS6A 3BIWE 3VBOA 3WG3A 4BCUA 5F5AA 5EHDA 2GP5A 4QGMA 3VZOA 1NCRB 3VD4A 3GJBA 2W1QA 4FPJA 1QQP3 5H9SA 1OFSA 3WHUA 5JPNB 2VAUA 1DHKB 4WVMB 1EPWA 1LULA 5I0TA 1PZ8A 2DFBA 5FZIA 3PU8A 5C6CA 5FYMA 4AGVA 3KSCA 3LEKA 2BBVA 2BP6A 3B9IA 3BB6A 3K48A 1Q3EA 1ZZBA 1OFNA 3APBA 1AL0G 1FOD2 1QJY1 2IC1A 3KV9A 3KLSA 4UXAA 1D7PM 4XUTA 1OLRA 1M06G 3WN0A 4GALA 3PUIA 4HK8A 4K8FA 3VBRA 1UWWA 4Q0PA 3WUDA 3WG2A 3C7FA 5F37A 5KHIA 3LSEA 5LA2A 1HB2A 2IXCA 4FAGA 2BU9A 1PK6B 2QUOA 2BW8A 4UBGA 2DFCA 2NN8A 2UWBA 4ITCA 3MLJA 4LBLA 4KWUA 4KWJA 1H1MA 3CBNA 5KC5A 1VBB2 4EWDA 4YPJA 3GYDA 4IEZA 4YNIA 4UYBA 4LULA 1JN2P 2PAKA 4BA6A 5J09A 4KC8A 1VP6A 3T2TA 2V4VA 3SCHA 3MFCA 4GULA 4AEMA 1NG0A 4COYA 3L2YA 4A4AA 3CEWA 4CCDA 3RI9A 2QFEA 3U37A 2ZGQA 5FAXA 3HQUA 1HRI2 4Q4W2 5FZ1A 2QCSB 4GH4A 1SQ4A 2XKOA 3MGUA 5GZDA 5GLOA 5C71A 1AXYA 1NAEA 4UFJA 5LY1A 4KCAA 2HEWF 2WLPA 4PT6A 4BK5A 4HSJA 3S30A 2E53A 4OQ8A 3OBRA 3H8XA 5FP4A 4E8CA 3UESA 1FV2A 3BYKA 3NNJA 4QKBA 2BZDA 2NZ9A 4A6SA 4AHXA 4R4XA 5C5UA 4RFRB 1BBT2 1O4TA 2C24A 3HVDA 3S6PA 3PURA 1S4CA 2VTFA 2PTMA 2WNEA 4KMQA 2FDGA 2IXIA 2XHNA 3BPZA 4IV3A 4MUVA 1GQGA 1ZRCA 4AG4A 1RVF1 2X5IC 4Q1RA 1SG3A 1ZX5A 2DWRA 3VT1A 2RR11 1KXGA 2ZX4A 1UZ0A 1ULFA 5GLVA 1AL23 3NNFA 4Q0QA 4RFT0 2H6CA 1NUKA 2J22A 1BQPA 2XWBB 3OGJA 5IVJA 5FZAA 4FPOB 1QJU3 4HL0A 3RJRA 5HXMA 3NQHA 1H8TA 2NPIA 4A42A 3AP7A 2DTYA 1TMF1 4EQVA 1F5JA 5JI7A 1VRH3 1LESA 1YFUA 4M3CF 3CKHA 5C70A 5FR3A 3I59A 2A6WA 3Q9OA 1NKGA 1GWLA 5I8SA 2XBO3 4K3UA 3J7HA 3BODA 4HN0A 2A3YA 4RD7A 4ATEA 2YC4A 2EIDA 5DUVA 5JVVA 4BJ0A 5ERLA 2VCAA 2HBTA 1ULOA 2PLV2 2WNVC 3MO4A 2BYVE 2CTVA 1FPN3 3B5LB 1ASJ3 2JDKA 1DIWA 2QQUA 4XBLA 2BFUS 3CO2A 4PLOA 4GXLA 4AW7A 5A7VB 2VNGA 1YEWA 3IKWA 5L9RA 3J7MA 4PDWB 5FY1A 4I30A 1WCKA 4GKXA 1V9U1 2VXRA 1ENSA 2VQTA 4FAHA 4JV4A 3WAUA 4Q0VA 2FDIA
chains in the Genus database with same CATH topology
3OM7A 3LIGA 1OYGA 4N4BA 4UFIA 5FIXA 5GLQA 4KC7A 3R67A 3PIGA 2YFRA 4ONZA 3U75A 3C7GA 5GLRA 3R4ZA 3AKHA 2AEYA 3WN0A 3VSRA 4KMIA 5FKBA 3KSTA 3C7HA 3KF5A 4O8NA 3ZXJA 5A8DA 3VSSA 3LEMA 3C7FA 3C2UA 3D61A 1YIFA 3AKIA 3WPYA 4FFHA 4U6DA 5GLKA 4O8PA 3LDKA 3D5YA 2XQRA 5A8CA 5AYDA 1Y9MA 4UDIA 3D60A 4B1LA 3KF3A 5JOWA 3U1XA 3QEEA 3WN2A 5B6SA 4U6BA 4UDJA 1YRZA 5FMCA 1UV4A 1UYPA 4CCEA 5FKCA 4AZZA 1GYDB 4UFKA 5FK7A 4CCDA 3RWKX 3AKGA 3QC2A 3QEDA 3WATA 4AK5A 3OSDA 3IMMA 5FMBA 4O8OA 3WPUA 4N2ZA 3OM4A 2YFTA 5FLWA 4COTA 1PT2A 3QEFA 5FMDA 1Y7BA 4QQSA 5GLOA 2EXIA 2X8FA 1Y9GA 4UFJA 4KCAA 4PVAA 3ZXKA 3WN1A 3LIHA 4AK7A 2EXJA 4UDKA 3OM2A 4UFHA 1GYEB 5AYEA 2X8TA 3C7OA 3LFIA 3BYKA 3PIJA 3BYNA 3WMYA 3NMBA 3H3LA 3SC7X 3VT2A 3K1UA 3S5QA 4D47A 2EXKA 3UGHA 3P2NA 4N1IA 4FFGA 3WPVA 2ADEA 3TAWA 5GLPA 3LDRA 2EXHA 2VDTA 3LF7A 3QZ4A 3VT1A 3WPZA 3VT0A 4NOVA 2B4WA 4UFMA 5A7VA 1WL7A 5FK8A 4N2RA 3D5ZA 3HBKA 2YFSA 3OM5A 4MLGA 3NQHA 3LV4A 4PVIA 1VKDA 4KCBA 1W2TA 5AY9A 4EQVA 2AC1A 3UGGA 3WASA 1ST8A 1YI7A 4UDKE 4KC8A 5JOYA 2QQWA 1Y4WA 2X8SA 3ZXLA 3AKFA 4JQTA 4B1MA 3VSZA 2QQVA 2OXBA 5C0PA 1GYHA 5GLMA 3WMZA 3ZR6A 4CCCA 3ZR5A 5AYCA 3R4YA 4UFLA 1W18A 2AEZA 3C7EA 2QQUA 3VSFA 3OM6A 4QHZA 5GLNA 4AK6A 3BYJA 5A7VB 3BYLA 4UDGA 5JOXA 5GLLA 4FFFA 5B6TA 3UGFA 4FFIA 4HXCA 3CU9A 3WAUA 5JOZA 3U14A 2ADDA 5ANNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OM7 A;  3LIG A;  1OYG A;  4N4B A;  4UFI A;  5FIX A;  5GLQ A;  4KC7 A;  3R67 A;  3PIG A;  2YFR A;  4ONZ A;  3U75 A;  3C7G A;  5GLR A;  3R4Z A;  3AKH A;  2AEY A;  3WN0 A;  3VSR A;  4KMI A;  5FKB A;  3KST A;  3C7H A;  3KF5 A;  4O8N A;  3ZXJ A;  5A8D A;  3VSS A;  3LEM A;  3C7F A;  3C2U A;  3D61 A;  1YIF A;  3AKI A;  3WPY A;  4FFH A;  4U6D A;  5GLK A;  4O8P A;  3LDK A;  3D5Y A;  2XQR A;  5A8C A;  5AYD A;  1Y9M A;  4UDI A;  3D60 A;  4B1L A;  3KF3 A;  5JOW A;  3U1X A;  3QEE A;  3WN2 A;  5B6S A;  4U6B A;  4UDJ A;  1YRZ A;  5FMC A;  1UV4 A;  1UYP A;  4CCE A;  5FKC A;  4AZZ A;  1GYD B;  4UFK A;  5FK7 A;  4CCD A;  3RWK X;  3AKG A;  3QC2 A;  3QED A;  3WAT A;  4AK5 A;  3OSD A;  3IMM A;  5FMB A;  4O8O A;  3WPU A;  4N2Z A;  3OM4 A;  2YFT A;  5FLW A;  4COT A;  1PT2 A;  3QEF A;  5FMD A;  1Y7B A;  4QQS A;  5GLO A;  2EXI A;  2X8F A;  1Y9G A;  4UFJ A;  4KCA A;  4PVA A;  3ZXK A;  3WN1 A;  3LIH A;  4AK7 A;  2EXJ A;  4UDK A;  3OM2 A;  4UFH A;  1GYE B;  5AYE A;  2X8T A;  3C7O A;  3LFI A;  3BYK A;  3PIJ A;  3BYN A;  3WMY A;  3NMB A;  3H3L A;  3SC7 X;  3VT2 A;  3K1U A;  3S5Q A;  4D47 A;  2EXK A;  3UGH A;  3P2N A;  4N1I A;  4FFG A;  3WPV A;  2ADE A;  3TAW A;  5GLP A;  3LDR A;  2EXH A;  2VDT A;  3LF7 A;  3QZ4 A;  3VT1 A;  3WPZ A;  3VT0 A;  4NOV A;  2B4W A;  4UFM A;  5A7V A;  1WL7 A;  5FK8 A;  4N2R A;  3D5Z A;  3HBK A;  2YFS A;  3OM5 A;  4MLG A;  3NQH A;  3LV4 A;  4PVI A;  1VKD A;  4KCB A;  1W2T A;  5AY9 A;  4EQV A;  2AC1 A;  3UGG A;  3WAS A;  1ST8 A;  1YI7 A;  4UDK E;  4KC8 A;  5JOY A;  2QQW A;  1Y4W A;  2X8S A;  3ZXL A;  3AKF A;  4JQT A;  4B1M A;  3VSZ A;  2QQV A;  2OXB A;  5C0P A;  1GYH A;  5GLM A;  3WMZ A;  3ZR6 A;  4CCC A;  3ZR5 A;  5AYC A;  3R4Y A;  4UFL A;  1W18 A;  2AEZ A;  3C7E A;  2QQU A;  3VSF A;  3OM6 A;  4QHZ A;  5GLN A;  4AK6 A;  3BYJ A;  5A7V B;  3BYL A;  4UDG A;  5JOX A;  5GLL A;  4FFF A;  5B6T A;  3UGF A;  4FFI A;  4HXC A;  3CU9 A;  3WAU A;  5JOZ A;  3U14 A;  2ADD A;  5ANN A; 
#chains in the Genus database with same CATH topology
 1SPP A;  2Q4S A;  1HJG A;  1I3H A;  2WRA A;  1VBC 3;  4XFI A;  1UY4 A;  1RUH 1;  2D6K A;  3BCW A;  4UFI A;  3SIS A;  4IUG A;  2P34 A;  2NMO A;  4ZU5 A;  5FLI A;  4AAP A;  1GUI A;  5LA9 A;  5CFD B;  1JU4 A;  2PHU A;  1EP0 A;  1HQW A;  2RS5 1;  1YJK A;  3ZFG A;  2G19 A;  4XJZ A;  4O7X A;  1W9Y A;  5FZH A;  3WF2 A;  3ZXJ A;  1RED A;  2GND A;  3I3D A;  1A8D A;  4JTO A;  5C4W B;  4GMP 1;  5D8A B;  3N9M A;  1HIX A;  1MZE A;  3QD6 A;  4BQX A;  2O1Q A;  3NO8 A;  3WPY A;  4OZO A;  3ACI A;  3OY8 A;  2Y33 A;  2PHX A;  4N43 C;  2WAO A;  1CAX A;  2K0G A;  5ABJ A;  1JUI A;  5BY5 A;  4GB3 2;  4XQD A;  3UYJ A;  4ZS3 A;  4O8P A;  3LDK A;  1FAY A;  3N9Q A;  3VHP A;  4OHW A;  1RYY A;  3N7L A;  2VUC A;  1AX2 A;  1XPW A;  1NCQ C;  3V0B B;  5JZG B;  2RMU 3;  2VVE A;  1RUD 1;  1K5J A;  3A23 A;  4OUM A;  1W3V A;  2AAC A;  3ZFE B;  1W90 A;  4MV2 A;  2E51 A;  1GBG A;  2X53 S;  4A45 A;  1KIT A;  2HWC 1;  4AZZ A;  4TXW A;  1KFU L;  4BOW A;  1Q5O A;  3QED A;  2IUW A;  5EJZ B;  3H42 B;  1W8T A;  3H8R A;  4OZX A;  4Q4Y 3;  1D4M 2;  3KCC A;  2Y6G A;  2YFU A;  1XSR A;  1HB1 A;  4XAE A;  5F3G A;  4I0B A;  1WUV A;  1XOY A;  2XGX A;  2VCB A;  1RL3 A;  3M3I A;  4QQO A;  3WDW A;  4IEV A;  4XZP A;  2JIC A;  4LHK A;  4UDK A;  1OT5 A;  1V70 A;  4MGK E;  5JSO A;  1KS5 A;  3AMH A;  1LGB A;  2HWE 2;  2JB8 A;  3H3L A;  3NAP A;  5DDJ 2;  5FLH A;  1H1I A;  1W2U A;  2KR2 A;  2ZEZ A;  4P9J A;  4L9B A;  3SC7 X;  3FHI B;  3N36 A;  4CDU B;  1FOD 3;  4D47 A;  1QH7 A;  2D7F A;  3E5Q A;  1ZM1 A;  3M3O A;  3WPV A;  4WM7 A;  1QNY A;  2RS3 3;  2ZGT A;  3DXT A;  3OF1 A;  4E4Z A;  2R0H A;  3DYM A;  3RYR A;  1QMJ A;  4BZ4 A;  3WQ0 A;  5FY5 A;  2LTN A;  4XF0 A;  3RNS A;  1LEN A;  1RHI 3;  4IEY A;  1E5R A;  1YC6 1;  3O12 A;  4DXZ A;  2P5B A;  5IYY A;  3VBU C;  4I09 A;  4Y3O A;  1RUJ 2;  5J37 A;  1IPJ A;  4E8D A;  3LV4 A;  1R1A 3;  3OJB A;  3VDC A;  4AVA A;  3J8F 2;  3NJX A;  4DRR A;  4MXV A;  1PZ7 A;  3BIE A;  5IW0 A;  4FQZ A;  4QD2 A;  2QQW A;  3SNM A;  1S2B A;  4M0N A;  1I6X A;  4O65 A;  5C3P A;  1X9P A;  2QQK A;  3WR0 A;  2ZHN A;  4UT5 A;  4UOJ A;  1CAW B;  2OT7 A;  1GZW A;  1W9T A;  4MAD A;  4ONU A;  4Q4W 3;  3VKL A;  4BDV B;  3OPT A;  3TEX A;  5H9R A;  3PVB B;  1DGL A;  2EIB A;  3MIG A;  5BNO C;  3M7A A;  4QHZ A;  4RHV 3;  4RQP C;  1IS4 A;  5J7M A;  1MVQ A;  3BYL A;  1W6M B;  3VBO B;  5IT6 A;  2ATF A;  4KBZ A;  2PHF A;  4FFI A;  2VOX A;  4DZG A;  3ZN6 B;  1NQD A;  4NIG A;  4XJA A;  1WD3 A;  2RM2 2;  1EV1 2;  5JPM B;  1OYG A;  2GMP A;  4IES A;  2BOI A;  1Q8V A;  1AXK A;  2LM3 A;  3BVC A;  3IAQ A;  4QHB A;  2HWB 1;  1PO2 2;  1SBE A;  2JG9 B;  3FBY A;  4JGZ A;  4D7T A;  3WLU A;  4QB1 A;  2F17 A;  1JH5 A;  1I9R A;  4DXR A;  1RC6 A;  1C8M 1;  5A7P A;  4GMP 0;  4KMI A;  1REF A;  5FKB A;  1H2L A;  3KST A;  4UF0 B;  1XYP A;  1J84 A;  1HV0 A;  1RMU 2;  3FLP A;  1W2N A;  3LEM A;  1ZBA 2;  1WW4 A;  2IXK A;  4DMI A;  2WDB A;  4PF1 A;  3D61 A;  5IWF A;  1UD1 A;  4LT5 A;  4YVS A;  1VRB A;  2W2I A;  3SIT A;  2WNO A;  4HLT A;  3O0X A;  4CDW C;  4N90 A;  1YIP A;  4FFH A;  3VZM A;  1QF3 A;  4J6G A;  3SEE A;  2HKX A;  2WWU A;  2GDF A;  4AAX A;  1R64 A;  1OLM E;  4FPY A;  2A6X A;  1ND3 C;  3THP A;  4AQ2 A;  3O1O A;  4C1W A;  4N7I A;  4QKD A;  4NHX A;  2PLV 3;  3VZK A;  2EAL A;  4Y1X A;  1GP6 A;  5LRS A;  4PF5 A;  4UFK A;  1BEV 3;  4YW7 A;  2E7T A;  1O5U A;  4NN0 A;  4XMI A;  1K45 A;  1AR9 1;  5DZE A;  1GSL A;  2RVA A;  2XJT A;  2GN7 A;  2D3R A;  5LY2 A;  3N7J A;  5D1I A;  2FCU A;  2W1S A;  1LHO A;  2YU2 A;  5JXG A;  1AYM 1;  5L7O A;  4Q4X 1;  4JGY A;  3SH4 A;  4N53 A;  2DU1 A;  2GZW A;  4UW6 A;  3WOG A;  4XDQ A;  2LAL A;  4AFB A;  4BIO A;  1VBE 3;  2XXZ A;  1H9P A;  1TE1 B;  2BGP A;  1OF3 A;  3FZ3 A;  4RL7 A;  1JYV A;  4YVW C;  2DU0 A;  2W39 A;  5DAV A;  1V6K A;  2CAV A;  1Z7S 1;  3AKQ A;  4NHK A;  3R4D B;  4P14 A;  4C8D A;  4Z92 B;  4CP2 A;  2GAL A;  2VR4 A;  4LMF A;  1RUF 1;  2KD7 A;  1S0D A;  1URX A;  3Q8C A;  2ENR A;  5FJK A;  1IS3 A;  2A3W A;  1QY4 A;  2Y6F A;  1FI2 A;  3PTY A;  3KV4 A;  4JDN A;  3N3H A;  4MGI E;  2YFS A;  3NV4 A;  2ARC A;  1I5Z A;  4FP2 A;  4TLF A;  4CU8 A;  4KL1 A;  2ZA9 A;  3CJI C;  4AQT A;  4YGB A;  3B94 A;  2YB7 A;  4AED C;  4QX0 A;  5FY9 A;  2Q8C A;  3H7Y A;  2VO5 A;  2YYO A;  3W9A A;  1PMJ X;  3PHM A;  4XET A;  5K0U C;  2ZAA A;  4PI0 A;  4Y4Y A;  2ET7 A;  1UOB A;  3VSZ A;  5FBZ A;  1DZR A;  2TBV A;  4P5Y A;  2QJV A;  4IV1 A;  5A3U A;  4XFF A;  4Z2A A;  1JZ6 A;  5AYC A;  3ZPO A;  3VZN A;  3WW1 A;  1S2E A;  1XNT A;  3VDD C;  1D4M 3;  1YXW A;  1O4Z A;  2QDR A;  2P1B A;  2Y0I A;  4GKY A;  5LBB A;  3OYW A;  3PVO A;  3RG0 A;  5AFB A;  4UDG A;  2E31 A;  2PAE A;  5JOX A;  5FUI A;  2V5Y A;  3WY6 A;  3GM8 A;  5B6T A;  1ZVF A;  1ZBE 2;  1YCI A;  2DUQ A;  3PU3 A;  1SPP B;  2VU9 A;  4QXC A;  3AK0 A;  1XNC A;  3WHT A;  4N8M A;  1H1A A;  3ZDV A;  2ZGK A;  2Y6H A;  5GLQ A;  3VKM A;  4N9H A;  3SXW A;  3HWJ A;  1MAC A;  4PCR A;  3PIG A;  1GWK A;  4BQ2 A;  2DCT A;  4YGD A;  3ZXD A;  1NZC A;  1QJX 2;  2XWJ B;  4XMA A;  2RE9 A;  1BMV 2;  2R6Q A;  1WMD A;  2WLQ A;  4IGO A;  4FCA A;  3ZFG B;  3NWK A;  4GWI A;  5F8P A;  1SDW A;  4LUK A;  4UAP A;  4AHY A;  4L8Q A;  5GM0 A;  5CAZ A;  3P5B A;  5FPL A;  5GJ6 A;  3CNA A;  1MS5 A;  5HV0 A;  4WM8 A;  3HPN A;  5HCF A;  5JXH A;  4FT8 A;  5A8D A;  2JDP A;  1RUJ 3;  1W0O A;  3CL1 A;  3AXE A;  2C0Z A;  4YZ4 A;  4GB3 1;  3DN7 A;  3RZZ A;  4GAZ A;  4PLM A;  2VCM A;  2JDZ A;  3WP5 A;  1RUI 2;  4QB2 A;  5ABJ B;  3KB5 A;  1TME 1;  2V73 A;  1LJ7 A;  3IZO A;  3SCG A;  4CCO A;  5LW9 A;  4TSV A;  4LO5 B;  3ZSJ A;  1X7N A;  3THT A;  5FPU A;  1QGL A;  3N4M A;  4CDX B;  3KF3 A;  2J42 A;  2FDF A;  3RZG A;  1POV 3;  4R8H A;  3LEI A;  3RDI A;  3WDU A;  1TL2 A;  4W6Y A;  4F8A A;  2WJS A;  5FY7 A;  1ULG A;  4ASM B;  1PHM A;  1UZW A;  1AR6 2;  2BVV A;  1OD3 A;  3OGG A;  5FQ0 B;  5KWR A;  3H1Y A;  5JIA A;  1NQJ A;  2XLG A;  4D7S A;  1VB2 A;  3ZFF C;  3ALQ A;  2MPF A;  4XZU G;  2W91 A;  3ZOI A;  3VKN A;  1LAJ A;  2WWJ A;  5L19 A;  1Y7B A;  4QQS A;  5LAT A;  4OUL A;  1YQ2 A;  3M3E A;  2ZGR A;  3AMM A;  1G9F A;  5A7Q A;  3H3Z A;  4CEY C;  2RM2 3;  1J1T A;  4C0H A;  3ROU A;  4R9C A;  5GLZ A;  1VBA 2;  2D93 A;  3N9O A;  3WNM A;  1D0G A;  1NE4 A;  4GZ9 A;  4QPI C;  2E6V A;  3NAP B;  3WMY A;  3MYX A;  5LK5 A;  3K1U A;  3A22 A;  3S5Q A;  2PQS A;  2YC2 A;  1KRI A;  1XYN A;  3MIE A;  4WM7 B;  1WW6 A;  5A6X A;  3UJQ A;  3U0Z A;  1HX6 A;  3MW2 A;  2D5F A;  5GAL A;  2UUR A;  4YZ1 A;  1RMU 3;  5HBA A;  2JE7 A;  1W8N A;  4XUO A;  4LLF A;  1UXZ A;  2HYX A;  1LGN A;  1C8N A;  3HBK A;  4AFC A;  3J8F 1;  4DY3 A;  4MLG A;  1ND2 A;  4Y5S A;  2VBB A;  4QHO A;  4YGE A;  2JEC A;  3NVC A;  4MXW B;  1SEF A;  4HBN A;  5JXJ A;  3H1M A;  3GZU C;  4Q27 A;  1J58 A;  3WG1 A;  3WNN A;  2Y8K A;  1N3P A;  1OH3 A;  4OMD A;  1VIW B;  1WCU A;  2WFF 1;  3U10 A;  2B46 X;  2ET1 A;  5BNQ A;  3E5U A;  3GBF A;  2QBX A;  2ZKN A;  5FZB A;  4MG2 A;  3WMZ A;  5BNP C;  2E26 A;  1MS4 A;  2Y6K A;  3P3N A;  3ZR6 A;  5BNN A;  2MNG A;  5FYB A;  4CRQ A;  2RJK A;  2Q1Z B;  1SZB A;  2X10 A;  1CGP A;  2WS9 3;  3JD7 3;  2Y6L A;  3IDE A;  3HQX A;  1CVN A;  4FPH A;  1O6U A;  2VBP A;  3AVS A;  4NR1 A;  1MS9 A;  1XC6 A;  2VW0 A;  3FE5 A;  3IDB B;  3CZJ A;  1XU1 A;  3GBW A;  4XBQ A;  5GKA C;  1AR7 3;  4DUW A;  3UKT A;  3KGZ A;  2IXJ A;  4R9A A;  2DUO A;  4RS5 A;  2CWS A;  2ADD A;  3D4K A;  2JG8 C;  3R05 A;  3JZV A;  3I3M A;  2NM1 A;  2WZE A;  1BKZ A;  1LHU A;  3BOP A;  4ZS2 A;  2E7Q A;  3VD9 A;  1QH6 A;  4I01 A;  4S2G A;  2J7M A;  4TWT A;  1SLT A;  4I0A A;  3ME2 A;  3SHR A;  3VHN A;  3WZ1 A;  2VE1 A;  2GNM A;  2KA3 A;  3K3N A;  3BKZ A;  1UXX X;  4CP1 A;  3MF9 A;  5C9A B;  1B09 A;  1IOA A;  2PQQ A;  3RRD A;  3CDZ B;  1HN1 A;  4ZY9 A;  2BGO A;  1UCX A;  1WLW A;  3HJR A;  3HN1 A;  1VE0 A;  3LB9 A;  5FXW A;  3U07 A;  1B35 B;  4B29 A;  4BMB A;  1YYN A;  4BLJ A;  4DUV A;  1V0A A;  4MGS A;  4B3N A;  2KXL A;  3OGV A;  1R1Z A;  5M0T A;  1PGW 1;  4YVS B;  5JLV A;  2EAA A;  1D2S A;  3M3Q A;  1JYW A;  1T6G C;  2XJP A;  4P08 A;  3JQW A;  1W03 A;  4BQ1 A;  4CXY A;  2ID4 A;  1UAI A;  2XUM A;  3HNM A;  1IPS A;  1OBN A;  1DZT A;  2AR6 A;  2XQR A;  3IN9 A;  3D60 A;  5JWP A;  3E6D A;  1OOP B;  4FTE A;  1OOP C;  3Q8B A;  2ZKL A;  4LXL A;  4P9X A;  3DPR B;  5F5Q A;  4E2G A;  4UDJ A;  2A6Y A;  2WNV A;  1DGR A;  1OA4 A;  4EN7 B;  3R4U A;  3VZJ A;  1PGS A;  4H14 A;  1QDC A;  3MPB A;  2ZAC A;  2YZ4 A;  3RVH A;  5AC9 3;  5D21 A;  3I2H A;  2WQZ C;  2JWP A;  1ZBE 3;  3SQO A;  1Y9G A;  1J1L A;  4BXF A;  3ZXK A;  2P17 A;  3WN1 A;  2Y60 A;  2FD8 A;  4LE3 A;  1AL2 2;  3HNY M;  1DQ5 A;  4Q1P A;  3RZM A;  3CIH A;  2W9X A;  4JRL A;  2CDP A;  3AKP A;  4LK6 A;  4YW6 A;  5FBJ A;  5G05 L;  2FDK A;  1PMH X;  3R4S A;  1E5H A;  1F35 A;  3NL1 A;  1VRH 2;  4TN7 A;  4NHM A;  1QJX 3;  4MSV A;  2WO7 A;  4YLZ A;  3UT0 A;  4M4R A;  2TNF A;  1RGS A;  3I97 A;  3PUQ A;  4FFG A;  4DEQ A;  4PIZ A;  4RA0 A;  4XFG A;  5T5O A;  2ADE A;  2CGP A;  3TRS B;  4QPW A;  2VD7 A;  3LDR A;  2F4L A;  2WSV A;  3ACL A;  1UKR A;  1F31 A;  2Y64 A;  3OD0 A;  5L73 A;  2AEN A;  3VB9 A;  4EV0 A;  4OI0 A;  1SCS A;  1PGL 2;  4NOV A;  1FPN 2;  4XUR A;  5DQ0 A;  1UOG A;  2XJU A;  2B8M A;  2OII A;  2R04 1;  1RUI 3;  4AEJ A;  4YRD A;  2OS2 A;  1VBD 2;  4N43 A;  2VQA A;  4AYU A;  1XJA A;  2BQP A;  1WBL A;  4QPG C;  2ORZ A;  3ELN A;  3FUO A;  3T1M A;  1FNZ A;  4FP3 A;  1G9B A;  1NCQ A;  4ES8 A;  5HCH A;  1KQR A;  1RB8 G;  5A3O A;  4PIY A;  1Y3T A;  4QKN A;  3WV6 A;  3ZYR A;  2VW2 A;  4B1M A;  2OPW A;  1VBC 2;  2VMI A;  3WW4 A;  3AYD A;  1WGP A;  1W6O B;  4C0B A;  4XTP A;  2PHR A;  4ZPI A;  2VNV A;  3U11 A;  1K5M B;  5FZ9 A;  2IXH A;  1BHG A;  3UKN A;  5LAS A;  1WME A;  3WG4 A;  4Y1U A;  5A7W B;  1A3K A;  5DAX A;  5F3I A;  3USS A;  5F32 A;  1UZV A;  4JDM A;  3VDB A;  1JOB A;  5C8C B;  2Y6J A;  3ZSK A;  4CTE A;  2WIN B;  4CPB D;  3BTA A;  4U36 A;  1OD5 A;  4LE4 A;  3TN9 1;  3WW2 A;  1VBA 3;  1CAV B;  2A70 A;  2OQ7 A;  4LO7 A;  4FPG A;  2UY9 A;  1GOH A;  4I0W B;  5F39 A;  1AHS A;  5IVY A;  5SV5 A;  1K12 A;  4HFS A;  4IQP A;  1YFY A;  3KVA A;  4XUP A;  3FLR A;  3LKJ A;  4KC7 A;  1DZQ A;  2HWF 2;  4IE0 A;  1YUD A;  4XC9 A;  5DAQ A;  3JBG 1;  4PQ9 A;  4Y33 A;  4L11 A;  4G9S B;  5C33 A;  1PIV 1;  1T6B X;  1STM A;  1UPI A;  2RDQ A;  2RMU 2;  1W28 A;  4GWM A;  4Y24 A;  1HN0 A;  4CDQ A;  1DP0 A;  3VSR A;  4DRV A;  2A5Z A;  2B42 B;  4AFM A;  2Q0A A;  3FJS A;  4IE7 A;  2P6C A;  5FZO A;  5IK5 A;  3VSS A;  4OLL A;  1CJP A;  4Q0S A;  4YWA A;  5FZG A;  4UI9 L;  3WQ1 A;  4HK9 A;  2BNO A;  5F7U A;  1COV 2;  4ZXE A;  3DCQ A;  2UYB A;  4HPK B;  3VGI A;  4GD4 A;  4LTA A;  1NCR C;  1XNK A;  3MIB A;  5DAP A;  4D3W A;  1HQL A;  1Q8P A;  2IVI B;  3E5X A;  2VCC A;  4QT6 A;  2WR9 A;  4B4R A;  2OZ6 A;  2O0O A;  4Y1Z A;  5FOJ B;  5EJ1 B;  5IK8 A;  2X29 A;  5FP8 A;  2SBA A;  1HV1 A;  1UF2 C;  2W52 A;  3UNP A;  2G9Z A;  1GMM A;  3L2H A;  4LBK A;  1VMJ A;  4AK5 A;  5BNO A;  1I5P A;  3POI A;  5CFC B;  2WNU A;  4O8O A;  3AZV A;  2EVX A;  2CL2 A;  3KM5 A;  2RS3 2;  2D6O X;  5IAV A;  2R07 2;  4UW5 A;  3M8L A;  5J36 A;  3E97 A;  4PVA A;  1RHI 2;  5DXD A;  5AFE A;  1PK6 C;  5FV3 A;  1PO1 1;  4HOO A;  1R1A 2;  3LFI A;  2B7Y A;  1X8E A;  5FXZ A;  3N9L A;  1PVC 2;  2E9Q A;  3POG A;  4XUQ A;  4IER A;  4Y26 A;  5F6K A;  3GJA A;  2PHT A;  1AZD A;  2OQ6 A;  2QQN A;  4XXA A;  5FYT A;  4Y1Y A;  1VAM A;  3RSJ A;  4E4S A;  4W65 A;  2VZO A;  1RUC 1;  3GBG A;  3HQR A;  3T2Q A;  5I8Y A;  2P6H A;  2VQU A;  4LEJ A;  2GMM A;  2BGC A;  4FPK A;  1ND2 B;  4HKO A;  1Q8Q A;  2WT0 A;  4D6R A;  2QQM A;  2CGN A;  5ACA 2;  4CDW A;  3WUC A;  2R0F A;  1VR3 A;  1YHF A;  3CJX A;  4RHV 2;  1V6I A;  1UYZ A;  3FMG A;  3OGS A;  1LRH A;  1QQP 1;  5FJH A;  1TMF 3;  3MV1 1;  2AC1 A;  1H8V A;  3LAG A;  5CKN A;  2VZ3 A;  1XBF A;  1ND3 A;  1QNW A;  4W4Z A;  5JOY A;  1LCL A;  3BYW A;  3UJO A;  4CEW A;  3JUU A;  1XU2 A;  2DVA A;  2VGD A;  3ATG A;  4LKE A;  4Y20 A;  4Q2F A;  4BQ4 A;  1S55 A;  4K8R B;  3LA7 A;  5BNN B;  4XYX A;  1OPM A;  1PMI A;  2ARA A;  5E6H A;  4XAA A;  3S0M A;  2JD9 A;  2AH2 A;  2AEZ A;  2AUY A;  1F5F A;  3VBF B;  1SBF A;  2DVG A;  4RGA A;  1CZV A;  2QVS B;  3VBF C;  4O9E A;  4HKW A;  4EWA A;  5LBC A;  1K42 A;  1WA4 A;  2VXJ A;  1BZW A;  1UL9 A;  2JEN A;  5FWE A;  5FZF A;  1UZY A;  4RS5 B;  2E33 A;  1MR5 A;  5FP3 A;  1MQT B;  2VVD A;  4Y4R A;  4YAR A;  4YG0 A;  1MQT C;  4IDZ A;  5IFP A;  1JYT A;  3BGA A;  3ON7 A;  4H3W A;  2Q8O A;  5F3C A;  5I0S A;  2D3P A;  1X8M A;  4YVW A;  5DZF A;  3UV9 A;  4JKK A;  4COW A;  1JU3 A;  2EAK A;  5FYH A;  3K75 B;  1O59 A;  5GLR A;  1YQ6 A;  2YMZ A;  3KT4 A;  4NPM A;  4W50 A;  4XVH A;  3IMN A;  5FZ7 A;  1KFX L;  4XJU A;  2C5D A;  1JOJ A;  2W08 A;  5JMO A;  1NY7 1;  4IGP A;  4LO8 A;  1VBD 3;  2YV8 A;  1BEV 2;  2Y26 A;  5CG8 A;  2A7A A;  5FXX A;  3CJI A;  4LK7 A;  4HVR A;  5GZF A;  3PVE A;  3QH7 A;  4PDW C;  4AED A;  2VNR A;  3GHN A;  4U6D A;  5CKM A;  5E8A A;  1WMX A;  1NE6 A;  3RWN A;  4DPN A;  1ENQ A;  1RUD 3;  3GCX A;  4XFC A;  4XFH A;  4A7Y A;  2ZX1 A;  3K46 A;  3T2O A;  4YZ5 A;  2JB4 A;  4GJY A;  1VBE 2;  1JZ2 A;  4M00 A;  5FMC A;  4GWN A;  2HWC 3;  1Q8S A;  5CFD C;  5I93 A;  1LHN A;  1ZZ6 A;  3WAT A;  3N7K A;  1IZ3 A;  1GV9 A;  5EJ3 A;  5FO9 B;  3ZSM A;  4NUB A;  2D6L X;  4N2Z A;  2ZMK A;  2J1E A;  4FPL A;  5EV7 A;  4AHW A;  4OMC A;  4FOW A;  1G9C A;  5B6S A;  2BBA A;  2O8O A;  2EXI A;  3LSD A;  3POE A;  4OI4 A;  4Q29 A;  5D8A C;  3ZYG A;  1QJU 1;  1ZRR A;  5C4W C;  2E63 A;  3H7J A;  3I49 A;  1V6N A;  3K4A A;  4M4P A;  1FMD 2;  1VRH 1;  3IBM A;  5T5L A;  3I54 A;  3RPQ A;  1WCD J;  2HWF 3;  5LWB A;  4FXK B;  5JR7 B;  1GYE B;  1LOB A;  2W5F A;  1O5L A;  1BK1 A;  1RXG A;  4LBQ A;  2L9L A;  2XBO 1;  3ZMO A;  1HXS 2;  3NMB A;  3NW4 A;  5JZG C;  2UYA A;  4Z2W A;  4FVV A;  3V0A A;  2ZEY A;  3M4F A;  2XJQ A;  1LED A;  1R08 1;  2ZCW A;  4NJ4 A;  3ZFE C;  2WQ8 A;  3LQC A;  1MZF A;  4COV A;  3DKW A;  2RS1 1;  2VMD A;  3PL0 A;  5F1R A;  1ASJ 1;  2MEV 3;  3G7D A;  3TYJ A;  1UNB A;  3LF7 A;  3MIH A;  3QZ4 A;  1RUG 2;  1PZ9 A;  3MUZ 1;  3E6B A;  1COV 3;  4EN9 B;  2NLR A;  3OB8 A;  4BQ3 A;  2WAA A;  2ZHM A;  1AX1 A;  4FTS A;  1S0C A;  1A6C A;  2G9F A;  4IE6 A;  1OVP A;  2YBS A;  3I2K A;  2QNK A;  2D5H A;  2XG3 A;  3UGG A;  1QWR A;  3WIN E;  1GYK A;  4A41 A;  4N9I A;  1GWM A;  3MHZ A;  3B9C A;  3AKF A;  4JTN A;  4YFZ A;  2ERF A;  2XON A;  1JXN A;  4D6Q A;  3BU7 A;  4Q4V 1;  2P3Y A;  5K8S A;  3VD3 A;  1Q8O A;  3S7E A;  5A32 B;  4P9W A;  3ZR5 A;  4CDU C;  2AGS A;  4JCK A;  3ZFF A;  3AZZ A;  1OUS A;  2R07 3;  2XJR A;  2BUK A;  1MEC 2;  2J1S A;  5CIR A;  4NIA A;  3VBH B;  4QDR A;  5J48 A;  4XHX A;  2DCJ A;  4CEY A;  3M1H A;  4AFD A;  4K1Y A;  4LOT A;  4Y1V A;  5E1R A;  3CU9 A;  5ANN A;  2ZGN A;  3VUO A;  2JDU A;  3QCW A;  5IAT A;  5KXC A;  4PQQ A;  2BOJ A;  4JZR A;  4TTG A;  1NOV A;  1PVC 3;  1LOD A;  2K2S A;  2VUJ A;  4E2S A;  2HWB 3;  3K3O A;  1CX4 A;  3RYK A;  3WT3 A;  3AYE A;  1PX4 A;  4LPL A;  1O7F A;  1WW7 A;  4CDQ B;  3Q8F A;  4QGL A;  2V09 A;  2CDO A;  2VMG A;  3OPW A;  5FZO B;  1A8M A;  4Q4Y 1;  3ZXG A;  1OQE A;  5JDB A;  5ACA 3;  4O8N A;  1JZ7 A;  2DUP A;  4PI2 A;  4P5H A;  4Q0U A;  4ZON A;  3WXP A;  3K4Z A;  3VBO C;  3MLK A;  1IG3 A;  1QXR A;  3DL3 A;  1QJZ A;  2XVG A;  3I2D A;  5DAB A;  5JMC A;  3KWV A;  1O3T A;  2FBE A;  2C9K A;  2WSU A;  2C6S A;  3DV8 A;  3H1W A;  5KHH A;  1DCS A;  4ZZ5 A;  4H7L A;  1RJ7 A;  1CES A;  2JE8 A;  4EJR A;  5FO8 B;  2HWD 2;  4RGG A;  4R9D A;  1H6X A;  1FOD 1;  1CON A;  1O4Y A;  1ULC A;  2JG9 C;  3MIC A;  4NHL A;  5FK7 A;  4C90 A;  4C91 A;  4EZ4 A;  1VB4 A;  3IT8 A;  4XEZ A;  4AOC A;  1N1S A;  3VBR B;  1ZRF A;  1PNG A;  3VBR C;  5LA0 A;  1QJE A;  3ES1 A;  1KDM A;  1WW5 A;  1S2K A;  1VBB 1;  5A6Y A;  5FZC A;  2AYH A;  2R06 2;  3CF6 E;  2JG8 A;  5EPA A;  3TWI A;  5GZG A;  4TYS A;  1OKQ A;  1S0F A;  2JX9 A;  3J7L A;  4MHR A;  2XDV A;  4XCB A;  4BB3 A;  4DO0 A;  5F9T A;  3H9A A;  3J7N A;  5A3N A;  5AYE A;  2X8T A;  4BQY A;  1JS9 A;  3T08 A;  3DYP A;  4XIO A;  5CG9 A;  3ZIW A;  1OHF A;  4B4Q A;  4XFB A;  3W21 A;  3INA A;  4FPF A;  5A33 A;  4XJ9 A;  1Z7S 3;  4IND A;  2JIG A;  1HRI 1;  2ZS6 B;  4Q4W 1;  2B39 A;  5C3Q A;  1GR3 A;  2JE9 A;  4LIV A;  3ZKY A;  2NQY A;  1DYO A;  4ORF A;  4M0H A;  4KGG A;  3TB0 A;  4GH4 B;  1DQ4 A;  3USU A;  1L7R A;  1ZZC A;  1E5S A;  4GH4 C;  1DQ0 A;  4XF3 A;  1JMU B;  1SMV A;  2WS9 2;  1BK0 A;  1PX3 A;  2D3S A;  3JD7 2;  4JAA A;  1Z0H A;  4LUM A;  3ZYJ B;  4Z8B A;  1BXH A;  5EYY A;  4PVI A;  1OUX A;  5AY9 A;  2JDH A;  3OBT A;  1AR7 2;  4QM8 A;  4ZU7 A;  4B8E A;  3KCX A;  2CAU A;  1BBT 1;  4LIU A;  4CEW B;  1APN A;  1Y4W A;  5B4X A;  1XRU A;  4C1X A;  4Y20 B;  1OC1 A;  1JHJ A;  4ZKT B;  1UU5 A;  4YM1 A;  3TEW A;  5C0P A;  2GNT A;  1UKG A;  1GYH A;  2BTV C;  4L2N A;  1F9K A;  4MYE A;  4WZF A;  3VBS A;  5IVE A;  3LOB A;  4IV3 B;  1JOD A;  3T30 A;  4CA9 A;  4R9B A;  5A3M A;  2A73 B;  2ZGL A;  3OM6 A;  1AR6 3;  4AK6 A;  3MEP A;  3LD8 A;  1N47 A;  4JC1 A;  5I8T A;  1L7Q A;  1OQ1 A;  3POW A;  4XDP A;  4BPZ A;  5FFO C;  1FMD 3;  3ZN5 A;  2PMW B;  1RUN A;  5FZ6 A;  2FDH A;  1FV3 A;  1H8T B;  5JAX A;  1FX5 A;  1D0H A;  1AX0 A;  4JX0 A;  2C26 A;  3ZN4 A;  2ZOE B;  5FZK A;  5K9Y A;  1HRV 3;  5C8W A;  1CD3 G;  2ORX A;  3RZJ A;  5FZ8 A;  3TAY A;  1HXS 3;  1I1E A;  4BIF A;  3N9N A;  1NA1 A;  3HAG A;  3I59 B;  5FIX A;  3ZVX A;  2LRP A;  2BJS A;  4RN5 A;  2XJV A;  4YZ2 A;  4DOU A;  2YFR A;  4CP9 A;  2PLV 1;  2VVF A;  4CU6 A;  5FRE A;  2ZEW A;  3U75 A;  3PDQ A;  5TSW A;  1HB3 A;  5CAD A;  4AWD A;  3R4Z A;  5CU1 A;  2PFW A;  1QOT A;  1RUG 3;  5ANQ A;  4MGZ E;  5LA1 A;  1XE0 A;  2LW8 A;  1LOF C;  2YRO A;  4L99 A;  4XIL A;  3WQ7 A;  4MGY E;  2RDR A;  4D69 A;  2XL9 A;  2Y38 A;  3KD4 A;  3BTX A;  3URF A;  3WDT A;  1WLD A;  4EYU A;  3W58 A;  2JDY A;  4PJY A;  5AC9 2;  3AKI A;  1UPS A;  4NRM A;  4QPG A;  5CEH A;  1W8U A;  1ZZ9 A;  4QQ2 A;  1LOC A;  2W92 A;  2Z2S B;  2OYZ A;  1RUO A;  3B69 A;  4URA A;  4AQS A;  2IXL A;  5A6Z A;  1ENX A;  2EIE A;  3HN3 A;  1TQ5 A;  1GNH A;  3W20 A;  1GNY A;  3OGR A;  4TLG A;  1UY1 A;  4HAN A;  4YG6 A;  2H0B A;  1JHN A;  3AKS A;  4U6B A;  1V00 A;  2RG4 A;  1DLL A;  2CGO A;  3ETP A;  1AYN 2;  3V56 A;  2XVK A;  5K7P A;  4NII A;  3AKG A;  3QC2 A;  2ZXQ A;  5A7N A;  1MEC 3;  2I07 B;  2XH6 A;  3ZFG C;  2W94 A;  3O7O A;  2YG0 A;  4NAO A;  4CUC A;  1N3Q A;  1SLI A;  1WKY A;  2VZQ A;  3NV3 A;  1C28 A;  1LGC A;  3NKT A;  4DEV A;  3OY8 B;  1UMI A;  4XOG A;  3WVJ A;  1O3Q A;  1CAX B;  3LA2 A;  4WVZ A;  4OFG A;  3W5M A;  4ZZ8 A;  5ABJ C;  3I3B A;  2PN5 A;  4AVS A;  5IFT A;  2PAM A;  1SLA A;  3SKJ E;  5C7G A;  1MS3 A;  1SCR A;  3X29 B;  5HV4 A;  1AR8 2;  3MZH A;  4CDX C;  3POJ A;  3V0A B;  2EXK A;  1S0E A;  1MS1 A;  3UGH A;  4XAB A;  4V1P A;  1DDL A;  1ODM A;  2F6B A;  3B93 A;  2WZR 2;  4H7M A;  4Y22 A;  1YJL A;  4QU1 A;  2CSG A;  1D4M 1;  3JQX A;  1DYK A;  3AM2 A;  4OYU A;  4CUA A;  1RUE 2;  1UW8 A;  4RR3 A;  4ZXK A;  2VJX A;  1RXF A;  2PXJ A;  1GNZ A;  5EIY B;  2A1X A;  1ZRI A;  4DXS A;  3RFR A;  3OM5 A;  2YBK A;  4MET A;  1SHW B;  1NCR A;  2WYS A;  2BWC A;  4E4H A;  5I91 A;  1PNF A;  1S0B A;  4NOT A;  4XXP A;  4WVM A;  2HWE 1;  5DDJ 1;  1REE A;  1ZNP A;  1RJ8 A;  2V5D A;  3EHK A;  2HWD 3;  4UDK E;  1Q43 A;  1ZZ7 A;  1HJF A;  2ARE A;  2X8S A;  5KHJ A;  3ZXE A;  3O1U A;  1X36 A;  2QQV A;  2VNO A;  3NAP C;  3ZPY A;  3T0A A;  5T52 A;  2QQJ A;  4WVV A;  5DZG A;  1U5Z A;  4P00 B;  4I3P A;  3UL2 A;  2WL1 A;  3DEC A;  4CCC A;  4HVQ A;  2HH9 A;  2BRT A;  3I2G A;  4WM7 C;  1VLN A;  2QE3 A;  1SDD B;  2VTX J;  4IE4 A;  5B4N A;  5L9B A;  1NX9 A;  1RUJ 1;  1X82 A;  1QJY 2;  2H0V A;  1OVS A;  3ACF A;  3AJZ A;  2R06 3;  1QKQ A;  4FPE A;  4EN0 A;  3GAL A;  4YM0 A;  1PK6 A;  4IEW A;  3VL9 A;  4NID A;  4X8P A;  4JKM A;  2P3I A;  2RHP A;  2W3J A;  1D4V B;  1KJL A;  1YNA A;  1YIF A;  1EAH 3;  4P02 B;  4UW4 A;  2DVF A;  3WNP A;  2VC9 A;  5T3N A;  5EXO A;  4I2O A;  1DYP A;  3MDP A;  4I3G A;  3R67 A;  2VMH A;  1POV 1;  1QXJ A;  3OEA A;  5A1L A;  3WDX A;  4AE2 A;  4D7Y A;  4BM8 A;  4IW3 A;  4LHN A;  1GZW B;  3POB A;  4QX8 A;  5BPX A;  5GZC A;  3IM0 A;  4LOR A;  1ACC A;  1H30 A;  4ES9 A;  4BQW A;  3NRU A;  5J98 B;  2ZAB A;  2KM2 A;  2Y34 A;  3NST A;  2Y0O A;  4P9I A;  1CJD A;  2GN3 A;  4LO4 B;  4G3Y C;  1IKP A;  1GU3 A;  3AJY A;  3BOW A;  2WWS A;  1OKO A;  3VDA A;  1W8H A;  3III A;  4URT A;  2RM2 1;  1EV1 1;  3RI8 A;  4KG8 A;  1NLQ A;  1N1T A;  1W6N A;  2R30 A;  4Q8L A;  5FP9 A;  5KHK A;  1E5I A;  1ZA7 A;  2K46 A;  2GC1 A;  2VZP A;  1NYW A;  4JHZ A;  4NWV A;  2BV4 A;  1WMF A;  1PO2 1;  1U0A A;  2DVB A;  5JOW A;  4K9S A;  5LBE A;  4JKL A;  1ENR A;  1GP5 A;  1VAV A;  3ACH A;  4KGQ A;  2G9G A;  3RMY A;  4ERO A;  2Z69 A;  5DMY A;  4FBF A;  3N9P A;  4JGZ B;  1H4G A;  2GC3 A;  5LK7 B;  2A71 A;  2IWG B;  3LZZ A;  4HON A;  1RMU 1;  2X5I A;  4DXT A;  1ZBA 1;  5C9A C;  3BPS A;  3IMM A;  3BTY A;  3ECQ A;  3QH6 A;  5IVF A;  1OH4 A;  1R09 3;  3PUH A;  4CXX A;  1LTE A;  1X9T A;  3NV1 A;  1RVF 2;  1B35 C;  3VLB B;  3AFG A;  2GNB A;  1RIT A;  4LNV A;  2BPA 2;  2RR1 2;  5BXX A;  3LDB A;  1UIJ A;  4YVS C;  3HOB A;  2IFW A;  1PVX A;  3THC A;  5FYI A;  2EXJ A;  1UZZ A;  2QZ2 A;  4Q5O A;  1C5H A;  1ZYB A;  2ARB A;  4M01 A;  1TMF 2;  4F7Z A;  1OPO A;  3BYN A;  5C3S A;  5C5T A;  4BHP A;  1YQ5 A;  3WNL A;  3F2Z A;  2IFR A;  1U12 A;  3FBM A;  1OSG A;  3FUQ A;  4G4F A;  4AHZ A;  4O9G A;  4EE2 A;  3DPR C;  1P8J A;  2HBU A;  2W46 A;  4CVU A;  3BUC A;  3KHC A;  2WII B;  2Q5T A;  4LBJ A;  4KU7 A;  2CWM A;  4YZ3 A;  1LOE A;  3SCF A;  3AP9 A;  3SH5 A;  1LU2 A;  5A7V A;  1WL7 A;  1CWP A;  2R04 3;  4PDW A;  2Q8D A;  1AR7 1;  4CCJ A;  3K51 A;  5FOB B;  1GZ9 A;  3THD A;  2WFP A;  3JCI A;  5L7O B;  4GIQ A;  5JI9 A;  4MX3 A;  3N7M A;  3T3Y A;  1C57 A;  4JGY B;  5IUQ A;  1XNA A;  1V9U 2;  2CHH A;  4HZF A;  3O1V A;  4N53 B;  3S57 A;  4N53 C;  3ZMN A;  1CAU A;  1Z78 A;  3C8X A;  5I0D A;  1AYN 3;  3IWZ A;  4LOS A;  1RUH 2;  4Y5Z 0;  3S7I A;  1OUR A;  2ZJC A;  3ZO0 B;  2UY8 A;  4A7K A;  2XPJ A;  4DS0 A;  2EA7 A;  4AGG A;  3VV1 A;  3EO6 A;  3GF6 A;  4K6B A;  5L9V A;  4MVT A;  3HNB M;  2RS5 2;  5IVC A;  3AB0 A;  4HG6 B;  2OZJ A;  4Z82 A;  5C4W A;  5D8A A;  3BYJ A;  3QLQ A;  2E7A A;  3KQ4 B;  1UQX A;  3AMQ A;  5FYU A;  4AVT A;  3U4X A;  3AXD A;  3SLI A;  5DAW A;  5J3U A;  4BXS V;  2VW1 A;  1J3Q A;  5CBL A;  4K20 A;  1AJO A;  1IS6 A;  1NA1 B;  1POV 0;  1AR8 3;  2Q30 A;  3OTF A;  1CZS A;  5DUU A;  3U78 A;  4N4B A;  2FZ2 A;  5FPA A;  3V0B A;  1W2A X;  3L9J T;  5KC6 A;  1IG0 A;  4CP9 B;  2VZR A;  2WZR 3;  1W6Q A;  3D3A A;  5CYY A;  1CR7 A;  3CQO A;  1RUD 2;  4IV1 B;  3C7G A;  1WLT A;  2JKB A;  1JYN A;  2AEY A;  1RUE 3;  2VZS A;  4RYD A;  2FQP A;  2WT1 A;  2V4A A;  1VJ2 A;  1K5M C;  2RJL A;  1EUT A;  3RS6 A;  5AC9 1;  1M4W A;  1W04 A;  2HWC 2;  1JOP A;  5HXV A;  3C7H A;  5BYN A;  1ODN A;  3OYW B;  3PMS A;  3C2U A;  1ZBE 1;  4W8J A;  3LPF A;  1ZA4 A;  3VHR A;  2R32 A;  2VMF A;  2Q1M A;  3ZYH A;  5C8C C;  5JSR A;  4QDQ A;  2RV9 A;  4HVO A;  1UY3 A;  4IE5 A;  3I7D A;  2VY0 A;  4GJZ A;  5JCT A;  2VOT A;  3HD8 B;  3WW3 A;  2P3J A;  4OI2 A;  4X6Q B;  3D5Y A;  1W0P A;  3BAL A;  2ZGU A;  1N3O A;  2GC2 A;  3D6E A;  4NE9 A;  2NMN A;  2QQP A;  2DF7 A;  2Z5W A;  1QJX 1;  1KEX A;  4QX1 A;  5FYY A;  3ST7 A;  4D8M A;  1BMV 1;  3ZIX A;  1OQD A;  3TNQ A;  4CDU A;  1YRZ A;  1UV4 A;  2YBP A;  3RWK X;  3ZLI A;  2YDE A;  3U4S A;  2ZHK A;  1QJY 3;  4JDO A;  2Z4F A;  5FMB A;  1ULD A;  1H9W A;  4LR4 A;  3EBR A;  4WM8 B;  2YFT A;  4MGQ A;  3R6S A;  1PT2 A;  5EQU A;  4NVP A;  2TEP A;  3VBU A;  3QEF A;  1GFF 2;  1RUI 1;  2MEV 2;  2X8F A;  1GAN A;  1EUU A;  1HLC A;  1MVE A;  5A6Q A;  1PO1 3;  2ZGO A;  3A7Q A;  5DPN A;  2YPJ A;  2GC0 A;  3H0O A;  4OVE A;  4QX5 A;  5FPV A;  2CY6 A;  1F4H A;  3O5S A;  4CCL A;  3PUA A;  2LRO A;  4XCA A;  1CAW A;  1EY2 A;  1IKQ A;  5FY0 A;  5JIU A;  3IDA A;  4QMA A;  2CNA A;  1RUC 3;  4RR3 B;  1LU1 A;  2QZ3 A;  4V2W A;  3VN4 A;  4RQP A;  2VH9 A;  5CFC C;  2DVD A;  2B4W A;  4N2R A;  5A3T A;  1S0G A;  3ZM8 A;  3ILN A;  3LWC A;  1UX7 A;  5J96 B;  1VBA 1;  3ZN6 A;  5A3L A;  2FCV A;  4N7U A;  4QXB A;  1F15 A;  1IGO A;  2OW4 A;  2W68 A;  5LZ6 A;  4MH0 E;  3MIF A;  1W6P A;  1V6J A;  3IIA A;  4XTM A;  5FMO L;  4FOQ A;  4AI2 A;  2RDS A;  2YPD A;  2NP0 A;  3ZX7 A;  2JG9 A;  3ZSE A;  5FUP A;  4ZU4 A;  3AZY A;  1SLC A;  1V6O A;  3K77 A;  5JUV A;  2HWB 2;  3MBW A;  1OLQ A;  4OHZ A;  3DUI A;  4KBB A;  3AMP A;  5FPZ A;  2WQ4 A;  1RVF 3;  2B45 X;  3TOJ A;  1DQ1 A;  4UF0 A;  2VG9 A;  2RR1 3;  3IB3 A;  4FXG B;  1C8M 2;  2A75 A;  4AL9 A;  3WDV A;  2H6B A;  3D8C A;  4NRQ A;  1ND2 C;  2WZ8 A;  3EXU A;  1S1A A;  1UYX A;  2FDJ A;  4KWK A;  5DG1 A;  2QQI A;  3TEZ A;  3H8O A;  1TZO A;  2Q1F A;  4HXC A;  4LKF A;  4CXW A;  1OLM A;  2VOW A;  3P3P A;  3ZYP A;  2DV9 A;  4QXH A;  3M70 A;  3O1S A;  5FZL A;  5A7O A;  5A80 A;  5T54 A;  1UU6 A;  2BER A;  4PHZ A;  2Z42 A;  2VEC A;  1GOF A;  3UKV A;  2IVJ A;  4XE9 A;  1GIC A;  1GLH A;  1N1Y A;  2Z79 A;  3DGT A;  3FL7 A;  5E16 A;  4BLI A;  5BNN C;  2I2S A;  4ZHN A;  5FPB A;  5KBF A;  1GQP A;  4SBV A;  4AR2 A;  1GP4 A;  1GKB A;  4LKD A;  5E88 A;  4DFS A;  3WP4 A;  5H9P A;  1AR9 2;  2NYY A;  4XQ4 A;  1POQ A;  2XKP A;  2WC2 A;  1W6N B;  1O8S A;  1V9U 3;  3A0N A;  5HI0 A;  4RS5 C;  1AYM 2;  4Z07 A;  2IZW A;  2A3X A;  4JRA A;  2D98 A;  4Q4X 2;  1Y9M A;  1RUH 3;  1MS0 A;  2P37 A;  5F2S A;  1ZZ8 A;  3LOI A;  5T55 A;  4YW2 A;  4OHY A;  3MPP G;  5E89 A;  3QEE A;  3T4H B;  3WF4 A;  1V6L A;  2PEL A;  4QU2 A;  1L3J A;  2I45 A;  2HYK A;  1OF4 A;  3DXU A;  3AP4 A;  3FFZ A;  3KVB A;  4KWL A;  3VKO A;  2X5I B;  5A7S A;  2RS5 3;  3PNA A;  5EFU A;  4AVC A;  1QDO A;  1Z7S 2;  4ISQ A;  1XE8 A;  2E32 A;  1O91 A;  3I2I A;  4X6R B;  3RZL A;  1DFQ A;  2VBD A;  1RUF 2;  1LHV A;  3WNX A;  4GMP 3;  1QXP A;  1H2N A;  3H3U A;  3OD4 A;  3QBQ A;  4K1Z A;  2YFZ A;  4OUS A;  3VKF C;  4LJH A;  2DCK A;  4K40 A;  3KS7 A;  3ASI A;  2ZAH A;  2OX0 A;  4J1W A;  5G04 L;  2MHF A;  3C7O A;  5K0U A;  3FC0 A;  3D0S A;  4UW3 A;  5F5C A;  3IPV A;  1J3R A;  1WA6 X;  3WEZ A;  3A0K A;  5ISL A;  2QTW B;  1R08 3;  3B7M A;  2WNV B;  2ZHL A;  4DB5 A;  1UU4 A;  2RS1 3;  3VDD A;  1LOF A;  2GP3 A;  1YFX A;  5FZM A;  4IEU A;  1TG7 A;  5HCB A;  2BNN A;  1XE7 A;  5KXB A;  4NAM A;  3KMH A;  2W0X A;  4Q8K A;  5FK8 A;  4V2V A;  1ZRD A;  3D5Z A;  5CB7 A;  1AL2 1;  2B4K A;  4XBN A;  5FZ4 A;  1UMH A;  3WDY A;  1VKD A;  1W8W A;  2PHW A;  2VZT A;  3OG2 A;  4BIS A;  1CAU B;  4TZD A;  4RGK A;  3A4U A;  3NNL A;  3RMX A;  4AQ6 A;  4CCK A;  1HRV 2;  4J1X A;  1C4R A;  2N7G A;  3NNM A;  5FP7 A;  3HT2 A;  1UMZ A;  3KHB A;  4MZU A;  4Q4V 3;  3UK9 A;  2K9Z A;  1L7L A;  4GWJ A;  4AFA A;  2GAU A;  3ZXF A;  2R49 A;  1F8V A;  1W99 A;  1YWK A;  5APA A;  1PGL 1;  2D43 A;  3LE0 A;  1FPN 1;  4OCT A;  2YUE A;  3HR9 A;  3LA3 A;  1VBD 1;  5FZE A;  2BVB A;  1FYU A;  2JJ6 A;  3CU7 A;  5DUW A;  3G6J B;  2VM9 A;  4LHL A;  4N43 B;  5L36 A;  5GLL A;  1KD7 A;  3UGF A;  1C1L A;  4J25 A;  5IHR A;  4JHT A;  2P2K A;  4EZH A;  3H8U A;  3VD5 A;  2ZGM A;  1O3R A;  2VOV A;  5KHG A;  1NCQ B;  2GSY A;  2QQL A;  1VBC 1;  4HT1 T;  1TME 2;  5FRA A;  1CQ9 A;  4JVA A;  2J1V A;  5DUX A;  5F5I A;  4CDX A;  3JU9 A;  4L0P A;  4DY5 A;  5FDB A;  1W6Q B;  4U2A A;  3OUJ A;  4E4D X;  4ONZ A;  5FTT C;  2ZX2 A;  4BME A;  5LEK A;  2ZPX A;  3AKH A;  1JYC A;  4H2A A;  2VQ0 A;  3D82 A;  3MI8 A;  2EF6 A;  4QKF A;  4IGQ A;  4QXK A;  3WP3 A;  5FQ0 A;  5I0R A;  2EIC A;  1H6Y A;  2EIG A;  4XF9 A;  4QX3 A;  3HT1 A;  2BDR A;  3O1R A;  2RDN A;  3FLT A;  4KH9 A;  3VBH C;  4GQ7 A;  5EYX A;  1DQ6 A;  1CIW A;  2DBN A;  5GLT A;  1UY2 A;  4KI5 M;  5GLK A;  4O61 A;  1TNF A;  2HWF 1;  3OCP A;  3RYP A;  3T0D A;  1LEM A;  3JB8 A;  1GZT A;  3CHX A;  4NPR A;  1QU0 A;  2UWA A;  4MHU A;  4QPI A;  4XJW A;  4B1L A;  3KV6 A;  2RMU 1;  4E9K A;  4QQP A;  2JKX A;  3GZA A;  3EYP A;  5DG2 A;  4YYO A;  4CE8 A;  2WO2 A;  3PVN A;  1BVV A;  4LLO A;  5CKQ A;  5CNA A;  5FKC A;  1FAT A;  4MGT A;  1CN1 A;  1W9F A;  2MEV 1;  2XUE A;  3OSD A;  5EZW A;  4CDQ C;  5A70 A;  1C8M 3;  3QAC A;  3SKV A;  3LGR A;  2X09 A;  5FY8 A;  5FZ0 A;  1Q56 A;  1NT0 A;  1W06 A;  3OUI A;  1COV 1;  4YGC A;  2X8K A;  3VBU B;  5HPO A;  2WA3 A;  2GU9 A;  3P6B A;  4MO3 M;  2D6N A;  1VBB 3;  3JXS A;  2WUH A;  1YI9 A;  2ZX0 A;  3LIH A;  3ETQ A;  4MXW A;  4NPL A;  2ZTN A;  4XF4 A;  3VZL A;  4P9G A;  4AK7 A;  1DBN A;  3HBZ A;  3PJY A;  3DYO A;  5F3E A;  1GOG A;  3RZH A;  4FQ4 A;  4R4Z A;  3WF3 A;  1DF0 A;  4I02 A;  3B02 A;  2VZV A;  1JZ8 A;  1JZ3 A;  3VT2 A;  4NIH A;  2WFF 2;  4QB6 A;  1CPN A;  4R52 A;  5BNP A;  2HEY F;  2DDU A;  2VUA A;  4XHB A;  1HRI 3;  2JD4 A;  3HEI A;  5A3W A;  3WCS A;  1SLL A;  3MV0 1;  3FFQ A;  5FLJ A;  4OI1 A;  2WN3 A;  3ZKU A;  4DQA A;  2RS3 1;  5BUV A;  1A34 A;  2ZML A;  2EXH A;  4QM9 A;  2WYF A;  2R07 1;  4RQP B;  2WNU B;  4LBQ D;  5BNO B;  2WNU C;  1AR9 3;  5A1A A;  3UET A;  2V72 A;  1RHI 1;  2WAB A;  4E2Q A;  1F2N A;  2D97 A;  4LQR A;  1BCX A;  2J1R A;  4AI9 A;  5GLU A;  3W59 A;  3PTR B;  3RJ2 X;  2G1M A;  1AYM 3;  1W05 A;  3I2O A;  2R7E B;  1JZ5 A;  1R1A 1;  1W2T A;  1RIR A;  5SV8 A;  4Q4X 3;  1DGR N;  4QQH A;  3PLQ A;  1SLB A;  5JR2 A;  1NXM A;  3RQ0 A;  3O1P A;  1BBT 3;  1W6P B;  3TBD A;  1EAH 2;  2LUW A;  1PVC 1;  1VPH A;  4CZS A;  1OA2 A;  2JIJ A;  3I8T A;  4OHX A;  1UOJ A;  1J3P A;  3I2F A;  4QX2 A;  2OXB A;  3K2O A;  1W3X A;  2X05 A;  1FNY A;  4SLI A;  5GLM A;  4D0Q A;  4XF1 A;  1QHD A;  3ENR A;  4GA9 A;  5C9A A;  1YQC A;  2CYF A;  1W8F A;  1HW5 A;  1RUF 3;  1WLC A;  1CIY A;  5ACA 1;  1B35 A;  5FO7 B;  1OXC A;  4RHV 1;  3ZYB A;  5B2G B;  2OUJ A;  5I0U A;  4S2H A;  4WZC A;  5CIS A;  5IVB A;  2WN2 A;  4B7E A;  3OBZ A;  3OOX A;  4CDW B;  3KV5 A;  1K3I A;  4YG3 A;  3LFM A;  1PGW 2;  3FX3 A;  4NRP A;  5FYV A;  2ZZJ A;  3KZ4 C;  5FXV A;  3OM7 A;  3LIG A;  3AFK A;  2DBI A;  4K7J A;  1ND3 B;  3DF0 A;  1EPZ A;  4M3C A;  1OOP A;  1WCS A;  2B9V A;  3AYA A;  2O14 A;  4CEW C;  3DEM A;  4WVW A;  3DPR A;  2W95 A;  3PJQ A;  4QPY A;  5IJR A;  3OEB A;  5F2W A;  2XLA A;  3POY A;  5AVP A;  5IVV A;  4FOV A;  3MW4 A;  4IV3 C;  2VME A;  3PUS A;  5FZ3 A;  2ARX A;  4EN6 B;  2FCT A;  2D40 A;  3AVR A;  4ARX A;  3OUH A;  2C1F A;  1W2O A;  4DNY A;  1R09 2;  1AXZ A;  2QQO A;  1GQH A;  2YC0 A;  3KCY A;  5H9Q A;  2A6V A;  4KU8 A;  5F6L B;  4BE3 A;  2FMY A;  1H8T C;  2J1A A;  1U5Y A;  1BVP 1;  1UO9 A;  3POF A;  2BWA A;  4MLO A;  5BV6 A;  4YVW B;  5CZK A;  3RGB A;  1UOF A;  4HET A;  5FMO S;  3U1X A;  3WN2 A;  1X50 A;  2SLI A;  2XB6 C;  3MUY 1;  1ULP A;  1MZ6 A;  5LBF A;  5D2A A;  2VZ1 A;  4B7K A;  3D5O A;  2F4P A;  1CZT A;  1XB9 A;  1H4H A;  1BEV 1;  2CU5 A;  2XOM A;  4YM3 A;  1H0B A;  1TEI A;  3AYC A;  5A1F A;  3QOP A;  1V6M A;  1VMH A;  3M2M A;  1LEC A;  3KQR A;  3NJY A;  4W6W A;  5IAX A;  3CJI B;  5FWJ A;  4GB3 3;  3F95 A;  4AED B;  3AX4 A;  2R04 2;  1W8O A;  4YW1 A;  3GXU A;  3Q8A A;  3I3E A;  1TME 3;  1XXN A;  4XW3 A;  1U5I A;  5K4L A;  2ZX3 A;  5K0U B;  4UFH A;  1BLZ A;  1DG6 A;  3R0R A;  3OM2 A;  3O14 A;  5IK7 A;  1VBE 1;  3B01 A;  3IPV B;  3PIJ A;  4NO4 A;  4LBN A;  1IQD C;  2WT2 A;  3T0B A;  1ONA A;  1W6O A;  3NJZ A;  5LRR A;  3P2N A;  4N1I A;  1JW6 A;  1F4A A;  3VDD B;  4CYD A;  2AZ5 A;  1K5M A;  2R1B A;  2PHD A;  1WBF A;  2VOK A;  4CCN A;  1G9A A;  4COZ A;  3ABZ A;  1H2M A;  5A7W A;  2VDT A;  1AR6 1;  3WPZ A;  3BN6 A;  3FN9 A;  3VT0 A;  4UFM A;  1QIQ A;  1QEX A;  4P9L A;  3SEP A;  5C8C A;  1FMD 1;  1O8P A;  4BYY A;  4Y5T A;  5DN2 A;  1YLL A;  4W6X A;  4BH9 A;  3D0J A;  3S5A A;  2VUL A;  1CAV A;  5C3O A;  3FHA A;  5KXE A;  4XAC A;  1HRV 1;  1WWY A;  4QDS A;  1KDK A;  4HN1 A;  5DDJ 3;  2HWE 3;  1HXS 1;  2VMC A;  2VUD A;  2OUH A;  3TN9 2;  1ST8 A;  1YI7 A;  3OBA A;  4AVV A;  4LBQ B;  4D94 A;  3IAP A;  4QGN A;  3ZYF A;  1O3S A;  3HMY A;  3ZXL A;  4DIQ A;  5FYZ A;  1OA3 A;  2W1W A;  4CUB A;  1DGW A;  1NLR A;  3IDC B;  5FZD A;  3JBG 2;  5FY4 A;  4QAW A;  3R4Y A;  4UFL A;  1RUG 1;  4A6O A;  1PIV 2;  3WX5 A;  4BQ5 A;  2R1D A;  3EJK A;  1ALY A;  4IEP A;  4ARY A;  1S0I A;  2XQX A;  3H50 A;  2RJ2 A;  2JDA A;  1ZRE A;  2UWC A;  3CLP A;  1DLC A;  1H2K A;  4XUN A;  4XDO A;  3WSO A;  3AL5 A;  3J8F 3;  1SAC A;  2YGM A;  4FFF A;  4XPV A;  1HKD A;  4CUG A;  4HPK A;  2ZZQ A;  3EQE A;  3U14 A;  1HB4 A;  2B9U A;  4PLN A;  1W9S A;  4QWN A;  3SH3 A;  5JXI A;  1IS5 A;  4AVB A;  3M3C A;  3B3Q E;  2WFF 3;  4PBO A;  3E6C C;  4AI0 A;  1JUH A;  1JYI A;  4Q26 A;  1CPM A;  3T09 A;  2PA7 A;  3I3Q A;  2XML A;  1A78 A;  4AI1 A;  3WF0 A;  4FSJ A;  2FZ1 A;  1G7Y A;  3ZFF B;  1MEC 1;  4YSF A;  3RZK A;  2ETE A;  1UN1 A;  3WNK A;  1C1F A;  2A6Z A;  5CFC A;  4CCM A;  4ET7 A;  2HJI A;  4AF9 A;  3EMR A;  1PM7 A;  1SBD A;  2BEO A;  3N35 A;  3KF5 A;  3VD7 A;  1J59 A;  1W8Z A;  1LKN A;  2XVL A;  2XHK A;  1QOS A;  3ZDS A;  1MS8 A;  2ZGS A;  3J9S A;  3POS A;  2FHR A;  3C3V A;  3HIF A;  4NHY A;  4ATF A;  4PIX A;  4A2U A;  4CEY B;  2B5H A;  3GZE A;  4UBH A;  5CVR A;  4YW5 A;  1EV1 3;  4CU9 A;  2PYT A;  3LPG A;  4E27 A;  3LEG A;  3KT1 A;  4QPI B;  2FMD A;  2G4I A;  1PO1 2;  4Z1V A;  1YQ8 A;  1JYX A;  1LR5 A;  4UDI A;  1PO2 3;  5AYD A;  3V65 A;  5GLW A;  2VPV A;  3CZU A;  3MFA A;  4OQ9 A;  1KJR A;  4OHV A;  2J1T A;  4ASK A;  1UYP A;  1AUY A;  2ZEX A;  4CCE A;  5C2M A;  1HDK A;  1MZ5 A;  3VL8 A;  3GHM A;  2CV6 A;  4LKS A;  4CP0 A;  1ZBA 3;  4XQW A;  3CMG A;  2ZBJ A;  1AF9 A;  4IL7 A;  5FYS A;  1AJK A;  4HKL A;  4ASL A;  3WPU A;  2W87 A;  1VMF A;  3ILF A;  4AI8 A;  4XIK A;  3OM4 A;  2BFU L;  1E57 A;  3ORJ A;  3BI3 A;  5FLW A;  1RUC 2;  3A21 A;  4LO6 B;  3AC0 A;  2R16 A;  5C3R A;  1UY0 A;  4S2D A;  1XND A;  3SMH A;  3J26 N;  4IEO A;  1SFP A;  4BWO A;  3GNE A;  1QQP 2;  2HWD 1;  3KT7 A;  1JTZ X;  3AKR A;  4AI3 A;  5BNP B;  3DKQ A;  1W9W A;  5GZE A;  3GGL A;  2WA4 A;  4A3Z A;  1KGY A;  1NXD 1;  2DTW A;  1UX6 A;  3AKT A;  4JGZ C;  2JXA A;  3LCP A;  1LOG A;  4BU2 A;  2DCZ A;  1BJQ A;  2OVU A;  3VBF A;  1FXZ A;  1LHW A;  2R06 1;  3ILR A;  4AGR A;  3W5N A;  2ZGP A;  3E1F 1;  5JSP A;  1XSQ A;  2DYC A;  2JG8 B;  1Y9Q A;  5KXD A;  4KCB A;  1EAH 1;  4FO9 A;  1MQT A;  5EP9 A;  1ULE A;  4DIN B;  5KR7 A;  3O0W A;  1D2Q A;  2XL7 A;  2OPK A;  3ES4 A;  3ZSL A;  3NNG A;  4CU7 A;  1JI6 A;  1IHM A;  5A33 B;  1U5X A;  1EYB A;  2BNM A;  4CPB A;  1XNB A;  4QX7 A;  4KG0 A;  4ISR A;  4YFW A;  1NZI A;  5LCW L;  1W18 A;  4MOA A;  5T50 A;  1N1V A;  4FPC A;  2UU8 A;  3VSF A;  3AP5 A;  4COU A;  4XJ8 A;  1HQN A;  2WS9 1;  3JD7 1;  3WP6 A;  5GLN A;  3T4V A;  1GZC A;  1RIN A;  3USU B;  1NY7 2;  4LHS A;  3AMN A;  2OA2 A;  4LBO A;  3GCW A;  5JOZ A;  4F83 A;  5L7O C;  4A3X A;  3AL6 A;  5T5J A;  4JGY C;  2WO3 A;  4M3C B;  2XR4 A;  3OPZ A;  4LA2 A;  4L97 A;  2WO1 A;  4M3C E;  3WF1 A;  3ITQ A;  4AXO A;  3I4I A;  2P4E A;  4CSW A;  1J83 A;  5CFD A;  5IK4 A;  2XLF A;  1CX1 A;  3VBS B;  2VTX A;  3VBS C;  1QJF A;  3KGL A;  2DCY A;  2YU1 A;  1R09 1;  4EN8 B;  4NMI A;  1FT9 A;  2HLE A;  2QDN A;  1SFN A;  4IEX A;  4D6S A;  2JDM A;  3NKG A;  2C4X A;  1AVB A;  2C9A A;  1W39 A;  4A44 A;  3TN9 3;  1C3H A;  2D44 A;  1UYY A;  5T5P A;  4B4P A;  2YGL A;  1QJU 2;  1X33 A;  1TNR A;  3O0V A;  2YHJ A;  2W47 A;  3AP6 A;  3ZYI B;  2XJS A;  5A8C A;  1LOA A;  2JEM A;  5CA6 A;  4FI9 A;  1NA1 C;  2VL4 A;  1JBC A;  1MPX A;  2ZMN A;  3P1I A;  4UWD A;  4P9Y A;  5JZG A;  3JBG 3;  3MID A;  1C5I A;  1DQ2 A;  1UIK A;  2PHL A;  5A3P A;  3ZFE A;  2XBO 2;  4AK3 A;  1PIV 3;  1JZ4 A;  1BYH A;  3O1M A;  1XYO A;  4KQ7 A;  4DUX A;  3GZT B;  3ACG A;  1DGW X;  1GYD B;  3K4D A;  4IV1 C;  2QKD A;  2WKK A;  5FYC A;  4LIT A;  1R08 2;  3ZXA C;  1PM4 A;  1WZX A;  4AEK A;  2VZU A;  2RS1 2;  3GDB A;  4HSL A;  4COT A;  1ASJ 2;  3B00 A;  3FWE A;  1IPK A;  1IQA A;  4YM2 A;  1Y43 B;  1SFY A;  1WD4 A;  5FMD A;  1OI6 A;  4PBP A;  4NRO A;  2J1U A;  4QPG B;  4LBM A;  5LB6 A;  4EWE A;  3MF6 A;  5FUN A;  1LB2 A;  3T1L A;  3TNP B;  4JQR A;  1US2 A;  3MLL A;  4FOY A;  4IXL A;  4IEQ A;  3WD5 A;  1XQN A;  1G9D A;  5FPX A;  4H55 A;  4FTB A;  1AYN 1;  2P3K A;  1VAK A;  4WV8 A;  4YW4 A;  4X8N A;  5J1X A;  5LEJ A;  1RTV A;  3WNO A;  5FCC A;  4OUE A;  5A32 A;  1KS4 A;  4KNC A;  1G6N A;  2I74 A;  3V64 A;  4BK4 A;  3TAW A;  3J4U H;  5GLP A;  1QOO A;  4Q4V 2;  2WZP P;  2GH8 A;  4WBB A;  4F3J A;  1VAL A;  2OKX A;  3I2J A;  2YXS A;  4IET A;  2ILM A;  4WM8 C;  1YFW A;  3VBH A;  1S0J A;  1OMI A;  3FHQ A;  3TEY A;  1WCQ A;  5HCA A;  1LNS A;  3NV2 A;  4XFA A;  1T2X A;  3MW3 A;  1W0N A;  4QQL A;  3VHO A;  1YO8 A;  4RSU A;  4L92 A;  2ES3 A;  4K21 A;  1US3 A;  1AR8 1;  2GME A;  3WAS A;  2JDN A;  3T2P A;  2W1U A;  4YW3 A;  3EB7 A;  4JQT A;  3AZX A;  1DU3 D;  2WBK A;  2WZR 1;  2GH2 A;  4A7Z A;  2TUN A;  2D6M A;  3JB4 C;  2D6P A;  3Q8E A;  3WQB A;  3NJV A;  3PME A;  4HMZ A;  2Q8E A;  5AVA A;  3BTZ A;  4NWW A;  1RUE 1;  1TVG A;  2O8Q A;  4Y22 B;  3O1T A;  1NLS A;  3AZW A;  2HEV F;  2YY1 A;  3C7E A;  3WCR A;  4LA3 A;  5EWS A;  1G86 A;  4RR3 C;  4S2F A;  1G8W A;  3BU0 A;  2DUR A;  1W6M A;  4Q4Y 2;  2LS6 A;  3BIW E;  3VBO A;  3WG3 A;  4BCU A;  5F5A A;  5EHD A;  2GP5 A;  4QGM A;  3VZO A;  1NCR B;  3VD4 A;  3GJB A;  2W1Q A;  4FPJ A;  1QQP 3;  5H9S A;  1OFS A;  3WHU A;  5JPN B;  2VAU A;  1DHK B;  4WVM B;  1EPW A;  1LUL A;  5I0T A;  1PZ8 A;  2DFB A;  5FZI A;  3PU8 A;  5C6C A;  5FYM A;  4AGV A;  3KSC A;  3LEK A;  2BBV A;  2BP6 A;  3B9I A;  3BB6 A;  3K48 A;  1Q3E A;  1ZZB A;  1OFN A;  3APB A;  1AL0 G;  1FOD 2;  1QJY 1;  2IC1 A;  3KV9 A;  3KLS A;  4UXA A;  1D7P M;  4XUT A;  1OLR A;  1M06 G;  3WN0 A;  4GAL A;  3PUI A;  4HK8 A;  4K8F A;  3VBR A;  1UWW A;  4Q0P A;  3WUD A;  3WG2 A;  3C7F A;  5F37 A;  5KHI A;  3LSE A;  5LA2 A;  1HB2 A;  2IXC A;  4FAG A;  2BU9 A;  1PK6 B;  2QUO A;  2BW8 A;  4UBG A;  2DFC A;  2NN8 A;  2UWB A;  4ITC A;  3MLJ A;  4LBL A;  4KWU A;  4KWJ A;  1H1M A;  3CBN A;  5KC5 A;  1VBB 2;  4EWD A;  4YPJ A;  3GYD A;  4IEZ A;  4YNI A;  4UYB A;  4LUL A;  1JN2 P;  2PAK A;  4BA6 A;  5J09 A;  4KC8 A;  1VP6 A;  3T2T A;  2V4V A;  3SCH A;  3MFC A;  4GUL A;  4AEM A;  1NG0 A;  4COY A;  3L2Y A;  4A4A A;  3CEW A;  4CCD A;  3RI9 A;  2QFE A;  3U37 A;  2ZGQ A;  5FAX A;  3HQU A;  1HRI 2;  4Q4W 2;  5FZ1 A;  2QCS B;  4GH4 A;  1SQ4 A;  2XKO A;  3MGU A;  5GZD A;  5GLO A;  5C71 A;  1AXY A;  1NAE A;  4UFJ A;  5LY1 A;  4KCA A;  2HEW F;  2WLP A;  4PT6 A;  4BK5 A;  4HSJ A;  3S30 A;  2E53 A;  4OQ8 A;  3OBR A;  3H8X A;  5FP4 A;  4E8C A;  3UES A;  1FV2 A;  3BYK A;  3NNJ A;  4QKB A;  2BZD A;  2NZ9 A;  4A6S A;  4AHX A;  4R4X A;  5C5U A;  4RFR B;  1BBT 2;  1O4T A;  2C24 A;  3HVD A;  3S6P A;  3PUR A;  1S4C A;  2VTF A;  2PTM A;  2WNE A;  4KMQ A;  2FDG A;  2IXI A;  2XHN A;  3BPZ A;  4IV3 A;  4MUV A;  1GQG A;  1ZRC A;  4AG4 A;  1RVF 1;  2X5I C;  4Q1R A;  1SG3 A;  1ZX5 A;  2DWR A;  3VT1 A;  2RR1 1;  1KXG A;  2ZX4 A;  1UZ0 A;  1ULF A;  5GLV A;  1AL2 3;  3NNF A;  4Q0Q A;  4RFT 0;  2H6C A;  1NUK A;  2J22 A;  1BQP A;  2XWB B;  3OGJ A;  5IVJ A;  5FZA A;  4FPO B;  1QJU 3;  4HL0 A;  3RJR A;  5HXM A;  3NQH A;  1H8T A;  2NPI A;  4A42 A;  3AP7 A;  2DTY A;  1TMF 1;  4EQV A;  1F5J A;  5JI7 A;  1VRH 3;  1LES A;  1YFU A;  4M3C F;  3CKH A;  5C70 A;  5FR3 A;  3I59 A;  2A6W A;  3Q9O A;  1NKG A;  1GWL A;  5I8S A;  2XBO 3;  4K3U A;  3J7H A;  3BOD A;  4HN0 A;  2A3Y A;  4RD7 A;  4ATE A;  2YC4 A;  2EID A;  5DUV A;  5JVV A;  4BJ0 A;  5ERL A;  2VCA A;  2HBT A;  1ULO A;  2PLV 2;  2WNV C;  3MO4 A;  2BYV E;  2CTV A;  1FPN 3;  3B5L B;  1ASJ 3;  2JDK A;  1DIW A;  2QQU A;  4XBL A;  2BFU S;  3CO2 A;  4PLO A;  4GXL A;  4AW7 A;  5A7V B;  2VNG A;  1YEW A;  3IKW A;  5L9R A;  3J7M A;  4PDW B;  5FY1 A;  4I30 A;  1WCK A;  4GKX A;  1V9U 1;  2VXR A;  1ENS A;  2VQT A;  4FAH A;  4JV4 A;  3WAU A;  4Q0V A;  2FDI A; 
#chains in the Genus database with same CATH homology
 3OM7 A;  3LIG A;  1OYG A;  4N4B A;  4UFI A;  5FIX A;  5GLQ A;  4KC7 A;  3R67 A;  3PIG A;  2YFR A;  4ONZ A;  3U75 A;  3C7G A;  5GLR A;  3R4Z A;  3AKH A;  2AEY A;  3WN0 A;  3VSR A;  4KMI A;  5FKB A;  3KST A;  3C7H A;  3KF5 A;  4O8N A;  3ZXJ A;  5A8D A;  3VSS A;  3LEM A;  3C7F A;  3C2U A;  3D61 A;  1YIF A;  3AKI A;  3WPY A;  4FFH A;  4U6D A;  5GLK A;  4O8P A;  3LDK A;  3D5Y A;  2XQR A;  5A8C A;  5AYD A;  1Y9M A;  4UDI A;  3D60 A;  4B1L A;  3KF3 A;  5JOW A;  3U1X A;  3QEE A;  3WN2 A;  5B6S A;  4U6B A;  4UDJ A;  1YRZ A;  5FMC A;  1UV4 A;  1UYP A;  4CCE A;  5FKC A;  4AZZ A;  1GYD B;  4UFK A;  5FK7 A;  4CCD A;  3RWK X;  3AKG A;  3QC2 A;  3QED A;  3WAT A;  4AK5 A;  3OSD A;  3IMM A;  5FMB A;  4O8O A;  3WPU A;  4N2Z A;  3OM4 A;  2YFT A;  5FLW A;  4COT A;  1PT2 A;  3QEF A;  5FMD A;  1Y7B A;  4QQS A;  5GLO A;  2EXI A;  2X8F A;  1Y9G A;  4UFJ A;  4KCA A;  4PVA A;  3ZXK A;  3WN1 A;  3LIH A;  4AK7 A;  2EXJ A;  4UDK A;  3OM2 A;  4UFH A;  1GYE B;  5AYE A;  2X8T A;  3C7O A;  3LFI A;  3BYK A;  3PIJ A;  3BYN A;  3WMY A;  3NMB A;  3H3L A;  3SC7 X;  3VT2 A;  3K1U A;  3S5Q A;  4D47 A;  2EXK A;  3UGH A;  3P2N A;  4N1I A;  4FFG A;  3WPV A;  2ADE A;  3TAW A;  5GLP A;  3LDR A;  2EXH A;  2VDT A;  3LF7 A;  3QZ4 A;  3VT1 A;  3WPZ A;  3VT0 A;  4NOV A;  2B4W A;  4UFM A;  5A7V A;  1WL7 A;  5FK8 A;  4N2R A;  3D5Z A;  3HBK A;  2YFS A;  3OM5 A;  4MLG A;  3NQH A;  3LV4 A;  4PVI A;  1VKD A;  4KCB A;  1W2T A;  5AY9 A;  4EQV A;  2AC1 A;  3UGG A;  3WAS A;  1ST8 A;  1YI7 A;  4UDK E;  4KC8 A;  5JOY A;  2QQW A;  1Y4W A;  2X8S A;  3ZXL A;  3AKF A;  4JQT A;  4B1M A;  3VSZ A;  2QQV A;  2OXB A;  5C0P A;  1GYH A;  5GLM A;  3WMZ A;  3ZR6 A;  4CCC A;  3ZR5 A;  5AYC A;  3R4Y A;  4UFL A;  1W18 A;  2AEZ A;  3C7E A;  2QQU A;  3VSF A;  3OM6 A;  4QHZ A;  5GLN A;  4AK6 A;  3BYJ A;  5A7V B;  3BYL A;  4UDG A;  5JOX A;  5GLL A;  4FFF A;  5B6T A;  3UGF A;  4FFI A;  4HXC A;  3CU9 A;  3WAU A;  5JOZ A;  3U14 A;  2ADD A;  5ANN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...