2ADDA

Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with sucrose
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
537
structure length
537
Chain Sequence
QIEQPYRTGYHFQPPSNWMNDPNGPMLYQGVYHFFYQYNPYAATFGDVIIWGHAVSYDLVNWIHLDPAIYPTQEADSKSCWSGSATILPGNIPAMLYTGSDSKSRQVQDLAWPKNLSDPFLREWVKHPKNPLITPPEGVKDDCFRDPSTAWLGPDGVWRIVVGGDRDNNGMAFLYQSTDFVNWKRYDQPLSSADATGTWECPDFYPVPLNSTNGLDTSVYGGSVRHVMKAGFEGHDWYTIGTYSPDRENFLPQNGLSLTGSTLDLRYDYGQFYASKSFFDDAKNRRVLWAWVPETDSQADDIEKGWAGLQSFPRALWIDRNGKQLIQWPVEEIEELRQNQVNLQNKNLKPGSVLEIHGIAASQADVTISFKLEGLKEAEVLDTTLVDPQALCNERGASSRGALGPFGLLAMASKDLKEQSAIFFRVFQNQLGRYSVLMCSDLSRSTVRSNIDTTSYGAFVDIDPRSEEISLRNLIDHSIIESFGAGGKTCITSRIYPKFVNNEEAHLFVFNNGTQNVKISEMSAWSMKNAKFVVDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the fine architecture of the active site of chicory fructan 1-exohydrolase: 1-kestose as substrate vs sucrose as inhibitor.
pubmed doi rcsb
source organism Cichorium intybus
molecule tags Hydrolase
molecule keywords fructan 1-exohydrolase IIa
total genus 147
structure length 537
sequence length 537
ec nomenclature ec 3.2.1.153: Fructan beta-(2,1)-fructosidase.
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 2addA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2addA01
4UFJA 2X8TA 3KSTA 1YI7A 3AKIA 4UDKA 2X8SA 5C0PA 5ANNA 5GLNA 5GLQA 3VT1A 4UFHA 4B1MA 4O8NA 3WMZA 3NQHA 3OM4A 3PIGA 1YIFA 1Y9MA 2AEZA 4QHZA 3BYKA 4KC7A 2YFTA 1UYPA 2QQWA 3CU9A 5FKBA 3QEDA 1Y9GA 4UFIA 1GYHA 3SC7X 3AKGA 3LDKA 2X8FA 4UFKA 3OM6A 3KF3A 3PIJA 3QEEA 4UDIA 3OM7A 4B1LA 3QC2A 4PVIA 4QQSA 4U6DA 3LIHA 3U1XA 1PT2A 3BYNA 4N1IA 2EXIA 3C2UA 5GLRA 5A7VB 3QEFA 3IMMA 4D47A 5AY9A 2EXHA 3AKHA 4MLGA 4AZZA 3WN2A 4UDGA 3OSDA 4UDJA 3C7OA 3D5YA 3LDRA 3VT2A 3BYJA 3LF7A 5JOXA 2QQVA 1YRZA 3UGFA 5AYDA 5A8CA 4N4BA 2XQRA 2B4WA 4O8PA 4JQTA 5FKCA 3VT0A 4N2ZA 2VDTA 4HXCA 3UGHA 5JOWA 3D61A 5FIXA 3ZR6A 3HBKA 3K1UA 2EXKA 3WPZA 3WATA 3WN0A 4AK5A 5GLOA 2QQUA 3LFIA 3WPUA 2OXBA 2ADDA 2ADEA 3ZXKA 1WL7A 3WN1A 4O8OA 3P2NA 4AK7A 5JOYA 3C7EA 3LEMA 3C7FA 5FLWA 4UDKE 2YFRA 4COTA 4KC8A 3C7HA 5GLMA 3OM2A 3D60A 3R67A 4NOVA 3UGGA 3U14A 5FK8A 3LIGA 4FFFA 4UFMA 5FMDA 2EXJA 3ZXJA 4CCEA 3TAWA 5B6SA 1Y7BA 4ONZA 3R4ZA 4KCBA 2AEYA 3RWKX 3WPYA 5GLLA 3WMYA 3H3LA 4N2RA 4CCCA 3OM5A 3VSSA 5FMBA 4EQVA 1W18A 2YFSA 3WASA 5B6TA 5AYEA 4FFIA 4AK6A 1UV4A 3VSZA 3VSRA 4FFGA 1ST8A 5A7VA 4PVAA 5A8DA 3QZ4A 3S5QA 3KF5A 4U6BA 1W2TA 3ZR5A 3WAUA 3NMBA 3R4YA 2AC1A 1VKDA 3U75A 1GYEB 3VSFA 5AYCA 5GLKA 4FFHA 3AKFA 3C7GA 4KCAA 5GLPA 3WPVA 4KMIA 3BYLA 5JOZA 1GYDB 3LV4A 3D5ZA 1OYGA 3ZXLA 4UFLA 5FMCA 5FK7A 1Y4WA 4CCDA
chains in the Genus database with same CATH superfamily
2X8TA 3KSTA 3AK0A 5KBFA 4KU7A 3M3QA 1GOHA 5FUPA 1O3RA 2V72A 2GC0A 3LA2A 1PGL1 1F4HA 4QX8A 1IKPA 4TLFA 5JCTA 4KI5M 1W99A 5EPAA 4S2HA 2JWPA 4Y26A 2A70A 5AC92 3PMSA 3E5QA 1XSQA 4CEYC 1QH6A 2I07B 2PTMA 2Y26A 2VUJA 5CAZA 2RS31 1G9CA 1XB9A 3K46A 3NAPA 3P6BA 1NA1A 1UY3A 3POBA 5GZDA 2UYAA 5T5LA 2PN5A 1C3HA 1FXZA 3L2YA 5JR2A 4RR3B 1MQTB 4BJ0A 1W8TA 3QEFA 2WZR1 3VD9A 1ZBA2 3WN2A 1BCXA 1HB3A 5HV0A 2Q8DA 1KGYA 4AE2A 4R4XA 5JXGA 2OW4A 3T0AA 5IW0A 1F4AA 3VT2A 3VDAA 2RJLA 3FBMA 3OOXA 1R091 4KL1A 3BYJA 1ULEA 3AB0A 3M1HA 1RUC2 4KU8A 1UW8A 3N7KA 4IUGA 1VLNA 4RS5C 3AXEA 1OF4A 1U5XA 1BK0A 1VB4A 4Q0UA 3RDIA 2X29A 5FIXA 1QJZA 1H6XA 2R041 1RJ7A 3H1MA 1IZ3A 3RFRA 1FV2A 1QJFA 1GQPA 2JKBA 2R1BA 4D7SA 5M0TA 1HRV1 1RHI3 4NHLA 3HNMA 1UZWA 1UO9A 4UF0A 4XYXA 5F39A 5IVCA 1ASJ1 2E53A 4BA6A 4IEQA 2RJ2A 1GNHA 1YFWA 1OMIA 1AYM3 2BP6A 1YQ5A 2HEYF 3A4UA 3JB8A 3MW4A 4NE9A 2DCYA 5IWFA 2Q1MA 4UDKE 2D7FA 3NKGA 1HXS1 1F35A 1LU1A 3PUSA 4A7YA 1QWRA 3HEIA 1PGL2 2BFUL 3O1TA 2G19A 1JYIA 4QKDA 1N1SA 1VAVA 3OBZA 2WNUB 3D5OA 1WLWA 3IT8A 5FUNA 3VHPA 1VR3A 3IZOA 1W04A 1UY4A 4DY3A 4A41A 1DU3D 3QLQA 4KCBA 4KWJA 4LR4A 1RUG3 4KGQA 4D3WA 5GZGA 1YO8A 5F8PA 2GMMA 3ZYBA 5LEKA 1RUJ1 5F3EA 4GMP0 3BOWA 3KM5A 3UETA 1G6NA 1ACCA 4Q1PA 4A42A 5JI9A 4Q4X2 4NIDA 3JU9A 1WMDA 5FYVA 3OG2A 1C8M1 3WXPA 4E8CA 5C9AC 4HVRA 3UYJA 2JG9A 5F3GA 3AMNA 4U36A 5FZ0A 4O9GA 3WQ7A 1OQEA 2JDNA 3PLQA 5FPAA 3DPRC 1LHNA 4ISQA 1MZEA 2WAAA 2VZUA 3W9AA 3AKFA 1CAVB 1IS4A 1NCQC 3VBRB 4AG4A 5FWJA 1QJU1 1J84A 4NAMA 3OBRA 3EHKA 4O7XA 4XVHA 1Q3EA 1O4ZA 5A3NA 2BVVA 2OZ6A 4AVBA 1XYNA 5C5UA 5J3UA 1OYGA 1RUH2 3ZXLA 1FATA 4UFLA 4L0PA 4PBOA 4A4AA 2GC3A 4FI9A 1AX0A 2JIJA 4B8EA 3ATGA 2B8MA 1YC61 1ZA7A 3ACLA 4YNIA 5LY2A 1PO22 2QZ2A 1K3IA 2WQZC 1QMJA 4AR2A 4QGLA 2VU9A 3NSTA 3POFA 2IXLA 3MF6A 1QEXA 4BCUA 1GOGA 3RGBA 1GICA 2FHRA 4BU2A 4AEDB 1AXKA 4XHXA 3LEKA 4YG6A 2YXSA 1ND3C 2BGCA 2Q1ZB 1HXS2 4Y20B 3ZSMA 2A5ZA 2ZKNA 3FE5A 4LBQD 3MIEA 5C70A 1EP0A 2FCUA 3OY8B 5DAWA 4A6OA 2V09A 1BMV2 4UDIA 3OM7A 3CZUA 2Y6JA 4RHV2 1KXGA 1FMD3 2VW1A 1HW5A 4XURA 5DZEA 5F9TA 2D43A 1AXYA 4O9EA 4K7JA 2YB7A 3CQOA 3B3QE 4E8DA 5E88A 2PLV2 4LBJA 1PMIA 2GMEA 3T1LA 3VHRA 4YW3A 3D5YA 1U0AA 1UY0A 1OPMA 4FPFA 4RFT0 4CE8A 2GC1A 4HANA 4OFGA 5CNAA 3FHAA 5C33A 3ZYIB 3WF3A 4GH4A 3W58A 5IAXA 5AC93 4D6QA 3ETQA 4MUVA 4ES8A 2ZBJA 1EAH3 3TRSB 1IGOA 3WQ0A 5E8AA 3LCPA 4Q4W3 2ZGQA 3HN1A 5FP4A 3LKJA 3PJYA 1XOYA 1X7NA 2VQTA 4YPJA 2ZZJA 4LOTA 3F95A 3UK9A 4RGAA 5KHHA 3SH4A 5FYHA 1SLCA 4AK7A 1HXS3 1NCQA 1SLIA 1QQP3 3AL5A 2BPA2 1C8M3 3AKQA 4QB2A 2IXCA 2F4PA 5DG1A 2QQPA 4A45A 1WW7A 1V9U2 3J8F3 5A3OA 2Y60A 3C7HA 4AFCA 4Q4V2 2VJXA 3VZLA 3PUHA 2JDHA 5CKQA 1KD7A 2RE9A 4NHMA 1S0CA 5JXHA 2FBEA 4A3ZA 3VHNA 2HBUA 2WQ8A 1CAXB 1BBT3 3R4ZA 3TWIA 3WF1A 5C9AA 2WNVB 3CF6E 5A7NA 1AL0G 2P37A 5F5AA 3DEMA 5JAXA 1Q8SA 5FMBA 3RSJA 5AYEA 2VVEA 1H1MA 3VSRA 1WMEA 3FFQA 5IFTA 1UZ0A 2ZZQA 3HVDA 4WVMA 3WINE 2QE3A 1OH3A 4QQLA 3W21A 3LD8A 2FCTA 3KV6A 4D69A 4LKFA 5T5JA 1W0OA 4A7ZA 4DXTA 3OTFA 4INDA 4GWMA 1HJFA 4D7TA 4DFSA 5L7OB 1UKGA 2BZDA 3WPVA 4BYYA 2VMEA 4YGBA 3CDZB 2Q8OA 2BWAA 4QPGC 1RUOA 2WYSA 3V0AB 4Y22B 1W39A 3IWZA 4TTGA 1G9BA 1X36A 1WMXA 3K4DA 1RUE1 2P6HA 1UX6A 5JSPA 2E7TA 1XBFA 1JU4A 4DUVA 2ZMNA 5EV7A 3FJSA 4R8HA 5C71A 3AKIA 2P3YA 2R062 2JDAA 1V6MA 5LRSA 1FYUA 4QQ2A 2G9GA 4FOVA 1RIRA 4XACA 4TXWA 2GNMA 1JHNA 4HK9A 4P9WA 2OKXA 2XQXA 3WSOA 1JYCA 3BKZA 2RV9A 2A6XA 1R081 4LO6B 2BU9A 1KQRA 3IDBB 3QD6A 2EVXA 2W46A 4WBBA 4K20A 4LBNA 4TYSA 1V9U1 5DUXA 1QJX3 2OQ6A 4LT5A 5F2SA 3POJA 4E4DX 1DQ1A 2WL1A 4FO9A 3SH5A 1CZTA 3PU8A 4D7YA 1NCRC 3PUQA 1MEC3 1N1YA 1PT2A 2XWBB 3S7EA 3AL6A 5BV6A 1N47A 1SLAA 2RR13 4FP2A 1YJLA 2WZR3 4Y1VA 3A21A 5B2GB 5D8AC 5C3SA 4YZ2A 2QQLA 1W8UA 3C7OA 3VBSA 1LB2A 3FLTA 4QM8A 3UGFA 1XNCA 5IATA 2ENRA 4X6QB 2XPJA 2DTWA 4XJZA 3K75B 2P3JA 1T6GC 4Q4Y2 3O0VA 5J1XA 2CY6A 5HCHA 2GH8A 4QDSA 2QZ3A 4UXAA 4YVSB 3D61A 2GNBA 4I09A 1O3SA 1OF3A 3CHXA 1RUG2 2JG8B 5JZGA 1D2SA 1PGW2 3RNSA 1WD4A 1RC6A 4NRMA 5FPUA 4BXFA 3M8LA 1V6NA 4C90A 2IXJA 2QQNA 3USSA 2WNOA 2VZTA 5FLWA 3BVCA 1XNTA 3D0JA 1VBA1 4AAPA 2VTFA 1IKQA 3BOPA 4AEJA 5FZMA 1ZRCA 1QDCA 2HWF1 2IXHA 3HQUA 1DZTA 2RDQA 3POYA 2XDVA 5T52A 2D6PA 1ZNPA 5FBJA 3VBUA 3H3UA 5A3WA 3WNLA 1KDMA 1US3A 4I02A 3FHQA 4N7UA 1X9TA 4DUWA 4Y20A 4CCEA 1JYWA 1JUHA 3WW4A 5LCWL 2D98A 1SBFA 2V4AA 4GH4B 3LFMA 4ONZA 3FN9A 1NA1C 1KRIA 3K3OA 5F32A 3OGGA 2HWC1 5IAVA 4BQWA 2VVFA 1CVNA 1JH5A 2VQUA 3OJBA 4P02B 3BYWA 5FJKA 3P3PA 1FNYA 1W18A 4WM8B 1BKZA 1WA6X 2A7AA 5HCFA 2CSGA 2EIBA 1VBE2 4AAXA 4DB5A 3I3DA 1BXHA 1R083 2XJSA 1TME1 3LGRA 4NVPA 3OEBA 2H0VA 5EHDA 1WMFA 1BQPA 2A3YA 3OY8A 5JI7A 1D2QA 3HT2A 3K51A 5LK7B 4OHWA 2DDUA 4RS5A 1WD3A 5CB7A 1ZRFA 2DURA 4FFHA 2ERFA 3AP5A 4YVWB 1QJU3 3VL9A 2ZHKA 3VZKA 1FX5A 2R32A 5CISA 2ZACA 4QMAA 4GA9A 4HKWA 5CKMA 5H9SA 1VE0A 4RHV3 2XG3A 5H9PA 2ZEYA 2ZGRA 3DKQA 5FAXA 1W2AX 5KHGA 3O12A 1G7YA 2VZSA 2XBO3 2ZOEB 3BTAA 1DGRN 3HMYA 4QD2A 4CUCA 1JZ3A 2QQIA 1UWWA 5BNOC 4Q4Y3 2P3KA 3WP4A 4FTEA 3EO6A 4D8MA 3H7JA 3IM0A 5GJ6A 4BQXA 4GD4A 1Y9QA 5KHIA 4N9IA 4IV3B 4XTPA 3ZN4A 2XVKA 2AEZA 1FPN2 2Z69A 4I01A 1PNGA 4CVUA 1VBA2 5IFPA 4N53A 2QQWA 4K1ZA 1I3HA 2HWF2 3JD73 4W6YA 1DGRA 2LALA 4CXYA 2ET1A 1VRH1 4XTMA 4CEWA 1SPPA 4UFKA 3KQRA 4N90A 2P4EA 3AYAA 3UESA 1PO13 2XLFA 3HPNA 3ZFFA 1ODMA 1Q8QA 2PHDA 2WYFA 2JG9C 4CCLA 4D0QA 5C3RA 1CJPA 3DPRA 3TOJA 2W3JA 4XOGA 5L9VA 3VV1A 1IPJA 2W1WA 1SCRA 4L9BA 5IJRA 3K48A 5LA9A 2UWAA 1VBC2 1CX4A 2OVUA 3IAPA 5LA1A 5ACA2 3UV9A 4CDUB 4N4BA 4YM3A 1W8WA 4COWA 1MVEA 4RN5A 2BBVA 4AEKA 3SNMA 2BFUS 2I2SA 1PIV2 4RSUA 3ZYHA 1LGNA 4XEZA 3GXUA 5IK4A 3MZHA 1KS5A 2ORXA 1LHUA 4IEVA 3WOGA 2K0GA 3I2HA 3VD4A 2Q1FA 3E6BA 4XMAA 2QQUA 4GB32 4BM8A 2JD9A 4JRLA 4AQSA 5CFDA 2ADEA 5BUVA 1SEFA 5FYBA 2GAUA 3EXUA 3MI8A 5IYYA 3WY6A 2XJTA 3VL8A 2D3RA 5FY5A 2A6WA 1RVF2 4MLOA 4WZFA 2QDNA 4QX3A 4ZPIA 1AR62 1O4TA 5FYMA 4JTNA 2J1UA 4XE9A 1IG0A 1U5IA 2Y33A 4OI2A 4Q8LA 5FYIA 3NNFA 3O1PA 5GLMA 1AZDA 1OFSA 1NA1B 3LAGA 1TEIA 4GZ9A 3GNEA 4U2AA 3V0AA 4XFFA 2H6CA 1XXNA 1OOPA 4P14A 3E6DA 1TG7A 1DYOA 5FPVA 5A80A 2PXJA 3FHIB 2Y6KA 3AKRA 4NUBA 2FDHA 4GXLA 2NPIA 2LROA 3ZXEA 3THTA 2ZCWA 3AZZA 1RMU2 3MEPA 4IQPA 1HRV3 1RHI1 1VRH2 4ZU7A 1HB4A 2B9VA 2HWD1 2R6QA 3THCA 4NIHA 5FZIA 3T2OA 3LE0A 3KV4A 3UL2A 1NUKA 1NE4A 4IETA 1URXA 4C8DA 2VZQA 3APBA 4XHBA 3ZIWA 4XF3A 5CU1A 4AEDC 2QCSB 1GZWA 1AHSA 2RM23 2ZAHA 4IDZA 1JYNA 2JD4A 3L9JT 1LNSA 1PO12 4OHVA 4U6BA 2F6BA 1HX6A 3X29B 4W50A 2WT0A 4CEWB 1GYEB 3ACIA 3AZVA 3AZXA 4AI0A 5AYCA 2WNVA 1FI2A 1Z7S2 2WINB 1YHFA 1O3QA 4K6BA 3ASIA 3AC0A 1AR81 4NIIA 1J3RA 2XONA 5EYYA 5IK7A 1GYDB 2WNUA 5T3NA 1LOFA 4Q4V3 4YZ5A 4M3CF 1VJ2A 1X82A 4L11A 4CP2A 2QFEA 4IV3A 2BTVC 2MNGA 4H7MA 1VMJA 3CLPA 4X6RB 3VN4A 4LO8A 3SKJE 4CDXC 4P9XA 5JUVA 4EROA 1VIWB 2JX9A 2YDEA 3VT0A 5LWBA 5HXVA 1PK6A 5GLVA 4KG0A 1JYXA 3WMZA 1VBD1 1W28A 1YUDA 4M3CE 5BNOB 4UF0B 1UYXA 1CPNA 1VRH3 2B39A 1W6OB 4MADA 1DLCA 3IMNA 3ME2A 4DO0A 3MYXA 4LE3A 4FBFA 5IHRA 4OHYA 4UFIA 5B4NA 3USUA 4LBMA 2V5DA 4LHNA 3LDKA 4M4RA 1VP6A 1WWYA 3KT7A 4Y1UA 1X8MA 3URFA 3MIFA 3VBOA 1VAKA 5JLVA 4P5HA 5BY5A 4V2WA 2R16A 4OHZA 1E5RA 5GLRA 2IFRA 5A7OA 1VBB1 1PNFA 1WCQA 3AM2A 4FP3A 1N3OA 1MZFA 2A3XA 1FNZA 4UYBA 1H9PA 3J7MA 1E5IA 1LOCA 4GALA 3VB9A 1H8VA 2N7GA 3CJIC 1RUF1 5BNPA 4P9IA 4PT6A 3RI9A 4Z2AA 4FCAA 5FQ0A 1QF3A 2Q8CA 1IQAA 4O8PA 1CESA 4N8MA 4PDWB 5CG9A 2GN7A 1YNAA 3OYWB 5C8WA 1CAWA 1K5MC 1UOBA 1YFYA 2VDTA 5C4WB 3ZYGA 1COV2 1VBA3 1SDDB 2I45A 2OUJA 4QKFA 5DQ0A 2R043 5JXIA 5H9QA 4R9AA 4LOSA 3ZR6A 4AK3A 3QH6A 3TBDA 3AX4A 2AUYA 3N35A 5FPZA 4EN0A 1N1VA 4R9CA 4SLIA 5KXBA 3TN92 1LESA 1R093 4LK7A 3BIWE 3PUIA 3RI8A 1QHDA 3G7DA 3K77A 3CO2A 1B35C 4IV1A 4Q27A 3WDXA 2X5IA 5A1FA 2P3IA 1UZZA 3U4XA 2R063 1H1AA 1QQP1 1DYPA 1K45A 4I0AA 3VUOA 2VD7A 1ZZ9A 3LIGA 5E89A 2EXJA 3TAYA 3ZXJA 4F83A 1DGLA 2W0XA 1L7LA 1EAH1 2VZRA 1YQ6A 2BDRA 2VNRA 2VTXA 2GNDA 2XR4A 1OC1A 3JQXA 2CNAA 3ZMOA 5LK5A 2B5HA 2WAOA 4Q4W1 1J58A 3ZXFA 1JODA 1CPMA 1RUJ3 1UF2C 3MW2A 4FSJA 5GLZA 1CR7A 5FRAA 2VL4A 5FXVA 1QKQA 4JGZA 2ZHNA 1FT9A 1NOVA 1Q43A 5DAPA 3WDTA 2XGXA 5DDJ2 4W4ZA 1LOBA 2ZGTA 5KC5A 2RR12 4FPHA 2A73B 5FY0A 2HYXA 2B42B 3KMHA 2ETEA 2VC9A 3O0WA 5FPBA 4AHWA 2JDMA 3J8F1 2DFCA 4BIOA 3NV2A 2JB4A 5GM0A 4J25A 3W5NA 2J1EA 2LS6A 1SPPB 2JENA 1V6IA 3ITQA 3ZSKA 4WM7B 3DXUA 3RZZA 2ZGNA 5FZBA 3ZYJB 1OHFA 4YM2A 4ZXKA 1GZTA 3CNAA 5FO7B 1H2LA 1YFXA 1WLDA 2DTYA 2RS12 2XHKA 3P3NA 4R4ZA 4Y33A 2XXZA 4CP1A 4YVWC 5K8SA 1HKDA 3ROUA 4OMCA 3LDBA 4FVVA 4JZRA 1C57A 4BQ1A 4DQAA 4IGPA 1AUYA 3LPGA 1DBNA 1AR91 1JN2P 5A7QA 3MLJA 1R1A2 2Y6HA 5JDBA 1SDWA 2VW2A 2WN3A 1YIFA 4OUEA 1QDOA 4KBZA 5C3OA 2B46X 3ZOIA 4P5YA 1IG3A 4XFHA 1JW6A 1ENQA 1VB2A 4UW3A 1WZXA 5I91A 5JWPA 4QGNA 2JKXA 1MS9A 4KMQA 1VBE3 1QXPA 4D94A 4AOCA 4M0NA 3RMXA 4QQSA 2LTNA 2W5FA 5DMYA 1W9YA 3B94A 4R9DA 5FMOS 1DQ0A 3ZYPA 3BYNA 1DQ4A 1EAH2 2D5HA 2WRAA 4CU6A 2EXHA 1LR5A 2ARCA 3V56A 2WZ8A 4P9JA 1H4HA 1K5MA 1QY4A 4HK8A 3RYPA 1RMU3 1EY2A 2VCAA 2PHWA 4HOOA 4JKKA 3ZFFC 3T2QA 4BE3A 1H8TB 4JX0A 4URTA 2WFF1 2VZOA 1XU1A 1ZM1A 4JHTA 5BNNA 4CDWC 4CCOA 1A6CA 2YZ4A 3E5XA 2VZPA 3VDCA 4K1YA 5BXXA 5DUUA 4N2ZA 1XPWA 4H3WA 5AFEA 4RD7A 5BPXA 3SCGA 4OUMA 1UY2A 2WABA 3NNJA 5FBZA 4CDUC 4XF4A 3F2ZA 3VBUC 1ZBA1 2VUDA 5FZ7A 1UY1A 1UMHA 1NXD1 2WIIB 1JZ7A 4Y1ZA 2JEMA 4PQQA 1NKGA 4ZXEA 1OLMA 3POIA 2RS11 3ILFA 3OGRA 2PHFA 3NO8A 4HBNA 4YM1A 5JVVA 3TYJA 4XJ8A 3NL1A 3VBFB 1KJLA 2ILMA 3S6PA 5K9YA 3ELNA 4EN6B 1ZX5A 3VDDB 2JE9A 3PTYA 3OM2A 3GBFA 4DY5A 3BALA 3OD4A 1AR92 2E31A 3GGLA 4UFMA 5FMDA 4CRQA 3ZYFA 3TAWA 1TMF1 3PVOA 5A1AA 4IE5A 2DCKA 4W65A 4XCBA 1W8FA 2WNEA 2ZGLA 3E97A 3KCXA 4PLOA 4AFBA 4E9KA 2VMGA 3RWKX 4LHKA 5A1LA 5FP7A 4H2AA 3THDA 5LA0A 2NMOA 4HFSA 3WEZA 5ANQA 4CCCA 1SLBA 4I0WB 3VBSB 3GF6A 4QXHA 4BQ2A 4XIOA 1X9PA 3H9AA 3N7JA 2AYHA 1ASJ3 2GDFA 4MOAA 2UURA 4AK6A 1GMMA 4AVTA 3H0OA 1IQDC 3VSZA 2WWSA 4YWAA 2X10A 4AXOA 3T1MA 2QQKA 4I3GA 1LHOA 1AX1A 1SLTA 2A75A 4IGOA 1TZOA 2VGDA 1GFF2 5FZGA 1OSGA 4BQ3A 3LEIA 5CIRA 3WX5A 1PVC3 2RMU1 2G9ZA 4NO4A 4L8QA 2GP5A 3GJAA 2C9AA 3VZJA 5I8YA 5GLKA 4LBQA 1GZ9A 2JICA 4ZY9A 5A7SA 3VBHB 2PHXA 3WP5A 4AEDA 4FPGA 4CDWA 2TEPA 2BVBA 5ABJB 2YU2A 3ZSJA 4M3CA 5A3PA 4DINB 1Q8PA 5C8CC 3VLBB 2ZXQA 2HJIA 1GBGA 4DEVA 1C8M2 3B5LB 3OYWA 3PHMA 4XUTA 5F6KA 3WNPA 4YZ1A 5LB6A 3UJOA 4CU8A 3I97A 3IB3A 1BEV2 3SITA 2YC0A 5C0PA 2C5DA 3E1F1 5FZOA 3B9CA 3T4HB 1W8HA 3UNPA 2VM9A 3POEA 1GR3A 4IESA 2RM22 5DG2A 3RZHA 1LEMA 1YJKA 2ZABA 4QHZA 3VKOA 3WW3A 5FV3A 1CZVA 2Y6LA 3ILNA 3KVAA 2ARXA 2TBVA 1VRBA 3FWEA 3GBGA 4RR3C 4YLZA 1FAYA 1HN0A 4OMDA 2JG8A 1POV0 3KD4A 2YBSA 5SV8A 5ACA3 5LEJA 1TNFA 4LE4A 1M4WA 3JB4C 1GP6A 3ON7A 3H8OA 3ZSLA 5LASA 3OGSA 2WO1A 4QPIA 2AACA 1NCRA 3LIHA 4XETA 4Q0QA 4XXAA 5CZKA 1ENRA 1H8TC 3I59B 3BTZA 2WFF3 3AKHA 5AY9A 2VTXJ 3M70A 1UAIA 2W91A 3H3ZA 5F6LB 4HVQA 3V0BA 1QXRA 4AQTA 3H1WA 3U11A 4AL9A 2VY0A 3ZFEB 3NJYA 3VKNA 4Q5OA 3ZXDA 3WF4A 4ZU4A 3S5AA 3VZMA 4NIGA 4BQYA 1PM7A 2YPJA 5G05L 3FL7A 3RG0A 4FPEA 1Y43B 3O1UA 1QNWA 2C6SA 2FQPA 3H8RA 3RZKA 1GV9A 3JCIA 1IS6A 2QNKA 1OH4A 2DF7A 2YYOA 4JKLA 5FWEA 3WG3A 4YGCA 5DZFA 5FYSA 2DVAA 1N3QA 1PMHX 2OXBA 4W6XA 4BOWA 2ZX2A 4QHOA 2YU1A 5JOYA 3T0BA 2D40A 3GCXA 1LGCA 1JZ4A 2CDPA 5JZGC 4IE6A 5A3UA 3MV01 4AQ6A 3N4MA 4XJ9A 3PVBB 3WG4A 4BDVB 5FXWA 3IDCB 4LTAA 2RHPA 5CFCB 4QPIB 4JDOA 1Y3TA 4XF1A 1D4VB 1XE0A 4XIKA 3W5MA 3JXSA 5HBAA 4NRQA 4DUXA 2J1TA 2VUAA 5DUVA 4UI9L 5EWSA 4NHKA 3WUDA 2EALA 1DZRA 1SMVA 1K12A 4DIQA 4Z92B 1GKBA 3O1MA 2GSYA 1RUD1 3DL3A 3M3CA 4E4ZA 5SV5A 5FZLA 5FPLA 3ACGA 1UMZA 2XOMA 5LZ6A 1UU6A 3H3LA 5FZHA 1LENA 1ZRRA 1FV3A 1O7FA 2XL7A 1J3QA 1TL2A 2C24A 4MXVA 2IWGB 5L9RA 2VBPA 2WDBA 2WFPA 5B6TA 5J09A 4AFAA 2W2IA 1OUXA 1NE6A 4YZ4A 1JTZX 1MS8A 2YFZA 1MQTA 1C28A 3SQOA 1SHWB 3KF5A 4DPNA 3VDBA 2QKDA 2WWUA 3FBYA 1S1AA 4QX2A 4AVCA 5ABJA 3HNYM 3R4YA 2K9ZA 1VKDA 3VD3A 4DOUA 1EPZA 2BV4A 4HETA 5ACA1 1JHJA 5EP9A 1EUUA 1DG6A 3KB5A 2G4IA 1MS5A 3DYMA 3SCHA 2VZ3A 1W90A 1W2OA 3ES4A 2Z5WA 3D0SA 5FZ9A 3D5ZA 3Q8AA 3S57A 4C1WA 2OPWA 2HBTA 4NPRA 1WCUA 2JXAA 2X09A 1V0AA 5FY4A 1Y4WA 4B4PA 1ENXA 5HI0A 4UFJA 1OBNA 2RG4A 3PL0A 1NXMA 2AR6A 3D3AA 5GLQA 3D6EA 2JJ6A 4PIZA 1CIWA 1RUI3 4AI8A 1ZBE2 2G1MA 3AZWA 2PELA 1QGLA 3R4UA 4IEYA 4QQOA 4Q2FA 1S0JA 4CCNA 3I4IA 4XDQA 2YC4A 3ZPYA 5AVPA 3PU3A 2Q0AA 2VZ1A 4Y3OA 1RUE2 1L7RA 3WP6A 3WNXA 2Y0IA 1NLSA 1QOTA 3A0KA 3D82A 3T2TA 4UBHA 2X8FA 4YW5A 4M4PA 4PVIA 1YEWA 4BPZA 1YIPA 4AFDA 3LSEA 4CEYA 1O8PA 4N1IA 5GZCA 5JPMB 1SQ4A 3S0MA 4D47A 2WJSA 1ODNA 4NHYA 4KH9A 2VOKA 2Y0OA 4PQ9A 1UOFA 4L99A 1RJ8A 2C4XA 4HN1A 2LM3A 2XHNA 1SLLA 1RHI2 1S0FA 2L9LA 3LF7A 4QQPA 3RRDA 3JD71 4CDQC 5FREA 1O5UA 5DUWA 1CWPA 5K0UC 5A8CA 2Y6GA 3ENRA 4P00B 2HWE2 2BWCA 4WZCA 1NZIA 2JDYA 3JQWA 3AJZA 3DCQA 3W20A 4AGVA 1EUTA 1CQ9A 2ZGPA 1QJX1 4CDWB 5JOWA 1C5IA 1REDA 2Y8KA 1RUD3 2IXIA 1GWKA 4N43C 2OPKA 4HKOA 4AI1A 4AK5A 5GLOA 4RS5B 3ZFGA 4DEQA 3IDAA 4DRRA 3I3EA 4WM8C 2XB6C 1ND2C 1IS3A 3BGAA 2FDIA 1W6NA 4LEJA 2JECA 2PYTA 4FPLA 1PX4A 1PMJX 1F8VA 4DNYA 1UX7A 2D3SA 2W08A 4BISA 4PLNA 4MV2A 2YFRA 1LU2A 1MS1A 1BEV3 1BZWA 4WM7C 5FFOC 2D6OX 3KGZA 4PIXA 2P2KA 1HQLA 1DYKA 3CBNA 1RUG1 2XJVA 5FY8A 3ZN5A 1V6JA 2GZWA 4MH0E 2V4VA 3LOIA 1NLRA 3M3EA 4RGGA 2ZEXA 4JHZA 5KXEA 3GYDA 4ZU5A 2FDKA 1DF0A 2ZGUA 5GLLA 1YXWA 3B01A 2E32A 4EWDA 2XBO2 2P6CA 1D4M2 1R1ZA 3J7LA 3WDVA 4UW5A 3WDUA 1W05A 2W39A 4TSVA 3WASA 4ZKTB 1UNBA 3DPRB 1HDKA 5DAXA 4KWLA 1GUIA 1H9WA 3GHMA 3QCWA 2AREA 4FFGA 4HG6B 3VBSC 3N3HA 1DGWA 3NJZA 4CUAA 1US2A 2ZX0A 1JUIA 1ZRDA 2YFTA 1PVC1 4XPVA 3NMBA 5FR3A 5D21A 5T55A 3MGUA 2HWC2 4TN7A 4B4QA 3MFCA 4COUA 5GLPA 3FUOA 4FQZA 3WNOA 5FDBA 2CAVA 1WLCA 3TEZA 5C3QA 3NW4A 3PVNA 2ZHMA 2UY8A 4QXBA 5CYYA 1QJEA 4QKBA 5K0UA 3HIFA 4A44A 1OOPC 5D8AB 2RS32 3J4UH 4H14A 2VVDA 5FK7A 2RJKA 3BN6A 1MZ5A 1SFYA 1YI7A 2GH2A 4MX3A 3PURA 3ACHA 1S0EA 4PI2A 4BK5A 4AF9A 2WS93 2C26A 2CYFA 2ZGMA 1W6QA 2ET7A 1ULDA 3NQHA 1UD1A 2E6VA 3OEAA 3ORJA 1GSLA 1XE8A 2YG0A 4D6RA 1APNA 4LO7A 1NZCA 5A7WB 5HCAA 4V2VA 1NCRB 1KS4A 2WT2A 2BOIA 5JSOA 1LJ7A 1R092 5HPOA 1AYN2 3POSA 1GYHA 1RUC1 4XFAA 1TVGA 2BJSA 4QX1A 3WCRA 1XE7A 2A71A 1UXXX 3KZ4C 5IVEA 4XJWA 3WW2A 4EWEA 3TNQA 1PVXA 2R042 1RUH3 2YC2A 4S2FA 2EIGA 4XAAA 4IV1B 2YBPA 4GMP3 3CL1A 4XZPA 3OBAA 4PI0A 2R49A 2D6NA 4XC9A 4LLOA 4NN0A 5AC91 5EQUA 3LDRA 1S55A 4B7KA 3O0XA 1YRZA 4HZFA 5IUQA 4LKSA 3ZFGB 4RQPA 3WUCA 1PK6C 3M4FA 4GH4C 4QX7A 2VG9A 2XKPA 4AW7A 1CIYA 1YFUA 3GALA 3J8F2 4CDQB 5D2AA 2WZR2 2WBKA 1PVC2 3WPZA 4TLGA 4NRPA 5D1IA 3LOBA 1ULCA 4OI4A 4RQPB 4XFIA 3U37A 5L7OA 3KLSA 4AVAA 3AMMA 4WM7A 1W0NA 3AP6A 4TWTA 4MGQA 4E4HA 2AZ5A 4O8OA 2ZA9A 2VBBA 4ASMB 1GANA 2WZEA 5JSRA 1ULPA 1GOFA 4MO3M 2Y38A 1W9FA 5T54A 1GQGA 2C0ZA 4EWAA 3FZ3A 1OQDA 5EZWA 2RS13 1F2NA 2YUEA 4H7LA 2VQ0A 3ZFEC 5JZGB 4NOVA 5DDJ3 3OD0A 3MIHA 2HWE3 4UWDA 1A34A 4CYDA 5GZFA 3U0ZA 2R0HA 2PMWB 3OUHA 4F8AA 4HL0A 1W6OA 2D5FA 4WVZA 2CWSA 5CADA 5C2MA 1ULGA 1Q5OA 1STMA 3NNMA 1H2NA 2F17A 4AGGA 4DS0A 2J1SA 5TSWA 3HQXA 1DCSA 1W6MB 3KSCA 2Y64A 2WO3A 4NIAA 2VECA 3JUUA 4KBBA 3VDDA 3QZ4A 1AX2A 2X8KA 3A0NA 1X33A 2JIGA 2ZJCA 1UV4A 1JZ2A 2Q30A 1Z0HA 1G9FA 5A7VA 1NAEA 1DLLA 1BVP1 1V6LA 1XJAA 4XFGA 5F7UA 4IEZA 4LK6A 5F3IA 5J98B 3O1OA 3LEGA 1VMHA 4ZZ8A 3WR0A 2BW8A 3OPWA 5A32B 4KMIA 4OQ9A 4CPBD 4ITCA 2C9KA 5JOZA 2W1UA 5F1RA 5E16A 2UWBA 4QPGA 1QIQA 1UPSA 5HXMA 2BNNA 4NHXA 2QQMA 2PQSA 3K4AA 3VZNA 1AL21 1NY71 3I3BA 4OVEA 3DKWA 5LBCA 3PNAA 5LBBA 1QOOA 1I1EA 1PO11 3WZ1A 1GLHA 1H8TA 3MHZA 4DMIA 1XYOA 3V64A 4PDWC 1NG0A 1MACA 3VGIA 1ZRIA 1TQ5A 4Y22A 2OIIA 3LA7A 2ES3A 1K42A 1AR72 2O0OA 2P1BA 4LO5B 5FY9A 4LUMA 1P8JA 3ZM8A 4XMIA 3ALQA 1ZZCA 4YSFA 2R30A 4YW2A 5JPNB 3GCWA 2HWB3 2XVGA 3HWJA 1OFNA 3DF0A 4C0HA 3NV3A 1RUH1 1UPIA 5T5PA 4WVWA 3USUB 1T6BX 3OM6A 3QEEA 2EIEA 1L7QA 1VMFA 3ZO0B 3U1XA 2V5YA 2O1QA 5EIYB 2DYCA 1TNRA 3AFGA 1W6PA 2RS33 5ABJC 1W6QB 3OPZA 1UIKA 1PK6B 4HPKB 3DV8A 1SZBA 4NOTA 5F2WA 5I0SA 2VPVA 4LXLA 4B7EA 3MDPA 4FPOB 4E2QA 1CAXA 2W94A 2IVJA 5D8AA 2EICA 4QU2A 3ZIXA 2J7MA 5J7MA 1BMV1 2E9QA 1ZZ8A 3SKVA 4JAAA 3TEWA 2YHJA 3BPZA 2WNVC 1WBLA 4GULA 1C1LA 2XUMA 2CHHA 3A23A 4COZA 1HB2A 1H1IA 4XFCA 1L3JA 3IPVB 1S2BA 3VD5A 4AHYA 2OYZA 3N36A 5FZCA 1O8SA 2ADDA 2VW0A 1D4M3 1FMD2 3ZFEA 1UZVA 4WV8A 4ATEA 2HKXA 2KXLA 5IVJA 3C7FA 4Q8KA 2RDSA 1UL9A 4BHPA 1PGSA 1AL22 1NY72 2WC2A 3T3YA 1COV1 4COTA 3WW1A 2B4WA 4BZ4A 4IGQA 2Z4FA 1BEV1 4LULA 3D60A 5IVFA 3RS6A 5T5OA 2BNMA 4XDPA 2VZVA 3SMHA 1TMF3 4ONUA 4AGRA 3GJBA 1LOGA 1V6OA 2YMZA 4N53B 2RM21 3VDDC 4AYUA 1OLRA 1POV3 3CIHA 1UYYA 3JBG1 1AR71 3SISA 3SCFA 4CP0A 2JDPA 2CU5A 2W68A 1S0BA 3I3QA 3Q8EA 1OI6A 2FDFA 1LODA 2J1RA 4K40A 4G9SB 4C91A 1C1FA 3ABZA 1W8NA 1IPSA 2VCBA 4URAA 4Q4V1 4JDNA 4HVOA 1UIJA 1EYBA 2QJVA 5A3MA 4B3NA 1ND2B 2DWRA 3BU0A 1AYM1 3CJIA 3HT1A 1W8OA 4KWKA 5BNPC 4QXCA 1JZ6A 4PVAA 5A8DA 4Q29A 2R061 1OUSA 4MGZE 4XJUA 5CFDB 4QKNA 2OQ7A 3AVSA 5FP9A 1QJY3 2E63A 1AL23 1DZQA 5J96B 2MHFA 3OB8A 1D0GA 2XL9A 2Z79A 1NYWA 2D97A 2VMFA 1CN1A 4QB1A 1S0IA 1O5LA 4KWUA 2R7EB 3ILRA 3CJIB 5FMCA 5HV4A 3NVCA 2NLRA 4CCDA 2KA3A 2BUKA 2BBAA 2ZKLA 4LKEA 1J83A 2DBNA 1D7PM 2NP0A 1RXFA 5F5QA 2VMDA 4FPJA 3R6SA 4KGGA 5FZAA 3I2OA 1CD3G 3BTYA 4O8NA 1DQ5A 5C4WC 5CG8A 5JXJA 1LHWA 2W52A 2UY9A 4LLFA 1F5FA 2FMYA 3THPA 4AHXA 3I2DA 1ZZBA 4BLIA 1ND3A 3I2GA 1HRI3 2WO2A 1PZ8A 4Q0SA 3CU9A 4EZHA 2E7AA 2R071 4GQ7A 5DABA 4FPCA 1VAMA 2FZ2A 4HKLA 3K2OA 4W6WA 2XH6A 1KITA 4N43A 2E33A 4NROA 2TUNA 4AI3A 1UU4A 5FXZA 1V00A 3Q8CA 3HD8B 1R082 1SBDA 1S0GA 2ZAAA 1H2KA 1HLCA 3I2KA 2QDRA 2BGOA 1LEDA 4E27A 3ZYRA 4OI0A 4FOQA 1RUI1 3LB9A 1ALYA 2CAUA 4JQTA 3ZSEA 3MO4A 1NQDA 2LRPA 4LIVA 4XQDA 2KD7A 3O1SA 1RGSA 4YVSA 5F5CA 1H4GA 3D4KA 1CZSA 5I93A 3UT0A 5FZ8A 1YLLA 3C8XA 4NR1A 1A3KA 5JMOA 3N9MA 4UOJA 5APAA 1NLQA 2ZEZA 4JC1A 3ZKYA 3EJKA 4XDOA 4Y4RA 5DZGA 3V65A 3IDEA 1PX3A 4XBNA 1W9SA 3ZXKA 1HV1A 1HRI2 2WFF2 1LHVA 1GZWB 1S0DA 3RZMA 1OLME 1ZVFA 2WLQA 2W9XA 2W92A 3A7QA 2OX0A 3H8UA 4LA2A 1LECA 2BERA 5A3TA 3JBG3 1MS0A 1T2XA 3BPSA 4Q1RA 1DQ2A 1J1LA 1SG3A 2DUPA 5FP3A 5DAVA 3U14A 1JMUB 4FFFA 3UGGA 2ZX1A 4BH9A 2GC2A 2VQAA 1R64A 4XUNA 1HQNA 4EN8B 1RINA 5CFCC 1TME2 3WP3A 4MZUA 2OT7A 2RDNA 1UOJA 3MPPG 3QBQA 4QX5A 1Y7BA 4RGKA 3HQRA 3M3IA 3T4VA 2AEYA 2DU1A 3ZX7A 3WPYA 1W06A 2I74A 1Z78A 3VBUB 3HAGA 1Z7S3 1AR63 3HJRA 3POWA 1O3TA 1VALA 2FDJA 1RTVA 5FYCA 4HPKA 2WZPP 4BLJA 4EYUA 1XNKA 4LBLA 4BIFA 3S7IA 2C1FA 1G9DA 5F3CA 5G04L 5I0RA 2WLPA 1ST8A 3KS7A 3D8CA 4AI9A 3WT3A 3VHOA 2D93A 4M3CB 3S5QA 4OHXA 4UBGA 4XW3A 3ZR5A 4B4RA 2GMPA 2Q5TA 4XFBA 3NAPB 5KHJA 2EIDA 2DCTA 3U75A 5C6CA 2R1DA 4CA9A 2R073 1RUI2 2NM1A 1MQTC 1FPN1 2XJPA 2PAEA 2PAMA 4CUGA 4FTBA 4X8NA 1AJOA 2JB8A 3CZJA 1WCSA 1YQ8A 1OA2A 1QJX2 4EJRA 5I8TA 2PQQA 3KHBA 3L2HA 1I9RA 3AKTA 3WV6A 1VBE1 2BOJA 3IKWA 4UW4A 4CDUA 4ARXA 3LPFA 1LOFC 1RUF3 5KXCA 5GLNA 2IZWA 4CXWA 2RMU2 2DVDA 2DVGA 4UAPA 1HRI1 2W95A 1BYHA 2DFBA 1OKQA 4ES9A 5BYNA 4R9BA 2KR2A 2BEOA 2HWB1 4IEUA 4QAWA 3UKTA 1DFQA 3GDBA 2WO7A 4OZXA 3FLRA 1Y9GA 1GNZA 4FOWA 4J1XA 1JS9A 3BIEA 1ZREA 2E7QA 1KDKA 1MPXA 3MPBA 4PBPA 3GZAA 1PIV1 2RS53 2UU8A 1R1A3 2NQYA 3ZMNA 4A7KA 5IVBA 3C2UA 5J36A 5A7VB 4XJAA 2BYVE 1O4YA 4HSLA 3AKSA 1H0BA 4GB31 5FXXA 5A6QA 5GALA 5FZOB 1CAUA 1LRHA 1XRUA 4CCKA 4E2SA 1HRV2 3LA3A 3RZJA 3KWVA 1D4M1 3TN93 3FFZA 5JR7B 2WT1A 4GKXA 2VNGA 1YI9A 2A6VA 4GMP1 3PUAA 3NV4A 5FYTA 4PJYA 1JZ5A 2WA3A 2WNUC 1A8MA 3JZVA 4N43B 3PTRB 1MS4A 1W0PA 2A1XA 1XQNA 3SLIA 1DP0A 1MEC2 2GALA 4IV3C 1OKOA 3AP7A 4YFZA 5AFBA 4FOYA 1QH7A 4CCMA 2EXKA 1N1TA 4XILA 3WVJA 2D3PA 3EB7A 4PDWA 4FAHA 5C7GA 1ND3B 4L97A 3I3MA 1Q8OA 1ZZ7A 2YV8A 2B4KA 5FZEA 4PHZA 4FPKA 1WL7A 5L73A 4CSWA 4WVMB 2KM2A 2CTVA 1RL3A 2NN8A 2VE1A 1C4RA 5FY1A 4H55A 3J7NA 4IEPA 4A3XA 1RUJ2 2BNOA 4GWJA 4IV1C 2YPDA 2RS52 4OLLA 2X5IC 2JDKA 2QQOA 5E6HA 5FZFA 3UJQA 1F5JA 4KC8A 1GP5A 4AVSA 4QPYA 3HOBA 3PVEA 4Q4X1 1B35B 1XNDA 3DGTA 3P1IA 3VBHC 3WDYA 1I5ZA 4BWOA 3VKFC 1CX1A 3OUJA 4CDQA 3T30A 3WLUA 1JOBA 5FYYA 1DGWX 1S2EA 4FXGB 1JXNA 4L92A 1W9WA 4MXWA 3FUQA 4NPMA 3FLPA 4O61A 3RZGA 1W3XA 4LBQB 4YG3A 2VAUA 2O14A 1OD5A 1W9TA 2VMCA 4XUPA 1IOAA 1AYN1 1U12A 1O59A 4JGYB 4N53C 4N2RA 4G3YC 1AR83 4IE4A 4OZOA 3NJXA 4IE0A 4YYOA 4EN9B 4RA0A 2W87A 3IIIA 5FOBB 2YFSA 3MIGA 1BLZA 3N9OA 4JVAA 4ZS3A 1WCDJ 3LSDA 3BU7A 1ND2A 4ARYA 4QDRA 4ZZ5A 5L19A 3NKTA 4Y5TA 4META 2Z2SB 1EV11 3TEXA 2PHUA 1W8ZA 4L2NA 4K3UA 4BMEA 1UU5A 1PO21 1GP4A 2JE8A 5A33A 1G86A 1QJY1 3CKHA 1Q8VA 1CAVA 2X05A 1REEA 1SFNA 1FOD3 3AYDA 2EAKA 4QX0A 2AGSA 4LORA 2VH9A 2B7YA 2H0BA 3AYEA 4LKDA 4LITA 1YQCA 1D0HA 2XKOA 1RVF3 5EFUA 4GWIA 2DCZA 4CPBA 2XQRA 3RJ2X 4XBLA 3I2IA 3OGJA 5BNNB 2GN3A 1J59A 4RHV1 1RYYA 1XNBA 4YM0A 4A6SA 1SACA 1VBB2 1N3PA 1UOGA 1OVSA 1K5MB 2EAAA 3AP9A 1FOD2 2VOXA 3PIGA 1PHMA 4Q0PA 3OM4A 1AJKA 4TZDA 1AR82 1TME3 3BYKA 4KC7A 1XC6A 2PLV1 1VPHA 3R0RA 4OUSA 1PIV3 2IC1A 2RS51 3MW3A 1W2NA 2QQJA 3NJVA 4CUBA 2VNOA 4RFRB 1J3PA 3IPVA 3H42B 4ZS2A 4JRAA 5FYZA 3SC7X 1CONA 5CFDC 4F3JA 4CEWC 2JDUA 3M3OA 1WBFA 3KF3A 2O8OA 5A70A 4FTSA 3WHTA 2XJRA 2GNTA 4IERA 1XU2A 1VBB3 1HQWA 2WS91 4HONA 2UWCA 2R0FA 4MLGA 1RUNA 1GWLA 1HJGA 1VBD2 1E5HA 2WR9A 4UDGA 2XMLA 1ULOA 3OSDA 1IS5A 3NWKA 4CXXA 3BI3A 4P9GA 1V9U3 5A3LA 3Q8BA 4Q26A 2QQVA 3GHNA 1GWMA 3KV9A 4Q4X3 1XSRA 3R4DB 2FDGA 4HT1T 3WQ1A 4CU9A 4XF0A 4J6GA 5CKNA 1LULA 2B45X 5A6YA 4MG2A 3O14A 4HXCA 2VBDA 3UGHA 3MF9A 1EV12 3H7YA 3BODA 3E5UA 4XF9A 3K1UA 4COVA 5CBLA 2ZX3A 3IIAA 1QJY2 4K21A 3IAQA 1E57A 1C5HA 2NYYA 2XWJB 1VBC3 1K5JA 1RUF2 4YVSC 1W2UA 5FY7A 3H50A 3P2NA 4XUQA 4LMFA 4KG8A 3AXDA 2JDZA 1YCIA 4D6SA 4JGZB 5T50A 1OT5A 5DDJ1 1GNYA 5KWRA 4QM9A 4AEMA 1I5PA 3U10A 3VBFC 2IUWA 5EJZB 3KQ4B 4EV0A 1FOD1 3HN3A 4YW1A 5K0UB 5JIUA 2PFWA 3ZDSA 4BB3A 4S2DA 3O7OA 3OGVA 4GJZA 3WMYA 1UYZA 5LRRA 1RUE3 3AVRA 2TNFA 4I30A 3FC0A 4X8PA 1WCKA 1FPN3 1AR73 1CAUB 1RXGA 2WKKA 3ES1A 1V70A 1QQP2 1WLTA 3BCWA 3C3VA 5J37A 4LBKA 2RMU3 5L9BA 4XBQA 1UN1A 2RDRA 4LQRA 3RPQA 1GYKA 3TB0A 3OBTA 4M00A 5LATA 1G9AA 4YARA 1COV3 3AKPA 2HWD3 3KHCA 1JOJA 2CV6A 5ERLA 4AWDA 4JGYA 3AMQA 4BMBA 3ZN6B 4MGTA 1CJDA 2AC1A 4Q4W2 5FLJA 1F15A 3ACFA 3ZLIA 4GAZA 4P9YA 2PHLA 1AXZA 4I2OA 5F5IA 4PF1A 5GLWA 4S2GA 2DVBA 3T0DA 1ASJ2 5FZ4A 4JCKA 3LV4A 1HB1A 4C0BA 1BHGA 5F37A 2RR11 3CJXA 4MGYE 2WWJA 5I8SA 3OCPA 2VXRA 1NT0A 1QNYA 3QACA 4QHBA 5DN2A 3GZEA 3B00A 4XABA 3ZFGC 2VCMA 2PLV3 2CWMA 1LTEA 1AR93 1FMD1 1GQHA 3N9NA 2PAKA 3DECA 1JOPA 3KT4A 3O1RA 4IXLA 2AH2A 3DYOA 1SCSA 4NWVA 2FZ1A 2D6LX 4NAOA 2ID4A 1A78A 1POQA 4PIYA 4RR3A 4COYA 2LW8A 3N9QA 4DRVA 5FOJB 1XYPA 5BNQA 1XNAA 3POGA 4MHRA 4YRDA 4Z07A 4WVVA 1OD3A 2LUWA 4Q4Y1 4RL7A 2ZGOA 3J7HA 5A7PA 4B1LA 5LW9A 1JZ8A 5I0UA 4QXKA 4U6DA 2ZS6B 3NRUA 2EXIA 1JBCA 1R1A1 2BRTA 2OUHA 2E51A 3JBG2 4IE7A 3K3NA 4XAEA 2G9FA 1PGW1 4J1WA 2VOVA 1AVBA 4GB33 3SEEA 2ZMKA 1B09A 5KC6A 5GLUA 1GZCA 1OPOA 2YROA 4B29A 5C5TA 5DAQA 4HN0A 3RYKA 4MSVA 1KJRA 5CVRA 2OS2A 1QJU2 5FZ6A 4ORFA 2VUCA 5FO9B 2XJUA 4YW7A 1PM4A 5H9RA 4NJ4A 5C8CA 3UKNA 2YBKA 3I2JA 3ZXAC 4C1XA 3WD5A 4LO4B 4MYEA 3M7AA 2K46A 2P34A 3HBKA 4YG0A 3RQ0A 4EN7B 3I7DA 3VSFA 3CMGA 3VBRA 2ZTNA 1WW5A 4I3PA 4IW3A 5FLIA 5EJ3A 5CFCA 1TMF2 3ZN6A 3RZLA 3WN1A 2VMHA 2ZEWA 2P5BA 1F9KA 3UKVA 3WF0A 5BNOA 2A3WA 4QPIC 2VCCA 2JG9B 2BGPA 1M06G 3PJQA 1OXCA 2QUOA 2YGMA 4ASLA 1KFXL 3SXWA 4ATFA 5LY1A 3QOPA 1UZYA 1BK1A 5IVVA 3ZFFB 1ZBA3 4BQ4A 2UYBA 5FZKA 4XUOA 5LA2A 2AENA 5FO8B 5KXDA 2XLGA 4EE2A 3SEPA 4AQ2A 2IVIB 1U5ZA 4A2UA 3KGLA 3MLKA 4JGZC 1OOPB 3VZOA 4LHLA 1EPWA 2NZ9A 1AYN3 4QPWA 3NV1A 1JYTA 4Y5Z0 1PZ7A 2DV9A 3VKLA 1WA4A 3OM5A 3MUZ1 2CGNA 2J1AA 4LPLA 2ARAA 4M0HA 4V1PA 3I49A 1ZZ6A 3MV11 4ZHNA 3V0BB 1ENSA 4YW6A 5JIAA 4FFIA 4Y24A 4XCAA 5C3PA 3VD7A 1W6PB 4Z8BA 3B02A 4QWNA 4QQHA 4OI1A 3BUCA 5DXDA 3PMEA 4KQ7A 1EV13 1H2MA 1BVVA 2ZMLA 3DN7A 1DQ6A 3NNGA 4YVWA 1KFUL 3BYLA 5CA6A 1TE1B 1X8EA 3AP4A 3TNPB 2B9UA 3IBMA 3DYPA 2Y34A 4ISRA 4MGSA 1YQ2A 3J26N 5L7OC 1OURA 5FZDA 4R52A 1OA4A 5B6SA 2GP3A 1A8DA 1RUC3 2VULA 3RWNA 4QDQA 2SLIA 2DUOA 4CP9A 4ZONA 2ZPXA 2X8SA 3VT1A 4UFHA 4GWNA 4Y1XA 2ORZA 4DXZA 2CL2A 2VR4A 3FMGA 3KVBA 3MICA 3NNLA 4Y4YA 1Y9MA 4GKYA 4JTOA 4XQ4A 2RVAA 5GLTA 2X53S 5C9AB 2WSUA 2XUEA 1CGPA 1HV0A 3VBHA 3GZTB 4XZUG 5A32A 1DDLA 1UYPA 3QEDA 3N9LA 4RQPC 4CZSA 2P17A 3EYPA 1MZ6A 2PHTA 1X50A 2WSVA 5LBFA 3AKGA 4FPYA 1WKYA 3KV5A 3W59A 3PIJA 3QC2A 3M2MA 5L36A 4GIQA 4CU7A 1C8NA 5DPNA 1ZA4A 1H6YA 3R05A 1LOAA 3KCCA 1LGBA 3GZUC 4BXSV 2EA7A 1MS3A 1ONAA 3RYRA 4OQ8A 2XJQA 2YGLA 5IVYA 3MIDA 5GZEA 1WW4A 4UDJA 4PLMA 4CDXB 2ZGKA 5BNNC 5JOXA 4K9SA 5FPXA 3T08A 4AI2A 1H30A 5HCBA 4QT6A 5FKCA 3MIBA 4G4FA 3ZKUA 4HMZA 5IT6A 4W8JA 2IXKA 1BJQA 3LWCA 3AMPA 1W03A 3I8TA 3P5BA 4P08A 4P9LA 3CEWA 5KR7A 2VOTA 3WG2A 3B93A 3B7MA 3WATA 4K8RB 3WPUA 1G8WA 5FCCA 4CDXA 2QVSB 3FX3A 3R4SA 2VNVA 4DXRA 2DBIA 4Y1YA 1ZBE3 3C7EA 1HIXA 3LEMA 4N7IA 4PF5A 2PHRA 1RMU1 3H1YA 2W47A 3EBRA 4WM8A 4JV4A 4Y5SA 2HWD2 1E5SA 5ISLA 2A6YA 4YZ3A 4XQWA 3TEYA 1LCLA 5C8CB 2HEVF 2JE7A 3ST7A 4N9HA 5J48A 4AHZA 3HNBM 5IK5A 2CDOA 4Q0VA 3RMYA 2A6ZA 1MR5A 1JI6A 3ZDVA 4GJYA 3VBOC 2D44A 3CU7A 4OULA 1RB8G 1SFPA 2Q8EA 2HWB2 1Z7S1 1AF9A 3MBWA 2HWC3 4UT5A 1B35A 2PA7A 4ASKA 5JMCA 3SHRA 2OZJA 4Z2WA 1BBT1 4EQVA 2E26A 2K2SA 5EJ1B 3ZPOA 1PO23 1YYNA 1W3VA 2J1VA 2SBAA 2VOWA 3HR9A 1NX9A 2BQPA 2H6BA 4EZ4A 5IK8A 3H8XA 5LBEA 2FD8A 1RUD2 3B9IA 5FYUA 3RVHA 2WUHA 4QGMA 3B69A 2HEWF 2DU0A 5E1RA 4FXKB 3MLLA 1QXJA 1POV1 2EF6A 2J42A 4K8FA 1QU0A 3IN9A 3O1VA 1S4CA 1MEC1 1SBEA 4Z1VA 5K7PA 3WNKA 2QTWB 4JKMA 1AYM2 2VO5A 2WA4A 1UKRA 5FJHA 4BQ5A 5B4XA 1GU3A 4BK4A 2MEV1 2ZHLA 1RITA 2DVFA 2XVLA 5AVAA 4UDKA 3LQCA 1ULFA 3VBFA 4LIUA 3EQEA 5ANNA 2V73A 2VMIA 3I2FA 4RYDA 2MPFA 5FZ3A 3E6CC 4O65A 2YFUA 3OUIA 4XXPA 4PCRA 3ZXGA 4B1MA 5I0DA 4NMIA 2ARBA 3WNMA 1DHKB 5K4LA 2Y6FA 2Z42A 4M01A 2Q4SA 3WNNA 4OYUA 3G6JB 3AZYA 3WQBA 5KHKA 1IPKA 2JG8C 2DUQA 5FKBA 4UW6A 4OCTA 1ZYBA 3N7MA 4LBOA 3WG1A 2WN2A 2YY1A 5A33B 4SBVA 4LUKA 1I6XA 4IEOA 3MFAA 4HLTA 1MVQA 1WGPA 3EMRA 3IMMA 1OA3A 1S2KA 3J9SA 4IL7A 2D6MA 3WCSA 4AZZA 1ZBE1 1LAJA 2GU9A 1QOSA 3ZVXA 1O91A 3GM8A 2NMNA 3ECQA 5FTTC 4KNCA 3TN91 4YFWA 1W6MA 1WW6A 3T2PA 1OLQA 4CP9B 3I54A 5FP8A 1BBT2 5I0TA 5AYDA 2R072 4FQ4A 1V6KA 3I59A 4LA3A 3SH3A 2ZX4A 4AFMA 5FUIA 4MXWB 2HLEA 2CGPA 1UMIA 2FCVA 3VKMA 3AYCA 1LOEA 4JQRA 1WUVA 2O8QA 4MGIE 2W1QA 2HH9A 3BTXA 4E2GA 1O6UA 3WN0A 4IEWA 2IFWA 1YWKA 2ZGSA 3LFIA 5FQ0B 3WDWA 1U5YA 4MGKE 3LZZA 3WHUA 1HN1A 2W1SA 2X5IB 3PDQA 3U78A 4JDMA 4LJHA 2HWF3 3JD72 3T09A 5FLHA 3N9PA 1REFA 3Q9OA 3N7LA 4FT8A 1W6NB 4CCJA 1OQ1A 3DXTA 2HWE1 3Q8FA 1LKNA 4QB6A 3A22A 1KEXA 4CTEA 1IHMA 3NAPC 2MEV2 3DUIA 3K4ZA 5A6ZA 2WQ4A 3VBOB 3R67A 2OA2A 1Q56A 4LHSA 4Z82A 5FK8A 3OF1A 4I0BA 4QPGB 3HBZA 4JGYC 4YW4A 5C4WA 3U07A 1NQJA 1DIWA 1CAWB 2FMDA 3OPTA 3KT1A 2J22A 4YGDA 5EYXA 3RJRA 4DXSA 5FMOL 1UCXA 5FZ1A 3WF2A 3ETPA 4MHUA 5CEHA 4DZGA 4ET7A 1PZ9A 1OVPA 1VBC1 5BNPB 3VSSA 2ATFA 3BB6A 2WS92 3AFKA 1JYVA 2XLAA 3GBWA 2HYKA 4YGEA 4IEXA 4LNVA 4CEYB 1NCQB 3VBRC 5A6XA 4NPLA 1W2TA 1UQXA 3WAUA 3AJYA 3U4SA 4MVTA 3S30A 3AMHA 2CGOA 3C7GA 5EXOA 4KCAA 1VBD3 2XBO1 2QBXA 3O5SA 5A7WA 2MEV3 4HSJA 4NWWA 2DCJA 3QH7A 4FAGA 4E4SA 4QU1A 1RVF1 1F31A 2VXJA 5GKAC 4F7ZA 1J1TA 4AVVA 3INAA 1JU3A 2D6KA 3MUY1 1AR61 1UXZA 3KCYA 2F4LA
chains in the Genus database with same CATH topology
4UFJA 2X8TA 3KSTA 1YI7A 3AKIA 4UDKA 2X8SA 5C0PA 5ANNA 5GLNA 5GLQA 3VT1A 4UFHA 4B1MA 4O8NA 3WMZA 3NQHA 3OM4A 3PIGA 1YIFA 1Y9MA 2AEZA 4QHZA 3BYKA 4KC7A 2YFTA 1UYPA 2QQWA 3CU9A 5FKBA 3QEDA 1Y9GA 4UFIA 1GYHA 3SC7X 3AKGA 3LDKA 2X8FA 4UFKA 3OM6A 3KF3A 3PIJA 3QEEA 4UDIA 3OM7A 4B1LA 3QC2A 4PVIA 4QQSA 4U6DA 3LIHA 3U1XA 1PT2A 3BYNA 4N1IA 2EXIA 3C2UA 5GLRA 5A7VB 3QEFA 3IMMA 4D47A 5AY9A 2EXHA 3AKHA 4MLGA 4AZZA 3WN2A 4UDGA 3OSDA 4UDJA 3C7OA 3D5YA 3LDRA 3VT2A 3BYJA 3LF7A 5JOXA 2QQVA 1YRZA 3UGFA 5AYDA 5A8CA 4N4BA 2XQRA 2B4WA 4O8PA 4JQTA 5FKCA 3VT0A 4N2ZA 2VDTA 4HXCA 3UGHA 5JOWA 3D61A 5FIXA 3ZR6A 3HBKA 3K1UA 2EXKA 3WPZA 3WATA 3WN0A 4AK5A 5GLOA 2QQUA 3LFIA 3WPUA 2OXBA 2ADDA 2ADEA 3ZXKA 1WL7A 3WN1A 4O8OA 3P2NA 4AK7A 5JOYA 3C7EA 3LEMA 3C7FA 5FLWA 4UDKE 2YFRA 4COTA 4KC8A 3C7HA 5GLMA 3OM2A 3D60A 3R67A 4NOVA 3UGGA 3U14A 5FK8A 3LIGA 4FFFA 4UFMA 5FMDA 2EXJA 3ZXJA 4CCEA 3TAWA 5B6SA 1Y7BA 4ONZA 3R4ZA 4KCBA 2AEYA 3RWKX 3WPYA 5GLLA 3WMYA 3H3LA 4N2RA 4CCCA 3OM5A 3VSSA 5FMBA 4EQVA 1W18A 2YFSA 3WASA 5B6TA 5AYEA 4FFIA 4AK6A 1UV4A 3VSZA 3VSRA 4FFGA 1ST8A 5A7VA 4PVAA 5A8DA 3QZ4A 3S5QA 3KF5A 4U6BA 1W2TA 3ZR5A 3WAUA 3NMBA 3R4YA 2AC1A 1VKDA 3U75A 1GYEB 3VSFA 5AYCA 5GLKA 4FFHA 3AKFA 3C7GA 4KCAA 5GLPA 3WPVA 4KMIA 3BYLA 5JOZA 1GYDB 3LV4A 3D5ZA 1OYGA 3ZXLA 4UFLA 5FMCA 5FK7A 1Y4WA 4CCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFJ A;  2X8T A;  3KST A;  1YI7 A;  3AKI A;  4UDK A;  2X8S A;  5C0P A;  5ANN A;  5GLN A;  5GLQ A;  3VT1 A;  4UFH A;  4B1M A;  4O8N A;  3WMZ A;  3NQH A;  3OM4 A;  3PIG A;  1YIF A;  1Y9M A;  2AEZ A;  4QHZ A;  3BYK A;  4KC7 A;  2YFT A;  1UYP A;  2QQW A;  3CU9 A;  5FKB A;  3QED A;  1Y9G A;  4UFI A;  1GYH A;  3SC7 X;  3AKG A;  3LDK A;  2X8F A;  4UFK A;  3OM6 A;  3KF3 A;  3PIJ A;  3QEE A;  4UDI A;  3OM7 A;  4B1L A;  3QC2 A;  4PVI A;  4QQS A;  4U6D A;  3LIH A;  3U1X A;  1PT2 A;  3BYN A;  4N1I A;  2EXI A;  3C2U A;  5GLR A;  5A7V B;  3QEF A;  3IMM A;  4D47 A;  5AY9 A;  2EXH A;  3AKH A;  4MLG A;  4AZZ A;  3WN2 A;  4UDG A;  3OSD A;  4UDJ A;  3C7O A;  3D5Y A;  3LDR A;  3VT2 A;  3BYJ A;  3LF7 A;  5JOX A;  2QQV A;  1YRZ A;  3UGF A;  5AYD A;  5A8C A;  4N4B A;  2XQR A;  2B4W A;  4O8P A;  4JQT A;  5FKC A;  3VT0 A;  4N2Z A;  2VDT A;  4HXC A;  3UGH A;  5JOW A;  3D61 A;  5FIX A;  3ZR6 A;  3HBK A;  3K1U A;  2EXK A;  3WPZ A;  3WAT A;  3WN0 A;  4AK5 A;  5GLO A;  2QQU A;  3LFI A;  3WPU A;  2OXB A;  2ADD A;  2ADE A;  3ZXK A;  1WL7 A;  3WN1 A;  4O8O A;  3P2N A;  4AK7 A;  5JOY A;  3C7E A;  3LEM A;  3C7F A;  5FLW A;  4UDK E;  2YFR A;  4COT A;  4KC8 A;  3C7H A;  5GLM A;  3OM2 A;  3D60 A;  3R67 A;  4NOV A;  3UGG A;  3U14 A;  5FK8 A;  3LIG A;  4FFF A;  4UFM A;  5FMD A;  2EXJ A;  3ZXJ A;  4CCE A;  3TAW A;  5B6S A;  1Y7B A;  4ONZ A;  3R4Z A;  4KCB A;  2AEY A;  3RWK X;  3WPY A;  5GLL A;  3WMY A;  3H3L A;  4N2R A;  4CCC A;  3OM5 A;  3VSS A;  5FMB A;  4EQV A;  1W18 A;  2YFS A;  3WAS A;  5B6T A;  5AYE A;  4FFI A;  4AK6 A;  1UV4 A;  3VSZ A;  3VSR A;  4FFG A;  1ST8 A;  5A7V A;  4PVA A;  5A8D A;  3QZ4 A;  3S5Q A;  3KF5 A;  4U6B A;  1W2T A;  3ZR5 A;  3WAU A;  3NMB A;  3R4Y A;  2AC1 A;  1VKD A;  3U75 A;  1GYE B;  3VSF A;  5AYC A;  5GLK A;  4FFH A;  3AKF A;  3C7G A;  4KCA A;  5GLP A;  3WPV A;  4KMI A;  3BYL A;  5JOZ A;  1GYD B;  3LV4 A;  3D5Z A;  1OYG A;  3ZXL A;  4UFL A;  5FMC A;  5FK7 A;  1Y4W A;  4CCD A; 
#chains in the Genus database with same CATH topology
 2X8T A;  3KST A;  3AK0 A;  5KBF A;  4KU7 A;  3M3Q A;  1GOH A;  5FUP A;  1O3R A;  2V72 A;  2GC0 A;  3LA2 A;  1PGL 1;  1F4H A;  4QX8 A;  1IKP A;  4TLF A;  5JCT A;  4KI5 M;  1W99 A;  5EPA A;  4S2H A;  2JWP A;  4Y26 A;  2A70 A;  5AC9 2;  3PMS A;  3E5Q A;  1XSQ A;  4CEY C;  1QH6 A;  2I07 B;  2PTM A;  2Y26 A;  2VUJ A;  5CAZ A;  2RS3 1;  1G9C A;  1XB9 A;  3K46 A;  3NAP A;  3P6B A;  1NA1 A;  1UY3 A;  3POB A;  5GZD A;  2UYA A;  5T5L A;  2PN5 A;  1C3H A;  1FXZ A;  3L2Y A;  5JR2 A;  4RR3 B;  1MQT B;  4BJ0 A;  1W8T A;  3QEF A;  2WZR 1;  3VD9 A;  1ZBA 2;  3WN2 A;  1BCX A;  1HB3 A;  5HV0 A;  2Q8D A;  1KGY A;  4AE2 A;  4R4X A;  5JXG A;  2OW4 A;  3T0A A;  5IW0 A;  1F4A A;  3VT2 A;  3VDA A;  2RJL A;  3FBM A;  3OOX A;  1R09 1;  4KL1 A;  3BYJ A;  1ULE A;  3AB0 A;  3M1H A;  1RUC 2;  4KU8 A;  1UW8 A;  3N7K A;  4IUG A;  1VLN A;  4RS5 C;  3AXE A;  1OF4 A;  1U5X A;  1BK0 A;  1VB4 A;  4Q0U A;  3RDI A;  2X29 A;  5FIX A;  1QJZ A;  1H6X A;  2R04 1;  1RJ7 A;  3H1M A;  1IZ3 A;  3RFR A;  1FV2 A;  1QJF A;  1GQP A;  2JKB A;  2R1B A;  4D7S A;  5M0T A;  1HRV 1;  1RHI 3;  4NHL A;  3HNM A;  1UZW A;  1UO9 A;  4UF0 A;  4XYX A;  5F39 A;  5IVC A;  1ASJ 1;  2E53 A;  4BA6 A;  4IEQ A;  2RJ2 A;  1GNH A;  1YFW A;  1OMI A;  1AYM 3;  2BP6 A;  1YQ5 A;  2HEY F;  3A4U A;  3JB8 A;  3MW4 A;  4NE9 A;  2DCY A;  5IWF A;  2Q1M A;  4UDK E;  2D7F A;  3NKG A;  1HXS 1;  1F35 A;  1LU1 A;  3PUS A;  4A7Y A;  1QWR A;  3HEI A;  1PGL 2;  2BFU L;  3O1T A;  2G19 A;  1JYI A;  4QKD A;  1N1S A;  1VAV A;  3OBZ A;  2WNU B;  3D5O A;  1WLW A;  3IT8 A;  5FUN A;  3VHP A;  1VR3 A;  3IZO A;  1W04 A;  1UY4 A;  4DY3 A;  4A41 A;  1DU3 D;  3QLQ A;  4KCB A;  4KWJ A;  4LR4 A;  1RUG 3;  4KGQ A;  4D3W A;  5GZG A;  1YO8 A;  5F8P A;  2GMM A;  3ZYB A;  5LEK A;  1RUJ 1;  5F3E A;  4GMP 0;  3BOW A;  3KM5 A;  3UET A;  1G6N A;  1ACC A;  4Q1P A;  4A42 A;  5JI9 A;  4Q4X 2;  4NID A;  3JU9 A;  1WMD A;  5FYV A;  3OG2 A;  1C8M 1;  3WXP A;  4E8C A;  5C9A C;  4HVR A;  3UYJ A;  2JG9 A;  5F3G A;  3AMN A;  4U36 A;  5FZ0 A;  4O9G A;  3WQ7 A;  1OQE A;  2JDN A;  3PLQ A;  5FPA A;  3DPR C;  1LHN A;  4ISQ A;  1MZE A;  2WAA A;  2VZU A;  3W9A A;  3AKF A;  1CAV B;  1IS4 A;  1NCQ C;  3VBR B;  4AG4 A;  5FWJ A;  1QJU 1;  1J84 A;  4NAM A;  3OBR A;  3EHK A;  4O7X A;  4XVH A;  1Q3E A;  1O4Z A;  5A3N A;  2BVV A;  2OZ6 A;  4AVB A;  1XYN A;  5C5U A;  5J3U A;  1OYG A;  1RUH 2;  3ZXL A;  1FAT A;  4UFL A;  4L0P A;  4PBO A;  4A4A A;  2GC3 A;  4FI9 A;  1AX0 A;  2JIJ A;  4B8E A;  3ATG A;  2B8M A;  1YC6 1;  1ZA7 A;  3ACL A;  4YNI A;  5LY2 A;  1PO2 2;  2QZ2 A;  1K3I A;  2WQZ C;  1QMJ A;  4AR2 A;  4QGL A;  2VU9 A;  3NST A;  3POF A;  2IXL A;  3MF6 A;  1QEX A;  4BCU A;  1GOG A;  3RGB A;  1GIC A;  2FHR A;  4BU2 A;  4AED B;  1AXK A;  4XHX A;  3LEK A;  4YG6 A;  2YXS A;  1ND3 C;  2BGC A;  2Q1Z B;  1HXS 2;  4Y20 B;  3ZSM A;  2A5Z A;  2ZKN A;  3FE5 A;  4LBQ D;  3MIE A;  5C70 A;  1EP0 A;  2FCU A;  3OY8 B;  5DAW A;  4A6O A;  2V09 A;  1BMV 2;  4UDI A;  3OM7 A;  3CZU A;  2Y6J A;  4RHV 2;  1KXG A;  1FMD 3;  2VW1 A;  1HW5 A;  4XUR A;  5DZE A;  5F9T A;  2D43 A;  1AXY A;  4O9E A;  4K7J A;  2YB7 A;  3CQO A;  3B3Q E;  4E8D A;  5E88 A;  2PLV 2;  4LBJ A;  1PMI A;  2GME A;  3T1L A;  3VHR A;  4YW3 A;  3D5Y A;  1U0A A;  1UY0 A;  1OPM A;  4FPF A;  4RFT 0;  4CE8 A;  2GC1 A;  4HAN A;  4OFG A;  5CNA A;  3FHA A;  5C33 A;  3ZYI B;  3WF3 A;  4GH4 A;  3W58 A;  5IAX A;  5AC9 3;  4D6Q A;  3ETQ A;  4MUV A;  4ES8 A;  2ZBJ A;  1EAH 3;  3TRS B;  1IGO A;  3WQ0 A;  5E8A A;  3LCP A;  4Q4W 3;  2ZGQ A;  3HN1 A;  5FP4 A;  3LKJ A;  3PJY A;  1XOY A;  1X7N A;  2VQT A;  4YPJ A;  2ZZJ A;  4LOT A;  3F95 A;  3UK9 A;  4RGA A;  5KHH A;  3SH4 A;  5FYH A;  1SLC A;  4AK7 A;  1HXS 3;  1NCQ A;  1SLI A;  1QQP 3;  3AL5 A;  2BPA 2;  1C8M 3;  3AKQ A;  4QB2 A;  2IXC A;  2F4P A;  5DG1 A;  2QQP A;  4A45 A;  1WW7 A;  1V9U 2;  3J8F 3;  5A3O A;  2Y60 A;  3C7H A;  4AFC A;  4Q4V 2;  2VJX A;  3VZL A;  3PUH A;  2JDH A;  5CKQ A;  1KD7 A;  2RE9 A;  4NHM A;  1S0C A;  5JXH A;  2FBE A;  4A3Z A;  3VHN A;  2HBU A;  2WQ8 A;  1CAX B;  1BBT 3;  3R4Z A;  3TWI A;  3WF1 A;  5C9A A;  2WNV B;  3CF6 E;  5A7N A;  1AL0 G;  2P37 A;  5F5A A;  3DEM A;  5JAX A;  1Q8S A;  5FMB A;  3RSJ A;  5AYE A;  2VVE A;  1H1M A;  3VSR A;  1WME A;  3FFQ A;  5IFT A;  1UZ0 A;  2ZZQ A;  3HVD A;  4WVM A;  3WIN E;  2QE3 A;  1OH3 A;  4QQL A;  3W21 A;  3LD8 A;  2FCT A;  3KV6 A;  4D69 A;  4LKF A;  5T5J A;  1W0O A;  4A7Z A;  4DXT A;  3OTF A;  4IND A;  4GWM A;  1HJF A;  4D7T A;  4DFS A;  5L7O B;  1UKG A;  2BZD A;  3WPV A;  4BYY A;  2VME A;  4YGB A;  3CDZ B;  2Q8O A;  2BWA A;  4QPG C;  1RUO A;  2WYS A;  3V0A B;  4Y22 B;  1W39 A;  3IWZ A;  4TTG A;  1G9B A;  1X36 A;  1WMX A;  3K4D A;  1RUE 1;  2P6H A;  1UX6 A;  5JSP A;  2E7T A;  1XBF A;  1JU4 A;  4DUV A;  2ZMN A;  5EV7 A;  3FJS A;  4R8H A;  5C71 A;  3AKI A;  2P3Y A;  2R06 2;  2JDA A;  1V6M A;  5LRS A;  1FYU A;  4QQ2 A;  2G9G A;  4FOV A;  1RIR A;  4XAC A;  4TXW A;  2GNM A;  1JHN A;  4HK9 A;  4P9W A;  2OKX A;  2XQX A;  3WSO A;  1JYC A;  3BKZ A;  2RV9 A;  2A6X A;  1R08 1;  4LO6 B;  2BU9 A;  1KQR A;  3IDB B;  3QD6 A;  2EVX A;  2W46 A;  4WBB A;  4K20 A;  4LBN A;  4TYS A;  1V9U 1;  5DUX A;  1QJX 3;  2OQ6 A;  4LT5 A;  5F2S A;  3POJ A;  4E4D X;  1DQ1 A;  2WL1 A;  4FO9 A;  3SH5 A;  1CZT A;  3PU8 A;  4D7Y A;  1NCR C;  3PUQ A;  1MEC 3;  1N1Y A;  1PT2 A;  2XWB B;  3S7E A;  3AL6 A;  5BV6 A;  1N47 A;  1SLA A;  2RR1 3;  4FP2 A;  1YJL A;  2WZR 3;  4Y1V A;  3A21 A;  5B2G B;  5D8A C;  5C3S A;  4YZ2 A;  2QQL A;  1W8U A;  3C7O A;  3VBS A;  1LB2 A;  3FLT A;  4QM8 A;  3UGF A;  1XNC A;  5IAT A;  2ENR A;  4X6Q B;  2XPJ A;  2DTW A;  4XJZ A;  3K75 B;  2P3J A;  1T6G C;  4Q4Y 2;  3O0V A;  5J1X A;  2CY6 A;  5HCH A;  2GH8 A;  4QDS A;  2QZ3 A;  4UXA A;  4YVS B;  3D61 A;  2GNB A;  4I09 A;  1O3S A;  1OF3 A;  3CHX A;  1RUG 2;  2JG8 B;  5JZG A;  1D2S A;  1PGW 2;  3RNS A;  1WD4 A;  1RC6 A;  4NRM A;  5FPU A;  4BXF A;  3M8L A;  1V6N A;  4C90 A;  2IXJ A;  2QQN A;  3USS A;  2WNO A;  2VZT A;  5FLW A;  3BVC A;  1XNT A;  3D0J A;  1VBA 1;  4AAP A;  2VTF A;  1IKQ A;  3BOP A;  4AEJ A;  5FZM A;  1ZRC A;  1QDC A;  2HWF 1;  2IXH A;  3HQU A;  1DZT A;  2RDQ A;  3POY A;  2XDV A;  5T52 A;  2D6P A;  1ZNP A;  5FBJ A;  3VBU A;  3H3U A;  5A3W A;  3WNL A;  1KDM A;  1US3 A;  4I02 A;  3FHQ A;  4N7U A;  1X9T A;  4DUW A;  4Y20 A;  4CCE A;  1JYW A;  1JUH A;  3WW4 A;  5LCW L;  2D98 A;  1SBF A;  2V4A A;  4GH4 B;  3LFM A;  4ONZ A;  3FN9 A;  1NA1 C;  1KRI A;  3K3O A;  5F32 A;  3OGG A;  2HWC 1;  5IAV A;  4BQW A;  2VVF A;  1CVN A;  1JH5 A;  2VQU A;  3OJB A;  4P02 B;  3BYW A;  5FJK A;  3P3P A;  1FNY A;  1W18 A;  4WM8 B;  1BKZ A;  1WA6 X;  2A7A A;  5HCF A;  2CSG A;  2EIB A;  1VBE 2;  4AAX A;  4DB5 A;  3I3D A;  1BXH A;  1R08 3;  2XJS A;  1TME 1;  3LGR A;  4NVP A;  3OEB A;  2H0V A;  5EHD A;  1WMF A;  1BQP A;  2A3Y A;  3OY8 A;  5JI7 A;  1D2Q A;  3HT2 A;  3K51 A;  5LK7 B;  4OHW A;  2DDU A;  4RS5 A;  1WD3 A;  5CB7 A;  1ZRF A;  2DUR A;  4FFH A;  2ERF A;  3AP5 A;  4YVW B;  1QJU 3;  3VL9 A;  2ZHK A;  3VZK A;  1FX5 A;  2R32 A;  5CIS A;  2ZAC A;  4QMA A;  4GA9 A;  4HKW A;  5CKM A;  5H9S A;  1VE0 A;  4RHV 3;  2XG3 A;  5H9P A;  2ZEY A;  2ZGR A;  3DKQ A;  5FAX A;  1W2A X;  5KHG A;  3O12 A;  1G7Y A;  2VZS A;  2XBO 3;  2ZOE B;  3BTA A;  1DGR N;  3HMY A;  4QD2 A;  4CUC A;  1JZ3 A;  2QQI A;  1UWW A;  5BNO C;  4Q4Y 3;  2P3K A;  3WP4 A;  4FTE A;  3EO6 A;  4D8M A;  3H7J A;  3IM0 A;  5GJ6 A;  4BQX A;  4GD4 A;  1Y9Q A;  5KHI A;  4N9I A;  4IV3 B;  4XTP A;  3ZN4 A;  2XVK A;  2AEZ A;  1FPN 2;  2Z69 A;  4I01 A;  1PNG A;  4CVU A;  1VBA 2;  5IFP A;  4N53 A;  2QQW A;  4K1Z A;  1I3H A;  2HWF 2;  3JD7 3;  4W6Y A;  1DGR A;  2LAL A;  4CXY A;  2ET1 A;  1VRH 1;  4XTM A;  4CEW A;  1SPP A;  4UFK A;  3KQR A;  4N90 A;  2P4E A;  3AYA A;  3UES A;  1PO1 3;  2XLF A;  3HPN A;  3ZFF A;  1ODM A;  1Q8Q A;  2PHD A;  2WYF A;  2JG9 C;  4CCL A;  4D0Q A;  5C3R A;  1CJP A;  3DPR A;  3TOJ A;  2W3J A;  4XOG A;  5L9V A;  3VV1 A;  1IPJ A;  2W1W A;  1SCR A;  4L9B A;  5IJR A;  3K48 A;  5LA9 A;  2UWA A;  1VBC 2;  1CX4 A;  2OVU A;  3IAP A;  5LA1 A;  5ACA 2;  3UV9 A;  4CDU B;  4N4B A;  4YM3 A;  1W8W A;  4COW A;  1MVE A;  4RN5 A;  2BBV A;  4AEK A;  3SNM A;  2BFU S;  2I2S A;  1PIV 2;  4RSU A;  3ZYH A;  1LGN A;  4XEZ A;  3GXU A;  5IK4 A;  3MZH A;  1KS5 A;  2ORX A;  1LHU A;  4IEV A;  3WOG A;  2K0G A;  3I2H A;  3VD4 A;  2Q1F A;  3E6B A;  4XMA A;  2QQU A;  4GB3 2;  4BM8 A;  2JD9 A;  4JRL A;  4AQS A;  5CFD A;  2ADE A;  5BUV A;  1SEF A;  5FYB A;  2GAU A;  3EXU A;  3MI8 A;  5IYY A;  3WY6 A;  2XJT A;  3VL8 A;  2D3R A;  5FY5 A;  2A6W A;  1RVF 2;  4MLO A;  4WZF A;  2QDN A;  4QX3 A;  4ZPI A;  1AR6 2;  1O4T A;  5FYM A;  4JTN A;  2J1U A;  4XE9 A;  1IG0 A;  1U5I A;  2Y33 A;  4OI2 A;  4Q8L A;  5FYI A;  3NNF A;  3O1P A;  5GLM A;  1AZD A;  1OFS A;  1NA1 B;  3LAG A;  1TEI A;  4GZ9 A;  3GNE A;  4U2A A;  3V0A A;  4XFF A;  2H6C A;  1XXN A;  1OOP A;  4P14 A;  3E6D A;  1TG7 A;  1DYO A;  5FPV A;  5A80 A;  2PXJ A;  3FHI B;  2Y6K A;  3AKR A;  4NUB A;  2FDH A;  4GXL A;  2NPI A;  2LRO A;  3ZXE A;  3THT A;  2ZCW A;  3AZZ A;  1RMU 2;  3MEP A;  4IQP A;  1HRV 3;  1RHI 1;  1VRH 2;  4ZU7 A;  1HB4 A;  2B9V A;  2HWD 1;  2R6Q A;  3THC A;  4NIH A;  5FZI A;  3T2O A;  3LE0 A;  3KV4 A;  3UL2 A;  1NUK A;  1NE4 A;  4IET A;  1URX A;  4C8D A;  2VZQ A;  3APB A;  4XHB A;  3ZIW A;  4XF3 A;  5CU1 A;  4AED C;  2QCS B;  1GZW A;  1AHS A;  2RM2 3;  2ZAH A;  4IDZ A;  1JYN A;  2JD4 A;  3L9J T;  1LNS A;  1PO1 2;  4OHV A;  4U6B A;  2F6B A;  1HX6 A;  3X29 B;  4W50 A;  2WT0 A;  4CEW B;  1GYE B;  3ACI A;  3AZV A;  3AZX A;  4AI0 A;  5AYC A;  2WNV A;  1FI2 A;  1Z7S 2;  2WIN B;  1YHF A;  1O3Q A;  4K6B A;  3ASI A;  3AC0 A;  1AR8 1;  4NII A;  1J3R A;  2XON A;  5EYY A;  5IK7 A;  1GYD B;  2WNU A;  5T3N A;  1LOF A;  4Q4V 3;  4YZ5 A;  4M3C F;  1VJ2 A;  1X82 A;  4L11 A;  4CP2 A;  2QFE A;  4IV3 A;  2BTV C;  2MNG A;  4H7M A;  1VMJ A;  3CLP A;  4X6R B;  3VN4 A;  4LO8 A;  3SKJ E;  4CDX C;  4P9X A;  5JUV A;  4ERO A;  1VIW B;  2JX9 A;  2YDE A;  3VT0 A;  5LWB A;  5HXV A;  1PK6 A;  5GLV A;  4KG0 A;  1JYX A;  3WMZ A;  1VBD 1;  1W28 A;  1YUD A;  4M3C E;  5BNO B;  4UF0 B;  1UYX A;  1CPN A;  1VRH 3;  2B39 A;  1W6O B;  4MAD A;  1DLC A;  3IMN A;  3ME2 A;  4DO0 A;  3MYX A;  4LE3 A;  4FBF A;  5IHR A;  4OHY A;  4UFI A;  5B4N A;  3USU A;  4LBM A;  2V5D A;  4LHN A;  3LDK A;  4M4R A;  1VP6 A;  1WWY A;  3KT7 A;  4Y1U A;  1X8M A;  3URF A;  3MIF A;  3VBO A;  1VAK A;  5JLV A;  4P5H A;  5BY5 A;  4V2W A;  2R16 A;  4OHZ A;  1E5R A;  5GLR A;  2IFR A;  5A7O A;  1VBB 1;  1PNF A;  1WCQ A;  3AM2 A;  4FP3 A;  1N3O A;  1MZF A;  2A3X A;  1FNZ A;  4UYB A;  1H9P A;  3J7M A;  1E5I A;  1LOC A;  4GAL A;  3VB9 A;  1H8V A;  2N7G A;  3CJI C;  1RUF 1;  5BNP A;  4P9I A;  4PT6 A;  3RI9 A;  4Z2A A;  4FCA A;  5FQ0 A;  1QF3 A;  2Q8C A;  1IQA A;  4O8P A;  1CES A;  4N8M A;  4PDW B;  5CG9 A;  2GN7 A;  1YNA A;  3OYW B;  5C8W A;  1CAW A;  1K5M C;  1UOB A;  1YFY A;  2VDT A;  5C4W B;  3ZYG A;  1COV 2;  1VBA 3;  1SDD B;  2I45 A;  2OUJ A;  4QKF A;  5DQ0 A;  2R04 3;  5JXI A;  5H9Q A;  4R9A A;  4LOS A;  3ZR6 A;  4AK3 A;  3QH6 A;  3TBD A;  3AX4 A;  2AUY A;  3N35 A;  5FPZ A;  4EN0 A;  1N1V A;  4R9C A;  4SLI A;  5KXB A;  3TN9 2;  1LES A;  1R09 3;  4LK7 A;  3BIW E;  3PUI A;  3RI8 A;  1QHD A;  3G7D A;  3K77 A;  3CO2 A;  1B35 C;  4IV1 A;  4Q27 A;  3WDX A;  2X5I A;  5A1F A;  2P3I A;  1UZZ A;  3U4X A;  2R06 3;  1H1A A;  1QQP 1;  1DYP A;  1K45 A;  4I0A A;  3VUO A;  2VD7 A;  1ZZ9 A;  3LIG A;  5E89 A;  2EXJ A;  3TAY A;  3ZXJ A;  4F83 A;  1DGL A;  2W0X A;  1L7L A;  1EAH 1;  2VZR A;  1YQ6 A;  2BDR A;  2VNR A;  2VTX A;  2GND A;  2XR4 A;  1OC1 A;  3JQX A;  2CNA A;  3ZMO A;  5LK5 A;  2B5H A;  2WAO A;  4Q4W 1;  1J58 A;  3ZXF A;  1JOD A;  1CPM A;  1RUJ 3;  1UF2 C;  3MW2 A;  4FSJ A;  5GLZ A;  1CR7 A;  5FRA A;  2VL4 A;  5FXV A;  1QKQ A;  4JGZ A;  2ZHN A;  1FT9 A;  1NOV A;  1Q43 A;  5DAP A;  3WDT A;  2XGX A;  5DDJ 2;  4W4Z A;  1LOB A;  2ZGT A;  5KC5 A;  2RR1 2;  4FPH A;  2A73 B;  5FY0 A;  2HYX A;  2B42 B;  3KMH A;  2ETE A;  2VC9 A;  3O0W A;  5FPB A;  4AHW A;  2JDM A;  3J8F 1;  2DFC A;  4BIO A;  3NV2 A;  2JB4 A;  5GM0 A;  4J25 A;  3W5N A;  2J1E A;  2LS6 A;  1SPP B;  2JEN A;  1V6I A;  3ITQ A;  3ZSK A;  4WM7 B;  3DXU A;  3RZZ A;  2ZGN A;  5FZB A;  3ZYJ B;  1OHF A;  4YM2 A;  4ZXK A;  1GZT A;  3CNA A;  5FO7 B;  1H2L A;  1YFX A;  1WLD A;  2DTY A;  2RS1 2;  2XHK A;  3P3N A;  4R4Z A;  4Y33 A;  2XXZ A;  4CP1 A;  4YVW C;  5K8S A;  1HKD A;  3ROU A;  4OMC A;  3LDB A;  4FVV A;  4JZR A;  1C57 A;  4BQ1 A;  4DQA A;  4IGP A;  1AUY A;  3LPG A;  1DBN A;  1AR9 1;  1JN2 P;  5A7Q A;  3MLJ A;  1R1A 2;  2Y6H A;  5JDB A;  1SDW A;  2VW2 A;  2WN3 A;  1YIF A;  4OUE A;  1QDO A;  4KBZ A;  5C3O A;  2B46 X;  3ZOI A;  4P5Y A;  1IG3 A;  4XFH A;  1JW6 A;  1ENQ A;  1VB2 A;  4UW3 A;  1WZX A;  5I91 A;  5JWP A;  4QGN A;  2JKX A;  1MS9 A;  4KMQ A;  1VBE 3;  1QXP A;  4D94 A;  4AOC A;  4M0N A;  3RMX A;  4QQS A;  2LTN A;  2W5F A;  5DMY A;  1W9Y A;  3B94 A;  4R9D A;  5FMO S;  1DQ0 A;  3ZYP A;  3BYN A;  1DQ4 A;  1EAH 2;  2D5H A;  2WRA A;  4CU6 A;  2EXH A;  1LR5 A;  2ARC A;  3V56 A;  2WZ8 A;  4P9J A;  1H4H A;  1K5M A;  1QY4 A;  4HK8 A;  3RYP A;  1RMU 3;  1EY2 A;  2VCA A;  2PHW A;  4HOO A;  4JKK A;  3ZFF C;  3T2Q A;  4BE3 A;  1H8T B;  4JX0 A;  4URT A;  2WFF 1;  2VZO A;  1XU1 A;  1ZM1 A;  4JHT A;  5BNN A;  4CDW C;  4CCO A;  1A6C A;  2YZ4 A;  3E5X A;  2VZP A;  3VDC A;  4K1Y A;  5BXX A;  5DUU A;  4N2Z A;  1XPW A;  4H3W A;  5AFE A;  4RD7 A;  5BPX A;  3SCG A;  4OUM A;  1UY2 A;  2WAB A;  3NNJ A;  5FBZ A;  4CDU C;  4XF4 A;  3F2Z A;  3VBU C;  1ZBA 1;  2VUD A;  5FZ7 A;  1UY1 A;  1UMH A;  1NXD 1;  2WII B;  1JZ7 A;  4Y1Z A;  2JEM A;  4PQQ A;  1NKG A;  4ZXE A;  1OLM A;  3POI A;  2RS1 1;  3ILF A;  3OGR A;  2PHF A;  3NO8 A;  4HBN A;  4YM1 A;  5JVV A;  3TYJ A;  4XJ8 A;  3NL1 A;  3VBF B;  1KJL A;  2ILM A;  3S6P A;  5K9Y A;  3ELN A;  4EN6 B;  1ZX5 A;  3VDD B;  2JE9 A;  3PTY A;  3OM2 A;  3GBF A;  4DY5 A;  3BAL A;  3OD4 A;  1AR9 2;  2E31 A;  3GGL A;  4UFM A;  5FMD A;  4CRQ A;  3ZYF A;  3TAW A;  1TMF 1;  3PVO A;  5A1A A;  4IE5 A;  2DCK A;  4W65 A;  4XCB A;  1W8F A;  2WNE A;  2ZGL A;  3E97 A;  3KCX A;  4PLO A;  4AFB A;  4E9K A;  2VMG A;  3RWK X;  4LHK A;  5A1L A;  5FP7 A;  4H2A A;  3THD A;  5LA0 A;  2NMO A;  4HFS A;  3WEZ A;  5ANQ A;  4CCC A;  1SLB A;  4I0W B;  3VBS B;  3GF6 A;  4QXH A;  4BQ2 A;  4XIO A;  1X9P A;  3H9A A;  3N7J A;  2AYH A;  1ASJ 3;  2GDF A;  4MOA A;  2UUR A;  4AK6 A;  1GMM A;  4AVT A;  3H0O A;  1IQD C;  3VSZ A;  2WWS A;  4YWA A;  2X10 A;  4AXO A;  3T1M A;  2QQK A;  4I3G A;  1LHO A;  1AX1 A;  1SLT A;  2A75 A;  4IGO A;  1TZO A;  2VGD A;  1GFF 2;  5FZG A;  1OSG A;  4BQ3 A;  3LEI A;  5CIR A;  3WX5 A;  1PVC 3;  2RMU 1;  2G9Z A;  4NO4 A;  4L8Q A;  2GP5 A;  3GJA A;  2C9A A;  3VZJ A;  5I8Y A;  5GLK A;  4LBQ A;  1GZ9 A;  2JIC A;  4ZY9 A;  5A7S A;  3VBH B;  2PHX A;  3WP5 A;  4AED A;  4FPG A;  4CDW A;  2TEP A;  2BVB A;  5ABJ B;  2YU2 A;  3ZSJ A;  4M3C A;  5A3P A;  4DIN B;  1Q8P A;  5C8C C;  3VLB B;  2ZXQ A;  2HJI A;  1GBG A;  4DEV A;  1C8M 2;  3B5L B;  3OYW A;  3PHM A;  4XUT A;  5F6K A;  3WNP A;  4YZ1 A;  5LB6 A;  3UJO A;  4CU8 A;  3I97 A;  3IB3 A;  1BEV 2;  3SIT A;  2YC0 A;  5C0P A;  2C5D A;  3E1F 1;  5FZO A;  3B9C A;  3T4H B;  1W8H A;  3UNP A;  2VM9 A;  3POE A;  1GR3 A;  4IES A;  2RM2 2;  5DG2 A;  3RZH A;  1LEM A;  1YJK A;  2ZAB A;  4QHZ A;  3VKO A;  3WW3 A;  5FV3 A;  1CZV A;  2Y6L A;  3ILN A;  3KVA A;  2ARX A;  2TBV A;  1VRB A;  3FWE A;  3GBG A;  4RR3 C;  4YLZ A;  1FAY A;  1HN0 A;  4OMD A;  2JG8 A;  1POV 0;  3KD4 A;  2YBS A;  5SV8 A;  5ACA 3;  5LEJ A;  1TNF A;  4LE4 A;  1M4W A;  3JB4 C;  1GP6 A;  3ON7 A;  3H8O A;  3ZSL A;  5LAS A;  3OGS A;  2WO1 A;  4QPI A;  2AAC A;  1NCR A;  3LIH A;  4XET A;  4Q0Q A;  4XXA A;  5CZK A;  1ENR A;  1H8T C;  3I59 B;  3BTZ A;  2WFF 3;  3AKH A;  5AY9 A;  2VTX J;  3M70 A;  1UAI A;  2W91 A;  3H3Z A;  5F6L B;  4HVQ A;  3V0B A;  1QXR A;  4AQT A;  3H1W A;  3U11 A;  4AL9 A;  2VY0 A;  3ZFE B;  3NJY A;  3VKN A;  4Q5O A;  3ZXD A;  3WF4 A;  4ZU4 A;  3S5A A;  3VZM A;  4NIG A;  4BQY A;  1PM7 A;  2YPJ A;  5G05 L;  3FL7 A;  3RG0 A;  4FPE A;  1Y43 B;  3O1U A;  1QNW A;  2C6S A;  2FQP A;  3H8R A;  3RZK A;  1GV9 A;  3JCI A;  1IS6 A;  2QNK A;  1OH4 A;  2DF7 A;  2YYO A;  4JKL A;  5FWE A;  3WG3 A;  4YGC A;  5DZF A;  5FYS A;  2DVA A;  1N3Q A;  1PMH X;  2OXB A;  4W6X A;  4BOW A;  2ZX2 A;  4QHO A;  2YU1 A;  5JOY A;  3T0B A;  2D40 A;  3GCX A;  1LGC A;  1JZ4 A;  2CDP A;  5JZG C;  4IE6 A;  5A3U A;  3MV0 1;  4AQ6 A;  3N4M A;  4XJ9 A;  3PVB B;  3WG4 A;  4BDV B;  5FXW A;  3IDC B;  4LTA A;  2RHP A;  5CFC B;  4QPI B;  4JDO A;  1Y3T A;  4XF1 A;  1D4V B;  1XE0 A;  4XIK A;  3W5M A;  3JXS A;  5HBA A;  4NRQ A;  4DUX A;  2J1T A;  2VUA A;  5DUV A;  4UI9 L;  5EWS A;  4NHK A;  3WUD A;  2EAL A;  1DZR A;  1SMV A;  1K12 A;  4DIQ A;  4Z92 B;  1GKB A;  3O1M A;  2GSY A;  1RUD 1;  3DL3 A;  3M3C A;  4E4Z A;  5SV5 A;  5FZL A;  5FPL A;  3ACG A;  1UMZ A;  2XOM A;  5LZ6 A;  1UU6 A;  3H3L A;  5FZH A;  1LEN A;  1ZRR A;  1FV3 A;  1O7F A;  2XL7 A;  1J3Q A;  1TL2 A;  2C24 A;  4MXV A;  2IWG B;  5L9R A;  2VBP A;  2WDB A;  2WFP A;  5B6T A;  5J09 A;  4AFA A;  2W2I A;  1OUX A;  1NE6 A;  4YZ4 A;  1JTZ X;  1MS8 A;  2YFZ A;  1MQT A;  1C28 A;  3SQO A;  1SHW B;  3KF5 A;  4DPN A;  3VDB A;  2QKD A;  2WWU A;  3FBY A;  1S1A A;  4QX2 A;  4AVC A;  5ABJ A;  3HNY M;  3R4Y A;  2K9Z A;  1VKD A;  3VD3 A;  4DOU A;  1EPZ A;  2BV4 A;  4HET A;  5ACA 1;  1JHJ A;  5EP9 A;  1EUU A;  1DG6 A;  3KB5 A;  2G4I A;  1MS5 A;  3DYM A;  3SCH A;  2VZ3 A;  1W90 A;  1W2O A;  3ES4 A;  2Z5W A;  3D0S A;  5FZ9 A;  3D5Z A;  3Q8A A;  3S57 A;  4C1W A;  2OPW A;  2HBT A;  4NPR A;  1WCU A;  2JXA A;  2X09 A;  1V0A A;  5FY4 A;  1Y4W A;  4B4P A;  1ENX A;  5HI0 A;  4UFJ A;  1OBN A;  2RG4 A;  3PL0 A;  1NXM A;  2AR6 A;  3D3A A;  5GLQ A;  3D6E A;  2JJ6 A;  4PIZ A;  1CIW A;  1RUI 3;  4AI8 A;  1ZBE 2;  2G1M A;  3AZW A;  2PEL A;  1QGL A;  3R4U A;  4IEY A;  4QQO A;  4Q2F A;  1S0J A;  4CCN A;  3I4I A;  4XDQ A;  2YC4 A;  3ZPY A;  5AVP A;  3PU3 A;  2Q0A A;  2VZ1 A;  4Y3O A;  1RUE 2;  1L7R A;  3WP6 A;  3WNX A;  2Y0I A;  1NLS A;  1QOT A;  3A0K A;  3D82 A;  3T2T A;  4UBH A;  2X8F A;  4YW5 A;  4M4P A;  4PVI A;  1YEW A;  4BPZ A;  1YIP A;  4AFD A;  3LSE A;  4CEY A;  1O8P A;  4N1I A;  5GZC A;  5JPM B;  1SQ4 A;  3S0M A;  4D47 A;  2WJS A;  1ODN A;  4NHY A;  4KH9 A;  2VOK A;  2Y0O A;  4PQ9 A;  1UOF A;  4L99 A;  1RJ8 A;  2C4X A;  4HN1 A;  2LM3 A;  2XHN A;  1SLL A;  1RHI 2;  1S0F A;  2L9L A;  3LF7 A;  4QQP A;  3RRD A;  3JD7 1;  4CDQ C;  5FRE A;  1O5U A;  5DUW A;  1CWP A;  5K0U C;  5A8C A;  2Y6G A;  3ENR A;  4P00 B;  2HWE 2;  2BWC A;  4WZC A;  1NZI A;  2JDY A;  3JQW A;  3AJZ A;  3DCQ A;  3W20 A;  4AGV A;  1EUT A;  1CQ9 A;  2ZGP A;  1QJX 1;  4CDW B;  5JOW A;  1C5I A;  1RED A;  2Y8K A;  1RUD 3;  2IXI A;  1GWK A;  4N43 C;  2OPK A;  4HKO A;  4AI1 A;  4AK5 A;  5GLO A;  4RS5 B;  3ZFG A;  4DEQ A;  3IDA A;  4DRR A;  3I3E A;  4WM8 C;  2XB6 C;  1ND2 C;  1IS3 A;  3BGA A;  2FDI A;  1W6N A;  4LEJ A;  2JEC A;  2PYT A;  4FPL A;  1PX4 A;  1PMJ X;  1F8V A;  4DNY A;  1UX7 A;  2D3S A;  2W08 A;  4BIS A;  4PLN A;  4MV2 A;  2YFR A;  1LU2 A;  1MS1 A;  1BEV 3;  1BZW A;  4WM7 C;  5FFO C;  2D6O X;  3KGZ A;  4PIX A;  2P2K A;  1HQL A;  1DYK A;  3CBN A;  1RUG 1;  2XJV A;  5FY8 A;  3ZN5 A;  1V6J A;  2GZW A;  4MH0 E;  2V4V A;  3LOI A;  1NLR A;  3M3E A;  4RGG A;  2ZEX A;  4JHZ A;  5KXE A;  3GYD A;  4ZU5 A;  2FDK A;  1DF0 A;  2ZGU A;  5GLL A;  1YXW A;  3B01 A;  2E32 A;  4EWD A;  2XBO 2;  2P6C A;  1D4M 2;  1R1Z A;  3J7L A;  3WDV A;  4UW5 A;  3WDU A;  1W05 A;  2W39 A;  4TSV A;  3WAS A;  4ZKT B;  1UNB A;  3DPR B;  1HDK A;  5DAX A;  4KWL A;  1GUI A;  1H9W A;  3GHM A;  3QCW A;  2ARE A;  4FFG A;  4HG6 B;  3VBS C;  3N3H A;  1DGW A;  3NJZ A;  4CUA A;  1US2 A;  2ZX0 A;  1JUI A;  1ZRD A;  2YFT A;  1PVC 1;  4XPV A;  3NMB A;  5FR3 A;  5D21 A;  5T55 A;  3MGU A;  2HWC 2;  4TN7 A;  4B4Q A;  3MFC A;  4COU A;  5GLP A;  3FUO A;  4FQZ A;  3WNO A;  5FDB A;  2CAV A;  1WLC A;  3TEZ A;  5C3Q A;  3NW4 A;  3PVN A;  2ZHM A;  2UY8 A;  4QXB A;  5CYY A;  1QJE A;  4QKB A;  5K0U A;  3HIF A;  4A44 A;  1OOP C;  5D8A B;  2RS3 2;  3J4U H;  4H14 A;  2VVD A;  5FK7 A;  2RJK A;  3BN6 A;  1MZ5 A;  1SFY A;  1YI7 A;  2GH2 A;  4MX3 A;  3PUR A;  3ACH A;  1S0E A;  4PI2 A;  4BK5 A;  4AF9 A;  2WS9 3;  2C26 A;  2CYF A;  2ZGM A;  1W6Q A;  2ET7 A;  1ULD A;  3NQH A;  1UD1 A;  2E6V A;  3OEA A;  3ORJ A;  1GSL A;  1XE8 A;  2YG0 A;  4D6R A;  1APN A;  4LO7 A;  1NZC A;  5A7W B;  5HCA A;  4V2V A;  1NCR B;  1KS4 A;  2WT2 A;  2BOI A;  5JSO A;  1LJ7 A;  1R09 2;  5HPO A;  1AYN 2;  3POS A;  1GYH A;  1RUC 1;  4XFA A;  1TVG A;  2BJS A;  4QX1 A;  3WCR A;  1XE7 A;  2A71 A;  1UXX X;  3KZ4 C;  5IVE A;  4XJW A;  3WW2 A;  4EWE A;  3TNQ A;  1PVX A;  2R04 2;  1RUH 3;  2YC2 A;  4S2F A;  2EIG A;  4XAA A;  4IV1 B;  2YBP A;  4GMP 3;  3CL1 A;  4XZP A;  3OBA A;  4PI0 A;  2R49 A;  2D6N A;  4XC9 A;  4LLO A;  4NN0 A;  5AC9 1;  5EQU A;  3LDR A;  1S55 A;  4B7K A;  3O0X A;  1YRZ A;  4HZF A;  5IUQ A;  4LKS A;  3ZFG B;  4RQP A;  3WUC A;  1PK6 C;  3M4F A;  4GH4 C;  4QX7 A;  2VG9 A;  2XKP A;  4AW7 A;  1CIY A;  1YFU A;  3GAL A;  3J8F 2;  4CDQ B;  5D2A A;  2WZR 2;  2WBK A;  1PVC 2;  3WPZ A;  4TLG A;  4NRP A;  5D1I A;  3LOB A;  1ULC A;  4OI4 A;  4RQP B;  4XFI A;  3U37 A;  5L7O A;  3KLS A;  4AVA A;  3AMM A;  4WM7 A;  1W0N A;  3AP6 A;  4TWT A;  4MGQ A;  4E4H A;  2AZ5 A;  4O8O A;  2ZA9 A;  2VBB A;  4ASM B;  1GAN A;  2WZE A;  5JSR A;  1ULP A;  1GOF A;  4MO3 M;  2Y38 A;  1W9F A;  5T54 A;  1GQG A;  2C0Z A;  4EWA A;  3FZ3 A;  1OQD A;  5EZW A;  2RS1 3;  1F2N A;  2YUE A;  4H7L A;  2VQ0 A;  3ZFE C;  5JZG B;  4NOV A;  5DDJ 3;  3OD0 A;  3MIH A;  2HWE 3;  4UWD A;  1A34 A;  4CYD A;  5GZF A;  3U0Z A;  2R0H A;  2PMW B;  3OUH A;  4F8A A;  4HL0 A;  1W6O A;  2D5F A;  4WVZ A;  2CWS A;  5CAD A;  5C2M A;  1ULG A;  1Q5O A;  1STM A;  3NNM A;  1H2N A;  2F17 A;  4AGG A;  4DS0 A;  2J1S A;  5TSW A;  3HQX A;  1DCS A;  1W6M B;  3KSC A;  2Y64 A;  2WO3 A;  4NIA A;  2VEC A;  3JUU A;  4KBB A;  3VDD A;  3QZ4 A;  1AX2 A;  2X8K A;  3A0N A;  1X33 A;  2JIG A;  2ZJC A;  1UV4 A;  1JZ2 A;  2Q30 A;  1Z0H A;  1G9F A;  5A7V A;  1NAE A;  1DLL A;  1BVP 1;  1V6L A;  1XJA A;  4XFG A;  5F7U A;  4IEZ A;  4LK6 A;  5F3I A;  5J98 B;  3O1O A;  3LEG A;  1VMH A;  4ZZ8 A;  3WR0 A;  2BW8 A;  3OPW A;  5A32 B;  4KMI A;  4OQ9 A;  4CPB D;  4ITC A;  2C9K A;  5JOZ A;  2W1U A;  5F1R A;  5E16 A;  2UWB A;  4QPG A;  1QIQ A;  1UPS A;  5HXM A;  2BNN A;  4NHX A;  2QQM A;  2PQS A;  3K4A A;  3VZN A;  1AL2 1;  1NY7 1;  3I3B A;  4OVE A;  3DKW A;  5LBC A;  3PNA A;  5LBB A;  1QOO A;  1I1E A;  1PO1 1;  3WZ1 A;  1GLH A;  1H8T A;  3MHZ A;  4DMI A;  1XYO A;  3V64 A;  4PDW C;  1NG0 A;  1MAC A;  3VGI A;  1ZRI A;  1TQ5 A;  4Y22 A;  2OII A;  3LA7 A;  2ES3 A;  1K42 A;  1AR7 2;  2O0O A;  2P1B A;  4LO5 B;  5FY9 A;  4LUM A;  1P8J A;  3ZM8 A;  4XMI A;  3ALQ A;  1ZZC A;  4YSF A;  2R30 A;  4YW2 A;  5JPN B;  3GCW A;  2HWB 3;  2XVG A;  3HWJ A;  1OFN A;  3DF0 A;  4C0H A;  3NV3 A;  1RUH 1;  1UPI A;  5T5P A;  4WVW A;  3USU B;  1T6B X;  3OM6 A;  3QEE A;  2EIE A;  1L7Q A;  1VMF A;  3ZO0 B;  3U1X A;  2V5Y A;  2O1Q A;  5EIY B;  2DYC A;  1TNR A;  3AFG A;  1W6P A;  2RS3 3;  5ABJ C;  1W6Q B;  3OPZ A;  1UIK A;  1PK6 B;  4HPK B;  3DV8 A;  1SZB A;  4NOT A;  5F2W A;  5I0S A;  2VPV A;  4LXL A;  4B7E A;  3MDP A;  4FPO B;  4E2Q A;  1CAX A;  2W94 A;  2IVJ A;  5D8A A;  2EIC A;  4QU2 A;  3ZIX A;  2J7M A;  5J7M A;  1BMV 1;  2E9Q A;  1ZZ8 A;  3SKV A;  4JAA A;  3TEW A;  2YHJ A;  3BPZ A;  2WNV C;  1WBL A;  4GUL A;  1C1L A;  2XUM A;  2CHH A;  3A23 A;  4COZ A;  1HB2 A;  1H1I A;  4XFC A;  1L3J A;  3IPV B;  1S2B A;  3VD5 A;  4AHY A;  2OYZ A;  3N36 A;  5FZC A;  1O8S A;  2ADD A;  2VW0 A;  1D4M 3;  1FMD 2;  3ZFE A;  1UZV A;  4WV8 A;  4ATE A;  2HKX A;  2KXL A;  5IVJ A;  3C7F A;  4Q8K A;  2RDS A;  1UL9 A;  4BHP A;  1PGS A;  1AL2 2;  1NY7 2;  2WC2 A;  3T3Y A;  1COV 1;  4COT A;  3WW1 A;  2B4W A;  4BZ4 A;  4IGQ A;  2Z4F A;  1BEV 1;  4LUL A;  3D60 A;  5IVF A;  3RS6 A;  5T5O A;  2BNM A;  4XDP A;  2VZV A;  3SMH A;  1TMF 3;  4ONU A;  4AGR A;  3GJB A;  1LOG A;  1V6O A;  2YMZ A;  4N53 B;  2RM2 1;  3VDD C;  4AYU A;  1OLR A;  1POV 3;  3CIH A;  1UYY A;  3JBG 1;  1AR7 1;  3SIS A;  3SCF A;  4CP0 A;  2JDP A;  2CU5 A;  2W68 A;  1S0B A;  3I3Q A;  3Q8E A;  1OI6 A;  2FDF A;  1LOD A;  2J1R A;  4K40 A;  4G9S B;  4C91 A;  1C1F A;  3ABZ A;  1W8N A;  1IPS A;  2VCB A;  4URA A;  4Q4V 1;  4JDN A;  4HVO A;  1UIJ A;  1EYB A;  2QJV A;  5A3M A;  4B3N A;  1ND2 B;  2DWR A;  3BU0 A;  1AYM 1;  3CJI A;  3HT1 A;  1W8O A;  4KWK A;  5BNP C;  4QXC A;  1JZ6 A;  4PVA A;  5A8D A;  4Q29 A;  2R06 1;  1OUS A;  4MGZ E;  4XJU A;  5CFD B;  4QKN A;  2OQ7 A;  3AVS A;  5FP9 A;  1QJY 3;  2E63 A;  1AL2 3;  1DZQ A;  5J96 B;  2MHF A;  3OB8 A;  1D0G A;  2XL9 A;  2Z79 A;  1NYW A;  2D97 A;  2VMF A;  1CN1 A;  4QB1 A;  1S0I A;  1O5L A;  4KWU A;  2R7E B;  3ILR A;  3CJI B;  5FMC A;  5HV4 A;  3NVC A;  2NLR A;  4CCD A;  2KA3 A;  2BUK A;  2BBA A;  2ZKL A;  4LKE A;  1J83 A;  2DBN A;  1D7P M;  2NP0 A;  1RXF A;  5F5Q A;  2VMD A;  4FPJ A;  3R6S A;  4KGG A;  5FZA A;  3I2O A;  1CD3 G;  3BTY A;  4O8N A;  1DQ5 A;  5C4W C;  5CG8 A;  5JXJ A;  1LHW A;  2W52 A;  2UY9 A;  4LLF A;  1F5F A;  2FMY A;  3THP A;  4AHX A;  3I2D A;  1ZZB A;  4BLI A;  1ND3 A;  3I2G A;  1HRI 3;  2WO2 A;  1PZ8 A;  4Q0S A;  3CU9 A;  4EZH A;  2E7A A;  2R07 1;  4GQ7 A;  5DAB A;  4FPC A;  1VAM A;  2FZ2 A;  4HKL A;  3K2O A;  4W6W A;  2XH6 A;  1KIT A;  4N43 A;  2E33 A;  4NRO A;  2TUN A;  4AI3 A;  1UU4 A;  5FXZ A;  1V00 A;  3Q8C A;  3HD8 B;  1R08 2;  1SBD A;  1S0G A;  2ZAA A;  1H2K A;  1HLC A;  3I2K A;  2QDR A;  2BGO A;  1LED A;  4E27 A;  3ZYR A;  4OI0 A;  4FOQ A;  1RUI 1;  3LB9 A;  1ALY A;  2CAU A;  4JQT A;  3ZSE A;  3MO4 A;  1NQD A;  2LRP A;  4LIV A;  4XQD A;  2KD7 A;  3O1S A;  1RGS A;  4YVS A;  5F5C A;  1H4G A;  3D4K A;  1CZS A;  5I93 A;  3UT0 A;  5FZ8 A;  1YLL A;  3C8X A;  4NR1 A;  1A3K A;  5JMO A;  3N9M A;  4UOJ A;  5APA A;  1NLQ A;  2ZEZ A;  4JC1 A;  3ZKY A;  3EJK A;  4XDO A;  4Y4R A;  5DZG A;  3V65 A;  3IDE A;  1PX3 A;  4XBN A;  1W9S A;  3ZXK A;  1HV1 A;  1HRI 2;  2WFF 2;  1LHV A;  1GZW B;  1S0D A;  3RZM A;  1OLM E;  1ZVF A;  2WLQ A;  2W9X A;  2W92 A;  3A7Q A;  2OX0 A;  3H8U A;  4LA2 A;  1LEC A;  2BER A;  5A3T A;  3JBG 3;  1MS0 A;  1T2X A;  3BPS A;  4Q1R A;  1DQ2 A;  1J1L A;  1SG3 A;  2DUP A;  5FP3 A;  5DAV A;  3U14 A;  1JMU B;  4FFF A;  3UGG A;  2ZX1 A;  4BH9 A;  2GC2 A;  2VQA A;  1R64 A;  4XUN A;  1HQN A;  4EN8 B;  1RIN A;  5CFC C;  1TME 2;  3WP3 A;  4MZU A;  2OT7 A;  2RDN A;  1UOJ A;  3MPP G;  3QBQ A;  4QX5 A;  1Y7B A;  4RGK A;  3HQR A;  3M3I A;  3T4V A;  2AEY A;  2DU1 A;  3ZX7 A;  3WPY A;  1W06 A;  2I74 A;  1Z78 A;  3VBU B;  3HAG A;  1Z7S 3;  1AR6 3;  3HJR A;  3POW A;  1O3T A;  1VAL A;  2FDJ A;  1RTV A;  5FYC A;  4HPK A;  2WZP P;  4BLJ A;  4EYU A;  1XNK A;  4LBL A;  4BIF A;  3S7I A;  2C1F A;  1G9D A;  5F3C A;  5G04 L;  5I0R A;  2WLP A;  1ST8 A;  3KS7 A;  3D8C A;  4AI9 A;  3WT3 A;  3VHO A;  2D93 A;  4M3C B;  3S5Q A;  4OHX A;  4UBG A;  4XW3 A;  3ZR5 A;  4B4R A;  2GMP A;  2Q5T A;  4XFB A;  3NAP B;  5KHJ A;  2EID A;  2DCT A;  3U75 A;  5C6C A;  2R1D A;  4CA9 A;  2R07 3;  1RUI 2;  2NM1 A;  1MQT C;  1FPN 1;  2XJP A;  2PAE A;  2PAM A;  4CUG A;  4FTB A;  4X8N A;  1AJO A;  2JB8 A;  3CZJ A;  1WCS A;  1YQ8 A;  1OA2 A;  1QJX 2;  4EJR A;  5I8T A;  2PQQ A;  3KHB A;  3L2H A;  1I9R A;  3AKT A;  3WV6 A;  1VBE 1;  2BOJ A;  3IKW A;  4UW4 A;  4CDU A;  4ARX A;  3LPF A;  1LOF C;  1RUF 3;  5KXC A;  5GLN A;  2IZW A;  4CXW A;  2RMU 2;  2DVD A;  2DVG A;  4UAP A;  1HRI 1;  2W95 A;  1BYH A;  2DFB A;  1OKQ A;  4ES9 A;  5BYN A;  4R9B A;  2KR2 A;  2BEO A;  2HWB 1;  4IEU A;  4QAW A;  3UKT A;  1DFQ A;  3GDB A;  2WO7 A;  4OZX A;  3FLR A;  1Y9G A;  1GNZ A;  4FOW A;  4J1X A;  1JS9 A;  3BIE A;  1ZRE A;  2E7Q A;  1KDK A;  1MPX A;  3MPB A;  4PBP A;  3GZA A;  1PIV 1;  2RS5 3;  2UU8 A;  1R1A 3;  2NQY A;  3ZMN A;  4A7K A;  5IVB A;  3C2U A;  5J36 A;  5A7V B;  4XJA A;  2BYV E;  1O4Y A;  4HSL A;  3AKS A;  1H0B A;  4GB3 1;  5FXX A;  5A6Q A;  5GAL A;  5FZO B;  1CAU A;  1LRH A;  1XRU A;  4CCK A;  4E2S A;  1HRV 2;  3LA3 A;  3RZJ A;  3KWV A;  1D4M 1;  3TN9 3;  3FFZ A;  5JR7 B;  2WT1 A;  4GKX A;  2VNG A;  1YI9 A;  2A6V A;  4GMP 1;  3PUA A;  3NV4 A;  5FYT A;  4PJY A;  1JZ5 A;  2WA3 A;  2WNU C;  1A8M A;  3JZV A;  4N43 B;  3PTR B;  1MS4 A;  1W0P A;  2A1X A;  1XQN A;  3SLI A;  1DP0 A;  1MEC 2;  2GAL A;  4IV3 C;  1OKO A;  3AP7 A;  4YFZ A;  5AFB A;  4FOY A;  1QH7 A;  4CCM A;  2EXK A;  1N1T A;  4XIL A;  3WVJ A;  2D3P A;  3EB7 A;  4PDW A;  4FAH A;  5C7G A;  1ND3 B;  4L97 A;  3I3M A;  1Q8O A;  1ZZ7 A;  2YV8 A;  2B4K A;  5FZE A;  4PHZ A;  4FPK A;  1WL7 A;  5L73 A;  4CSW A;  4WVM B;  2KM2 A;  2CTV A;  1RL3 A;  2NN8 A;  2VE1 A;  1C4R A;  5FY1 A;  4H55 A;  3J7N A;  4IEP A;  4A3X A;  1RUJ 2;  2BNO A;  4GWJ A;  4IV1 C;  2YPD A;  2RS5 2;  4OLL A;  2X5I C;  2JDK A;  2QQO A;  5E6H A;  5FZF A;  3UJQ A;  1F5J A;  4KC8 A;  1GP5 A;  4AVS A;  4QPY A;  3HOB A;  3PVE A;  4Q4X 1;  1B35 B;  1XND A;  3DGT A;  3P1I A;  3VBH C;  3WDY A;  1I5Z A;  4BWO A;  3VKF C;  1CX1 A;  3OUJ A;  4CDQ A;  3T30 A;  3WLU A;  1JOB A;  5FYY A;  1DGW X;  1S2E A;  4FXG B;  1JXN A;  4L92 A;  1W9W A;  4MXW A;  3FUQ A;  4NPM A;  3FLP A;  4O61 A;  3RZG A;  1W3X A;  4LBQ B;  4YG3 A;  2VAU A;  2O14 A;  1OD5 A;  1W9T A;  2VMC A;  4XUP A;  1IOA A;  1AYN 1;  1U12 A;  1O59 A;  4JGY B;  4N53 C;  4N2R A;  4G3Y C;  1AR8 3;  4IE4 A;  4OZO A;  3NJX A;  4IE0 A;  4YYO A;  4EN9 B;  4RA0 A;  2W87 A;  3III A;  5FOB B;  2YFS A;  3MIG A;  1BLZ A;  3N9O A;  4JVA A;  4ZS3 A;  1WCD J;  3LSD A;  3BU7 A;  1ND2 A;  4ARY A;  4QDR A;  4ZZ5 A;  5L19 A;  3NKT A;  4Y5T A;  4MET A;  2Z2S B;  1EV1 1;  3TEX A;  2PHU A;  1W8Z A;  4L2N A;  4K3U A;  4BME A;  1UU5 A;  1PO2 1;  1GP4 A;  2JE8 A;  5A33 A;  1G86 A;  1QJY 1;  3CKH A;  1Q8V A;  1CAV A;  2X05 A;  1REE A;  1SFN A;  1FOD 3;  3AYD A;  2EAK A;  4QX0 A;  2AGS A;  4LOR A;  2VH9 A;  2B7Y A;  2H0B A;  3AYE A;  4LKD A;  4LIT A;  1YQC A;  1D0H A;  2XKO A;  1RVF 3;  5EFU A;  4GWI A;  2DCZ A;  4CPB A;  2XQR A;  3RJ2 X;  4XBL A;  3I2I A;  3OGJ A;  5BNN B;  2GN3 A;  1J59 A;  4RHV 1;  1RYY A;  1XNB A;  4YM0 A;  4A6S A;  1SAC A;  1VBB 2;  1N3P A;  1UOG A;  1OVS A;  1K5M B;  2EAA A;  3AP9 A;  1FOD 2;  2VOX A;  3PIG A;  1PHM A;  4Q0P A;  3OM4 A;  1AJK A;  4TZD A;  1AR8 2;  1TME 3;  3BYK A;  4KC7 A;  1XC6 A;  2PLV 1;  1VPH A;  3R0R A;  4OUS A;  1PIV 3;  2IC1 A;  2RS5 1;  3MW3 A;  1W2N A;  2QQJ A;  3NJV A;  4CUB A;  2VNO A;  4RFR B;  1J3P A;  3IPV A;  3H42 B;  4ZS2 A;  4JRA A;  5FYZ A;  3SC7 X;  1CON A;  5CFD C;  4F3J A;  4CEW C;  2JDU A;  3M3O A;  1WBF A;  3KF3 A;  2O8O A;  5A70 A;  4FTS A;  3WHT A;  2XJR A;  2GNT A;  4IER A;  1XU2 A;  1VBB 3;  1HQW A;  2WS9 1;  4HON A;  2UWC A;  2R0F A;  4MLG A;  1RUN A;  1GWL A;  1HJG A;  1VBD 2;  1E5H A;  2WR9 A;  4UDG A;  2XML A;  1ULO A;  3OSD A;  1IS5 A;  3NWK A;  4CXX A;  3BI3 A;  4P9G A;  1V9U 3;  5A3L A;  3Q8B A;  4Q26 A;  2QQV A;  3GHN A;  1GWM A;  3KV9 A;  4Q4X 3;  1XSR A;  3R4D B;  2FDG A;  4HT1 T;  3WQ1 A;  4CU9 A;  4XF0 A;  4J6G A;  5CKN A;  1LUL A;  2B45 X;  5A6Y A;  4MG2 A;  3O14 A;  4HXC A;  2VBD A;  3UGH A;  3MF9 A;  1EV1 2;  3H7Y A;  3BOD A;  3E5U A;  4XF9 A;  3K1U A;  4COV A;  5CBL A;  2ZX3 A;  3IIA A;  1QJY 2;  4K21 A;  3IAQ A;  1E57 A;  1C5H A;  2NYY A;  2XWJ B;  1VBC 3;  1K5J A;  1RUF 2;  4YVS C;  1W2U A;  5FY7 A;  3H50 A;  3P2N A;  4XUQ A;  4LMF A;  4KG8 A;  3AXD A;  2JDZ A;  1YCI A;  4D6S A;  4JGZ B;  5T50 A;  1OT5 A;  5DDJ 1;  1GNY A;  5KWR A;  4QM9 A;  4AEM A;  1I5P A;  3U10 A;  3VBF C;  2IUW A;  5EJZ B;  3KQ4 B;  4EV0 A;  1FOD 1;  3HN3 A;  4YW1 A;  5K0U B;  5JIU A;  2PFW A;  3ZDS A;  4BB3 A;  4S2D A;  3O7O A;  3OGV A;  4GJZ A;  3WMY A;  1UYZ A;  5LRR A;  1RUE 3;  3AVR A;  2TNF A;  4I30 A;  3FC0 A;  4X8P A;  1WCK A;  1FPN 3;  1AR7 3;  1CAU B;  1RXG A;  2WKK A;  3ES1 A;  1V70 A;  1QQP 2;  1WLT A;  3BCW A;  3C3V A;  5J37 A;  4LBK A;  2RMU 3;  5L9B A;  4XBQ A;  1UN1 A;  2RDR A;  4LQR A;  3RPQ A;  1GYK A;  3TB0 A;  3OBT A;  4M00 A;  5LAT A;  1G9A A;  4YAR A;  1COV 3;  3AKP A;  2HWD 3;  3KHC A;  1JOJ A;  2CV6 A;  5ERL A;  4AWD A;  4JGY A;  3AMQ A;  4BMB A;  3ZN6 B;  4MGT A;  1CJD A;  2AC1 A;  4Q4W 2;  5FLJ A;  1F15 A;  3ACF A;  3ZLI A;  4GAZ A;  4P9Y A;  2PHL A;  1AXZ A;  4I2O A;  5F5I A;  4PF1 A;  5GLW A;  4S2G A;  2DVB A;  3T0D A;  1ASJ 2;  5FZ4 A;  4JCK A;  3LV4 A;  1HB1 A;  4C0B A;  1BHG A;  5F37 A;  2RR1 1;  3CJX A;  4MGY E;  2WWJ A;  5I8S A;  3OCP A;  2VXR A;  1NT0 A;  1QNY A;  3QAC A;  4QHB A;  5DN2 A;  3GZE A;  3B00 A;  4XAB A;  3ZFG C;  2VCM A;  2PLV 3;  2CWM A;  1LTE A;  1AR9 3;  1FMD 1;  1GQH A;  3N9N A;  2PAK A;  3DEC A;  1JOP A;  3KT4 A;  3O1R A;  4IXL A;  2AH2 A;  3DYO A;  1SCS A;  4NWV A;  2FZ1 A;  2D6L X;  4NAO A;  2ID4 A;  1A78 A;  1POQ A;  4PIY A;  4RR3 A;  4COY A;  2LW8 A;  3N9Q A;  4DRV A;  5FOJ B;  1XYP A;  5BNQ A;  1XNA A;  3POG A;  4MHR A;  4YRD A;  4Z07 A;  4WVV A;  1OD3 A;  2LUW A;  4Q4Y 1;  4RL7 A;  2ZGO A;  3J7H A;  5A7P A;  4B1L A;  5LW9 A;  1JZ8 A;  5I0U A;  4QXK A;  4U6D A;  2ZS6 B;  3NRU A;  2EXI A;  1JBC A;  1R1A 1;  2BRT A;  2OUH A;  2E51 A;  3JBG 2;  4IE7 A;  3K3N A;  4XAE A;  2G9F A;  1PGW 1;  4J1W A;  2VOV A;  1AVB A;  4GB3 3;  3SEE A;  2ZMK A;  1B09 A;  5KC6 A;  5GLU A;  1GZC A;  1OPO A;  2YRO A;  4B29 A;  5C5T A;  5DAQ A;  4HN0 A;  3RYK A;  4MSV A;  1KJR A;  5CVR A;  2OS2 A;  1QJU 2;  5FZ6 A;  4ORF A;  2VUC A;  5FO9 B;  2XJU A;  4YW7 A;  1PM4 A;  5H9R A;  4NJ4 A;  5C8C A;  3UKN A;  2YBK A;  3I2J A;  3ZXA C;  4C1X A;  3WD5 A;  4LO4 B;  4MYE A;  3M7A A;  2K46 A;  2P34 A;  3HBK A;  4YG0 A;  3RQ0 A;  4EN7 B;  3I7D A;  3VSF A;  3CMG A;  3VBR A;  2ZTN A;  1WW5 A;  4I3P A;  4IW3 A;  5FLI A;  5EJ3 A;  5CFC A;  1TMF 2;  3ZN6 A;  3RZL A;  3WN1 A;  2VMH A;  2ZEW A;  2P5B A;  1F9K A;  3UKV A;  3WF0 A;  5BNO A;  2A3W A;  4QPI C;  2VCC A;  2JG9 B;  2BGP A;  1M06 G;  3PJQ A;  1OXC A;  2QUO A;  2YGM A;  4ASL A;  1KFX L;  3SXW A;  4ATF A;  5LY1 A;  3QOP A;  1UZY A;  1BK1 A;  5IVV A;  3ZFF B;  1ZBA 3;  4BQ4 A;  2UYB A;  5FZK A;  4XUO A;  5LA2 A;  2AEN A;  5FO8 B;  5KXD A;  2XLG A;  4EE2 A;  3SEP A;  4AQ2 A;  2IVI B;  1U5Z A;  4A2U A;  3KGL A;  3MLK A;  4JGZ C;  1OOP B;  3VZO A;  4LHL A;  1EPW A;  2NZ9 A;  1AYN 3;  4QPW A;  3NV1 A;  1JYT A;  4Y5Z 0;  1PZ7 A;  2DV9 A;  3VKL A;  1WA4 A;  3OM5 A;  3MUZ 1;  2CGN A;  2J1A A;  4LPL A;  2ARA A;  4M0H A;  4V1P A;  3I49 A;  1ZZ6 A;  3MV1 1;  4ZHN A;  3V0B B;  1ENS A;  4YW6 A;  5JIA A;  4FFI A;  4Y24 A;  4XCA A;  5C3P A;  3VD7 A;  1W6P B;  4Z8B A;  3B02 A;  4QWN A;  4QQH A;  4OI1 A;  3BUC A;  5DXD A;  3PME A;  4KQ7 A;  1EV1 3;  1H2M A;  1BVV A;  2ZML A;  3DN7 A;  1DQ6 A;  3NNG A;  4YVW A;  1KFU L;  3BYL A;  5CA6 A;  1TE1 B;  1X8E A;  3AP4 A;  3TNP B;  2B9U A;  3IBM A;  3DYP A;  2Y34 A;  4ISR A;  4MGS A;  1YQ2 A;  3J26 N;  5L7O C;  1OUR A;  5FZD A;  4R52 A;  1OA4 A;  5B6S A;  2GP3 A;  1A8D A;  1RUC 3;  2VUL A;  3RWN A;  4QDQ A;  2SLI A;  2DUO A;  4CP9 A;  4ZON A;  2ZPX A;  2X8S A;  3VT1 A;  4UFH A;  4GWN A;  4Y1X A;  2ORZ A;  4DXZ A;  2CL2 A;  2VR4 A;  3FMG A;  3KVB A;  3MIC A;  3NNL A;  4Y4Y A;  1Y9M A;  4GKY A;  4JTO A;  4XQ4 A;  2RVA A;  5GLT A;  2X53 S;  5C9A B;  2WSU A;  2XUE A;  1CGP A;  1HV0 A;  3VBH A;  3GZT B;  4XZU G;  5A32 A;  1DDL A;  1UYP A;  3QED A;  3N9L A;  4RQP C;  4CZS A;  2P17 A;  3EYP A;  1MZ6 A;  2PHT A;  1X50 A;  2WSV A;  5LBF A;  3AKG A;  4FPY A;  1WKY A;  3KV5 A;  3W59 A;  3PIJ A;  3QC2 A;  3M2M A;  5L36 A;  4GIQ A;  4CU7 A;  1C8N A;  5DPN A;  1ZA4 A;  1H6Y A;  3R05 A;  1LOA A;  3KCC A;  1LGB A;  3GZU C;  4BXS V;  2EA7 A;  1MS3 A;  1ONA A;  3RYR A;  4OQ8 A;  2XJQ A;  2YGL A;  5IVY A;  3MID A;  5GZE A;  1WW4 A;  4UDJ A;  4PLM A;  4CDX B;  2ZGK A;  5BNN C;  5JOX A;  4K9S A;  5FPX A;  3T08 A;  4AI2 A;  1H30 A;  5HCB A;  4QT6 A;  5FKC A;  3MIB A;  4G4F A;  3ZKU A;  4HMZ A;  5IT6 A;  4W8J A;  2IXK A;  1BJQ A;  3LWC A;  3AMP A;  1W03 A;  3I8T A;  3P5B A;  4P08 A;  4P9L A;  3CEW A;  5KR7 A;  2VOT A;  3WG2 A;  3B93 A;  3B7M A;  3WAT A;  4K8R B;  3WPU A;  1G8W A;  5FCC A;  4CDX A;  2QVS B;  3FX3 A;  3R4S A;  2VNV A;  4DXR A;  2DBI A;  4Y1Y A;  1ZBE 3;  3C7E A;  1HIX A;  3LEM A;  4N7I A;  4PF5 A;  2PHR A;  1RMU 1;  3H1Y A;  2W47 A;  3EBR A;  4WM8 A;  4JV4 A;  4Y5S A;  2HWD 2;  1E5S A;  5ISL A;  2A6Y A;  4YZ3 A;  4XQW A;  3TEY A;  1LCL A;  5C8C B;  2HEV F;  2JE7 A;  3ST7 A;  4N9H A;  5J48 A;  4AHZ A;  3HNB M;  5IK5 A;  2CDO A;  4Q0V A;  3RMY A;  2A6Z A;  1MR5 A;  1JI6 A;  3ZDV A;  4GJY A;  3VBO C;  2D44 A;  3CU7 A;  4OUL A;  1RB8 G;  1SFP A;  2Q8E A;  2HWB 2;  1Z7S 1;  1AF9 A;  3MBW A;  2HWC 3;  4UT5 A;  1B35 A;  2PA7 A;  4ASK A;  5JMC A;  3SHR A;  2OZJ A;  4Z2W A;  1BBT 1;  4EQV A;  2E26 A;  2K2S A;  5EJ1 B;  3ZPO A;  1PO2 3;  1YYN A;  1W3V A;  2J1V A;  2SBA A;  2VOW A;  3HR9 A;  1NX9 A;  2BQP A;  2H6B A;  4EZ4 A;  5IK8 A;  3H8X A;  5LBE A;  2FD8 A;  1RUD 2;  3B9I A;  5FYU A;  3RVH A;  2WUH A;  4QGM A;  3B69 A;  2HEW F;  2DU0 A;  5E1R A;  4FXK B;  3MLL A;  1QXJ A;  1POV 1;  2EF6 A;  2J42 A;  4K8F A;  1QU0 A;  3IN9 A;  3O1V A;  1S4C A;  1MEC 1;  1SBE A;  4Z1V A;  5K7P A;  3WNK A;  2QTW B;  4JKM A;  1AYM 2;  2VO5 A;  2WA4 A;  1UKR A;  5FJH A;  4BQ5 A;  5B4X A;  1GU3 A;  4BK4 A;  2MEV 1;  2ZHL A;  1RIT A;  2DVF A;  2XVL A;  5AVA A;  4UDK A;  3LQC A;  1ULF A;  3VBF A;  4LIU A;  3EQE A;  5ANN A;  2V73 A;  2VMI A;  3I2F A;  4RYD A;  2MPF A;  5FZ3 A;  3E6C C;  4O65 A;  2YFU A;  3OUI A;  4XXP A;  4PCR A;  3ZXG A;  4B1M A;  5I0D A;  4NMI A;  2ARB A;  3WNM A;  1DHK B;  5K4L A;  2Y6F A;  2Z42 A;  4M01 A;  2Q4S A;  3WNN A;  4OYU A;  3G6J B;  3AZY A;  3WQB A;  5KHK A;  1IPK A;  2JG8 C;  2DUQ A;  5FKB A;  4UW6 A;  4OCT A;  1ZYB A;  3N7M A;  4LBO A;  3WG1 A;  2WN2 A;  2YY1 A;  5A33 B;  4SBV A;  4LUK A;  1I6X A;  4IEO A;  3MFA A;  4HLT A;  1MVQ A;  1WGP A;  3EMR A;  3IMM A;  1OA3 A;  1S2K A;  3J9S A;  4IL7 A;  2D6M A;  3WCS A;  4AZZ A;  1ZBE 1;  1LAJ A;  2GU9 A;  1QOS A;  3ZVX A;  1O91 A;  3GM8 A;  2NMN A;  3ECQ A;  5FTT C;  4KNC A;  3TN9 1;  4YFW A;  1W6M A;  1WW6 A;  3T2P A;  1OLQ A;  4CP9 B;  3I54 A;  5FP8 A;  1BBT 2;  5I0T A;  5AYD A;  2R07 2;  4FQ4 A;  1V6K A;  3I59 A;  4LA3 A;  3SH3 A;  2ZX4 A;  4AFM A;  5FUI A;  4MXW B;  2HLE A;  2CGP A;  1UMI A;  2FCV A;  3VKM A;  3AYC A;  1LOE A;  4JQR A;  1WUV A;  2O8Q A;  4MGI E;  2W1Q A;  2HH9 A;  3BTX A;  4E2G A;  1O6U A;  3WN0 A;  4IEW A;  2IFW A;  1YWK A;  2ZGS A;  3LFI A;  5FQ0 B;  3WDW A;  1U5Y A;  4MGK E;  3LZZ A;  3WHU A;  1HN1 A;  2W1S A;  2X5I B;  3PDQ A;  3U78 A;  4JDM A;  4LJH A;  2HWF 3;  3JD7 2;  3T09 A;  5FLH A;  3N9P A;  1REF A;  3Q9O A;  3N7L A;  4FT8 A;  1W6N B;  4CCJ A;  1OQ1 A;  3DXT A;  2HWE 1;  3Q8F A;  1LKN A;  4QB6 A;  3A22 A;  1KEX A;  4CTE A;  1IHM A;  3NAP C;  2MEV 2;  3DUI A;  3K4Z A;  5A6Z A;  2WQ4 A;  3VBO B;  3R67 A;  2OA2 A;  1Q56 A;  4LHS A;  4Z82 A;  5FK8 A;  3OF1 A;  4I0B A;  4QPG B;  3HBZ A;  4JGY C;  4YW4 A;  5C4W A;  3U07 A;  1NQJ A;  1DIW A;  1CAW B;  2FMD A;  3OPT A;  3KT1 A;  2J22 A;  4YGD A;  5EYX A;  3RJR A;  4DXS A;  5FMO L;  1UCX A;  5FZ1 A;  3WF2 A;  3ETP A;  4MHU A;  5CEH A;  4DZG A;  4ET7 A;  1PZ9 A;  1OVP A;  1VBC 1;  5BNP B;  3VSS A;  2ATF A;  3BB6 A;  2WS9 2;  3AFK A;  1JYV A;  2XLA A;  3GBW A;  2HYK A;  4YGE A;  4IEX A;  4LNV A;  4CEY B;  1NCQ B;  3VBR C;  5A6X A;  4NPL A;  1W2T A;  1UQX A;  3WAU A;  3AJY A;  3U4S A;  4MVT A;  3S30 A;  3AMH A;  2CGO A;  3C7G A;  5EXO A;  4KCA A;  1VBD 3;  2XBO 1;  2QBX A;  3O5S A;  5A7W A;  2MEV 3;  4HSJ A;  4NWW A;  2DCJ A;  3QH7 A;  4FAG A;  4E4S A;  4QU1 A;  1RVF 1;  1F31 A;  2VXJ A;  5GKA C;  4F7Z A;  1J1T A;  4AVV A;  3INA A;  1JU3 A;  2D6K A;  3MUY 1;  1AR6 1;  1UXZ A;  3KCY A;  2F4L A; 
#chains in the Genus database with same CATH homology
 4UFJ A;  2X8T A;  3KST A;  1YI7 A;  3AKI A;  4UDK A;  2X8S A;  5C0P A;  5ANN A;  5GLN A;  5GLQ A;  3VT1 A;  4UFH A;  4B1M A;  4O8N A;  3WMZ A;  3NQH A;  3OM4 A;  3PIG A;  1YIF A;  1Y9M A;  2AEZ A;  4QHZ A;  3BYK A;  4KC7 A;  2YFT A;  1UYP A;  2QQW A;  3CU9 A;  5FKB A;  3QED A;  1Y9G A;  4UFI A;  1GYH A;  3SC7 X;  3AKG A;  3LDK A;  2X8F A;  4UFK A;  3OM6 A;  3KF3 A;  3PIJ A;  3QEE A;  4UDI A;  3OM7 A;  4B1L A;  3QC2 A;  4PVI A;  4QQS A;  4U6D A;  3LIH A;  3U1X A;  1PT2 A;  3BYN A;  4N1I A;  2EXI A;  3C2U A;  5GLR A;  5A7V B;  3QEF A;  3IMM A;  4D47 A;  5AY9 A;  2EXH A;  3AKH A;  4MLG A;  4AZZ A;  3WN2 A;  4UDG A;  3OSD A;  4UDJ A;  3C7O A;  3D5Y A;  3LDR A;  3VT2 A;  3BYJ A;  3LF7 A;  5JOX A;  2QQV A;  1YRZ A;  3UGF A;  5AYD A;  5A8C A;  4N4B A;  2XQR A;  2B4W A;  4O8P A;  4JQT A;  5FKC A;  3VT0 A;  4N2Z A;  2VDT A;  4HXC A;  3UGH A;  5JOW A;  3D61 A;  5FIX A;  3ZR6 A;  3HBK A;  3K1U A;  2EXK A;  3WPZ A;  3WAT A;  3WN0 A;  4AK5 A;  5GLO A;  2QQU A;  3LFI A;  3WPU A;  2OXB A;  2ADD A;  2ADE A;  3ZXK A;  1WL7 A;  3WN1 A;  4O8O A;  3P2N A;  4AK7 A;  5JOY A;  3C7E A;  3LEM A;  3C7F A;  5FLW A;  4UDK E;  2YFR A;  4COT A;  4KC8 A;  3C7H A;  5GLM A;  3OM2 A;  3D60 A;  3R67 A;  4NOV A;  3UGG A;  3U14 A;  5FK8 A;  3LIG A;  4FFF A;  4UFM A;  5FMD A;  2EXJ A;  3ZXJ A;  4CCE A;  3TAW A;  5B6S A;  1Y7B A;  4ONZ A;  3R4Z A;  4KCB A;  2AEY A;  3RWK X;  3WPY A;  5GLL A;  3WMY A;  3H3L A;  4N2R A;  4CCC A;  3OM5 A;  3VSS A;  5FMB A;  4EQV A;  1W18 A;  2YFS A;  3WAS A;  5B6T A;  5AYE A;  4FFI A;  4AK6 A;  1UV4 A;  3VSZ A;  3VSR A;  4FFG A;  1ST8 A;  5A7V A;  4PVA A;  5A8D A;  3QZ4 A;  3S5Q A;  3KF5 A;  4U6B A;  1W2T A;  3ZR5 A;  3WAU A;  3NMB A;  3R4Y A;  2AC1 A;  1VKD A;  3U75 A;  1GYE B;  3VSF A;  5AYC A;  5GLK A;  4FFH A;  3AKF A;  3C7G A;  4KCA A;  5GLP A;  3WPV A;  4KMI A;  3BYL A;  5JOZ A;  1GYD B;  3LV4 A;  3D5Z A;  1OYG A;  3ZXL A;  4UFL A;  5FMC A;  5FK7 A;  1Y4W A;  4CCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...