2ADDA

Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with sucrose
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
537
structure length
537
Chain Sequence
QIEQPYRTGYHFQPPSNWMNDPNGPMLYQGVYHFFYQYNPYAATFGDVIIWGHAVSYDLVNWIHLDPAIYPTQEADSKSCWSGSATILPGNIPAMLYTGSDSKSRQVQDLAWPKNLSDPFLREWVKHPKNPLITPPEGVKDDCFRDPSTAWLGPDGVWRIVVGGDRDNNGMAFLYQSTDFVNWKRYDQPLSSADATGTWECPDFYPVPLNSTNGLDTSVYGGSVRHVMKAGFEGHDWYTIGTYSPDRENFLPQNGLSLTGSTLDLRYDYGQFYASKSFFDDAKNRRVLWAWVPETDSQADDIEKGWAGLQSFPRALWIDRNGKQLIQWPVEEIEELRQNQVNLQNKNLKPGSVLEIHGIAASQADVTISFKLEGLKEAEVLDTTLVDPQALCNERGASSRGALGPFGLLAMASKDLKEQSAIFFRVFQNQLGRYSVLMCSDLSRSTVRSNIDTTSYGAFVDIDPRSEEISLRNLIDHSIIESFGAGGKTCITSRIYPKFVNNEEAHLFVFNNGTQNVKISEMSAWSMKNAKFVVDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords fructan 1-exohydrolase IIa
publication title Insights into the fine architecture of the active site of chicory fructan 1-exohydrolase: 1-kestose as substrate vs sucrose as inhibitor.
pubmed doi rcsb
source organism Cichorium intybus
molecule tags Hydrolase
total genus 147
structure length 537
sequence length 537
ec nomenclature ec 3.2.1.153: Fructan beta-(2,1)-fructosidase.
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain
A PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 2addA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2addA01
5AYCA 4UFMA 1Y4WA 2EXKA 4N4BA 4ONZA 3LIGA 5FMCA 3C7OA 4UFIA 3WPUA 4B1MA 3U1XA 2QQWA 2X8TA 4UDIA 4U6BA 5JOYA 3BYNA 3ZR5A 3WN0A 5GLOA 5GLMA 4AK6A 3U75A 3LV4A 5GLKA 4O8OA 3QZ4A 2ADEA 3AKFA 4U6DA 5AYEA 5AY9A 4KC7A 5FMBA 3ZR6A 2EXIA 2ADDA 5A7VA 5GLRA 3AKIA 5FMDA 4KC8A 4UDKA 3C7GA 4KMIA 3D5YA 4N2ZA 4CCCA 3S5QA 4O8PA 5GLPA 3VSZA 4COTA 3BYKA 3QC2A 4UDKE 3LDRA 4PVAA 3U14A 4AK5A 5FK8A 4O8NA 5GLLA 3ZXKA 3D60A 4UDJA 1GYDB 3WN2A 1Y9MA 3KSTA 3WPZA 2EXHA 4NOVA 1ST8A 2QQVA 3K1UA 3WPYA 3ZXJA 2QQUA 1Y7BA 4KCAA 4UFJA 4N1IA 4KCBA 5ANNA 3UGHA 3R4ZA 4B1LA 2VDTA 3WMYA 3D5ZA 4D47A 3OM4A 3RWKX 3IMMA 4AZZA 3VT1A 3UGFA 5JOZA 1GYHA 1W18A 3ZXLA 3VT0A 3C7FA 4UFKA 3R67A 5A8DA 5FKCA 3OM7A 3WASA 1UV4A 3PIGA 2EXJA 3CU9A 1YIFA 3AKHA 3SC7X 5A7VB 5B6TA 5FIXA 3PIJA 3C2UA 3QEDA 1UYPA 3KF3A 3OM6A 3H3LA 1GYEB 5B6SA 2AC1A 4CCEA 2AEZA 2OXBA 3UGGA 3LDKA 1PT2A 3TAWA 3P2NA 4AK7A 3LEMA 1WL7A 3VSFA 3VSSA 3OM5A 4UFHA 3LF7A 3C7EA 3WATA 5AYDA 1YI7A 2YFTA 4QHZA 3R4YA 4JQTA 3QEFA 3KF5A 4PVIA 3VT2A 4FFHA 3NQHA 3BYLA 5FLWA 4UDGA 5GLQA 3WMZA 3VSRA 4FFFA 3WN1A 2XQRA 4QQSA 4FFGA 3WAUA 4CCDA 2B4WA 1Y9GA 4MLGA 3BYJA 4FFIA 2X8FA 5FKBA 3D61A 1W2TA 1YRZA 5JOWA 4HXCA 3OM2A 5GLNA 3QEEA 3OSDA 2X8SA 5A8CA 3LIHA 4N2RA 2YFSA 3C7HA 5FK7A 2AEYA 1OYGA 3AKGA 5C0PA 3WPVA 1VKDA 3LFIA 3HBKA 5JOXA 2YFRA 3NMBA 4UFLA 4EQVA
chains in the Genus database with same CATH superfamily
3CEWA 1SFNA 3PURA 3ORJA 5BNNC 4AHYA 5CFCB 4C1WA 5HCAA 4XMAA 3O1SA 3NW4A 4LO4B 3LOIA 1MZ6A 2YPDA 2ZGLA 1LHNA 1TME2 1UU5A 2O1QA 3LCPA 5JCTA 2XBO2 4F3JA 4TLGA 3BU7A 1A78A 2VCBA 2XHKA 3PU3A 1LR5A 1NZIA 2JD9A 1UZWA 4HSLA 2IFWA 3P5BA 2VBBA 1DGRA 4XW3A 3D5YA 4CDUB 3BYKA 1UIKA 4B3NA 1X8EA 5FRAA 1BK1A 1PIV2 1Q8VA 1H2NA 3VV1A 4JGYA 1LRHA 3J8F3 1VJ2A 4JVAA 2RR13 4Q1PA 3IBMA 4CXYA 2D6NA 4K8FA 3ZXJA 5DUXA 4FPJA 2F6BA 3RYRA 4I3PA 4NUBA 3BI3A 4FOVA 5K7PA 1S2BA 2TBVA 2GDFA 2VR4A 2HWB1 2WZ8A 3CF6E 3HR9A 3K75B 1QJX3 4CPBA 1OQEA 2K9ZA 2ZX2A 1OSGA 3VT0A 3I2JA 4XETA 4MZUA 2LM3A 4LR4A 3AKQA 4OI2A 3JZVA 2Z42A 4CDXA 3KQ4B 2H6BA 4IEZA 2ZGNA 4YW1A 1Q43A 3AYEA 5IWFA 4AEKA 4XTMA 3IWZA 4H55A 2CYFA 1JOJA 2A6YA 1W6MA 2PAMA 3NRUA 4I0WB 5HV0A 4YGEA 4NIDA 4LKDA 1TNFA 1VALA 1TME3 1AF9A 2X8TA 1H0BA 2XBO3 4Q8KA 3JXSA 3I2KA 4FP2A 4GALA 4BK4A 3LA3A 1UZ0A 2OUJA 3JD72 2NM1A 4QXCA 3RVHA 4AQSA 3R4SA 2G9FA 2WS91 1O5LA 3I3QA 5J1XA 5FYZA 4Y5Z0 4Y24A 2QUOA 2PN5A 1HDKA 5T5LA 3GXUA 5CG8A 1H6XA 2QZ3A 4M0HA 2ZZQA 1AUYA 1FMD2 1PIV3 5KC5A 3N3HA 2HWB2 4F8AA 4LEJA 4CXXA 2JG8B 3W5MA 1RXFA 4KG8A 4J25A 1JHJA 4YG3A 5F2SA 5FYCA 5CISA 4XC9A 4JDOA 4RSUA 3WV6A 1U5XA 2EIEA 4C0BA 4FI9A 4FT8A 5T55A 1NLQA 4CCDA 2BNMA 2DUOA 4PBPA 2WUHA 4QD2A 2F17A 4Y4RA 4GQ7A 4E4HA 2ZS6B 3Q9OA 2BVVA 2HEVF 4YVSA 3AZZA 1ODMA 5EYXA 3VZOA 1Q8OA 5GLMA 1JZ3A 3DXUA 3RRDA 3BTZA 4XIOA 1K5MA 3MI8A 5G05L 2BNOA 5FZ3A 2HEWF 2W87A 1QNWA 2JE8A 3B69A 5FK7A 3U11A 1V0AA 2WS92 5APAA 3URFA 4RQPA 2VXRA 4O9GA 1JZ7A 4LOSA 4WVMB 4LBQA 1DYOA 2UURA 1G9BA 5GALA 2R0FA 2VMFA 5EJZB 5ABJA 3AP4A 2FDGA 4JTOA 3AC0A 1CAWB 1H8VA 1AR82 4ZZ5A 4JGZB 3T1MA 1CX1A 2WN3A 1OF3A 2XXZA 2XWBB 3KV5A 3R4UA 3WNMA 5FZHA 5CFDC 5LZ6A 4NIHA 4Q8LA 3U07A 1DF0A 2RDQA 3UJOA 5F3GA 3K48A 1KDMA 4HPKA 3SNMA 3HMYA 2E6VA 1DQ5A 3GJAA 5GZGA 1W9SA 4D7TA 2HWB3 4N53B 5LK7B 2O8OA 3B9IA 5FCCA 1AX1A 4IGQA 1O7FA 1DG6A 2RS31 2Y33A 1W3VA 1BHGA 1HQLA 1GANA 1LENA 4HETA 4BWOA 2FCTA 2VMEA 1OLME 4M0NA 5L7OC 5FXXA 4IEUA 3GYDA 3O1MA 1RC6A 1D0HA 2JDPA 2ZX3A 4RGAA 3E1F1 3VGIA 1Y9MA 5CKMA 1QH6A 1K5JA 4BIOA 3WN2A 2PHRA 3W9AA 5K9YA 1LGCA 4DFSA 3PUHA 4YFZA 2GC0A 3FL7A 5A7WB 4HOOA 4AR2A 4RHV1 2XPJA 3WW1A 1HB2A 3D5ZA 3INAA 2ZOEB 2E33A 2WS93 5B4NA 1JI6A 2VQAA 2WNVC 3ACGA 2VZTA 4Y1XA 4OHZA 3KT4A 3CLPA 3VN4A 5KHKA 3C7FA 3I2FA 3JBG1 1FPN1 2AREA 2QQOA 3I7DA 4CEYA 1JYTA 3MFAA 4V2VA 3ILFA 4MO3M 1W6PA 1RXGA 3RJ2X 3FBMA 1UMIA 4Q4W2 4MLOA 1UF2C 4KQ7A 2R0HA 5FZ8A 4ZY9A 4NHKA 5F6KA 2RS32 5FIXA 5F9TA 2J1AA 4K20A 3QEDA 4AEDA 1AYM1 1GP6A 1I9RA 1UYPA 5F3EA 1TNRA 1HX6A 2V73A 1JZ6A 4IGPA 1UW8A 5D2AA 5FQ0B 2ERFA 5JXGA 1RUNA 1R091 3OGSA 3O0VA 1WA4A 2NP0A 1RUOA 3UGGA 3OGVA 4U36A 5A3NA 3KGLA 1RIRA 3F95A 2E31A 4BQXA 4AG4A 1M4WA 2P3YA 3SCHA 3J26N 5A1FA 3O1VA 3GCWA 3OUJA 4RHV2 2PHXA 2A6WA 3VBUA 4DRVA 1VB2A 1NE4A 5AYDA 1UWWA 2ZGTA 2XKPA 5JSRA 4JQTA 1CPMA 1ULCA 2EIBA 5FPXA 3JBG2 1FPN2 3WY6A 5AFBA 5CB7A 1E5HA 1ALYA 5HCHA 2KR2A 3T09A 2LS6A 1WMDA 3IZOA 4JC1A 2H0VA 4DNYA 1OF4A 4MGKE 4X6RB 1RMU1 1VLNA 1DBNA 3WHUA 3H50A 1DGRN 2CAUA 2ZMNA 4HK8A 4W65A 1HW5A 1AYM2 2BUKA 1X9PA 1TE1B 5EJ3A 3ZPOA 1GP4A 2VXJA 5CFDB 2YFSA 1UU4A 2VW1A 3OBRA 1PM4A 5EXOA 1UCXA 3LFIA 1BJQA 1J1LA 4C1XA 5EFUA 3MUZ1 4J1XA 4JKMA 4UF0A 4D94A 2GSYA 3BKZA 4JCKA 4QU1A 4BLJA 4M4RA 2RS33 4MGSA 2WNEA 4K8RB 1H4GA 3LIGA 4S2DA 2KA3A 4UFIA 1MQTB 2ZKNA 4B1MA 1GQGA 2MNGA 1MVEA 4M3CB 3ZR5A 3K3NA 4U6BA 5C6CA 4FPLA 1RITA 2DVDA 3M3OA 5L7OB 5BNOB 4RS5C 1SLIA 2NMNA 1C4RA 4S2GA 4D6QA 3SKJE 5CU1A 3WDTA 4CDQC 4EZHA 3OEBA 2Q8EA 4ISQA 4LHSA 1IG3A 4CVUA 4RHV3 1UD1A 2W5FA 2XLAA 4TN7A 1QQP1 2X5IC 4QB1A 4I3GA 3ZXAC 1W9TA 4YWAA 1RMU2 4PDWC 3FLPA 3C7GA 5DZFA 4ZXKA 5DMYA 5FO9B 3TBDA 1ZA7A 3JBG3 1FPN3 2WNVB 1H9PA 1CGPA 5FUPA 5IHRA 5LWBA 5FK8A 4FVVA 5JPMB 3OEAA 1Q8PA 2VPVA 3A7QA 5LY2A 3ZYIB 4ES8A 4P9GA 3HVDA 3CU7A 1E57A 4GH4A 5LA0A 1FX5A 2WT1A 2G9ZA 1AYM3 3N7KA 1YJKA 3WLUA 4KCAA 1HIXA 2DCJA 1DZTA 3RZHA 2KD7A 2PMWB 2VDTA 1LU2A 4NO4A 2OT7A 1O3SA 1XYPA 1JZ2A 1R093 3WW4A 3SQOA 4Q0PA 2GNBA 5FZKA 2X8KA 2C6SA 4LUMA 3V64A 3E97A 2FCUA 5FREA 1CX4A 1W8OA 2XH6A 1OBNA 2BGCA 5FMOS 5H9RA 5BNPC 4RD7A 3DYMA 4RYDA 1OD5A 3VKMA 3VZMA 3O5SA 4AFBA 3K4ZA 2PHTA 1GMMA 1C8NA 3GNEA 2DF7A 1J3RA 1JOPA 1Q3EA 3WW2A 4EWAA 3TN92 4LA3A 1OKQA 4MVTA 3I49A 3AKRA 1GYEB 4LO7A 4IXLA 4LUKA 1RMU3 3CIHA 3ENRA 4WM8A 3LEGA 4AVAA 3ZIXA 5C9AA 1PT2A 3ACFA 1XPWA 4QWNA 3OPWA 1LOBA 2FDJA 4LBJA 4ATFA 3VSFA 3C7EA 4IGOA 2DU1A 4KWLA 2OIIA 4IETA 5C8WA 1OOPA 2XVKA 3WNLA 5C8CC 4AI2A 2WKKA 4OI0A 4N43C 1DHKB 1PO21 5BYNA 2WFF1 2A70A 3EYPA 2Q1ZB 1Y9GA 1WMFA 3VBRC 1AJOA 4FAHA 2X8FA 2O14A 1PHMA 4FXKB 2R1BA 4LK7A 4NPRA 3BCWA 3AKSA 3H7JA 2G19A 1XBFA 1SDWA 1RUD1 3ZYBA 4AFAA 2DCZA 4J6GA 4Y20B 1YEWA 5JSPA 1WGPA 3MBWA 3B5LB 4QX7A 3QH6A 1AXYA 4UWDA 2DCKA 4JV4A 1QQP3 5A3OA 5LBCA 3QCWA 3FMGA 3GZAA 4N7UA 3ES1A 3VBFA 2RV9A 4X8PA 1O4ZA 1S0FA 2R30A 5G04L 2XUMA 4DY5A 1IQDC 3WHTA 4B4QA 5HPOA 3WP3A 3PJYA 4FO9A 4A4AA 4QPWA 3FLRA 1AX0A 1OI6A 2W94A 4ARYA 3ALQA 1ZRDA 5AY9A 4QMAA 1HJGA 1YFWA 4N8MA 4YVWA 5FMBA 1J58A 2DU0A 3ZFFC 5I93A 3ILRA 2BV4A 1QH7A 4UAPA 3OYWA 2HWF1 1RHI1 3OGGA 5I0RA 4N2ZA 1GYKA 3EHKA 2OUHA 4IV3A 3H42B 1W3XA 3SISA 3T3YA 2EALA 4LHLA 4OVEA 1XNTA 5A33A 2Y6FA 3GCXA 3ZYGA 5JWPA 2OX0A 4C0HA 3ZXKA 5KHGA 4AGRA 3I59B 4QPGA 1EPZA 2ZHKA 1NA1A 2KXLA 3I2HA 4RA0A 2ZTNA 5D8AC 3BTYA 3TEYA 4E2GA 1PGSA 1CJDA 4E2QA 1QU0A 4LTAA 4RGGA 3FX3A 3B9CA 4WBBA 1ULDA 3FFQA 2WLPA 3R4ZA 3PUIA 5FBZA 4GB31 1HB4A 3RWKX 4CDWB 1JYCA 3HQUA 5CFCA 2BBVA 3OM4A 1UO9A 2L9LA 3J7NA 4ES9A 1NKGA 3DPRC 4UFKA 5IFPA 1D2QA 3KSCA 1UY4A 4COWA 3TOJA 1NCQB 5FPLA 3PIGA 3ZKYA 2HWF2 4KWJA 1RHI2 1STMA 1WMXA 1JW6A 4Y1ZA 3WXPA 1DP0A 1LJ7A 1PO23 2BQPA 2PHWA 3POBA 4LLFA 4P9IA 5CZKA 5J96B 2WFF3 5C3OA 1N1YA 1SLTA 4KG0A 4JX0A 4UW5A 4CDUA 1A3KA 1V6JA 4N43B 1NYWA 3N7LA 3OM6A 4YGDA 4DQAA 5B6SA 3VL9A 3POEA 3OB8A 1DZQA 2VMIA 4A45A 4AAPA 2YBSA 2W08A 5IVEA 2V4AA 1PNGA 1W03A 2JDYA 2XLGA 5C3RA 2ES3A 5BY5A 1RUD3 1OYGA 2BGPA 2ZAAA 3CMGA 5C2MA 2VW2A 1LODA 4UFHA 4Y4YA 3MIEA 5JMCA 1WKYA 3POSA 4GB32 3H7YA 4LO5B 1RUF2 2RHPA 3B00A 1KXGA 2I74A 5FLWA 5CVRA 3WG4A 2PAKA 3POIA 4QX2A 1UOJA 2XJQA 4AOCA 3JQWA 2J42A 2BGOA 1MS1A 2ZZJA 1GNHA 3GBGA 1GQHA 4FFIA 5BNQA 1YNAA 5I0TA 2GALA 3OF1A 2W46A 1W2TA 5IT6A 5LY1A 2XL7A 5FOBB 3OM2A 2EVXA 2C9KA 5GLVA 2AENA 4AE2A 4YG0A 1QXRA 4OI4A 4EN6B 5CEHA 3LIHA 3NSTA 1XSRA 1NCRA 1XOYA 5FZGA 3WNNA 1E5SA 2FQPA 4D7SA 4UXAA 4NIGA 3OOXA 2WO7A 4O65A 5HCBA 5A32B 1W0PA 4PQ9A 4MOAA 1W9FA 2HWF3 2WFPA 4OUSA 5FPAA 2CV6A 1UKRA 1RHI3 2MPFA 3IDAA 4UFMA 4XUNA 4URAA 3T0DA 4LKEA 1ZRIA 1XE7A 2EXKA 2Y38A 2JJ6A 1EUTA 3Q8CA 1XB9A 2P3IA 3FUOA 2D3RA 2X09A 5LA1A 5KHHA 3U4SA 3U75A 1GBGA 5CA6A 2JG8A 2FDFA 1LOAA 2HWC1 5EZWA 2XUEA 5AVPA 3VBSC 2I2SA 5D8AB 1BK0A 2WYFA 1W8ZA 3M7AA 4OHYA 4GMP0 1XJAA 4FPEA 1PK6C 1WW7A 2MEV1 3MO4A 4GB33 3CBNA 3ST7A 4BYYA 5J7MA 3N4MA 4KC8A 3VDDB 3FJSA 1LB2A 2W39A 1ENSA 1YJLA 1IQAA 1J3PA 4XE9A 4KMQA 3E5UA 3ZN6B 1FV3A 4AK5A 1NLRA 1S1AA 2B45X 4TWTA 5FZ1A 4Q29A 5IAVA 4Q5OA 3MV01 5LATA 1TEIA 3M8LA 1XYOA 3MGUA 1DQ1A 1WCDJ 1L7RA 3IMNA 4NOVA 3ZXEA 3BPZA 3EXUA 3B7MA 2QQUA 4BPZA 4GWMA 4WVMA 3IB3A 2WAOA 1ULEA 4D7YA 4L0PA 3NAPB 5A6QA 4JAAA 3TWIA 1I3HA 1RL3A 1W0OA 5FZ0A 4W6XA 5JXJA 3RGBA 1NXMA 4C91A 1G9CA 1CAWA 3J7MA 4JGZA 3UK9A 3AMPA 4BQYA 4GMP1 4B4RA 3DKQA 4NHLA 4DB5A 2PAEA 3WEZA 5K4LA 3USSA 2QVSB 2EIGA 5FYVA 4IEOA 2MEV2 5LRSA 4P08A 2VU9A 1AR61 2IXCA 4TZDA 3QBQA 1W99A 3BGAA 4AL9A 1BVVA 4N53A 1N3QA 2ZGKA 3DN7A 4HG6B 1V00A 4QQPA 4OUEA 1VB4A 4BQ2A 2JXAA 4YSFA 1ZREA 1AR91 4WM7C 4GJZA 2A73B 2B9UA 3KS7A 5CAZA 1KFUL 1PVC2 2YG0A 4OHVA 3E5QA 5FLIA 4Z8BA 2BBAA 5FLJA 3D3AA 3H1MA 3N9LA 3NVCA 4META 1EUUA 3TEWA 4A7KA 3ZFEC 4Q4V1 1D7PM 1UPSA 5A7WA 3ZDSA 1Q8QA 5A6YA 2BJSA 4AVCA 1CR7A 3OD0A 2DYCA 5T5PA 1HV0A 5EJ1B 3JB4C 4Q0VA 4QX5A 2RDNA 5K0UC 1REDA 5DG1A 1IKQA 4E8DA 1I6XA 1DDLA 3ZN5A 2DURA 1LHWA 3FE5A 1F4AA 2G4IA 2W1UA 1ZBA2 2CU5A 3BYJA 3IKWA 4AAXA 2MHFA 4CE8A 4XIKA 1B35B 2WYSA 2GMMA 1WCSA 3H8RA 3KD4A 3VD7A 3RMYA 4TTGA 2HWC3 3OSDA 3T2PA 3ON7A 3IT8A 1JYNA 1NOVA 4ZXEA 1V6NA 2RJLA 3I2DA 3ROUA 4B7EA 1AR92 1J1TA 2C9AA 4DPNA 5C3SA 1VKDA 3VBSB 5KXCA 2YFRA 2DWRA 2MEV3 2Y34A 1ZZ6A 3VLBB 2YMZA 1IOAA 4I0AA 3POWA 3M4FA 4Q26A 4QU2A 2VH9A 2Z79A 4L99A 1LHVA 2D7FA 2F4LA 4FOYA 4FOWA 4QX8A 5F2WA 3TB0A 2VM9A 4N4BA 1KQRA 1CAVB 4Q4V2 4UBHA 2DBIA 3DKWA 4KGGA 2UY9A 4M4PA 3POFA 3TYJA 3MPBA 1YFXA 1SG3A 3PVBB 4RFRB 4ASLA 1X50A 1H4HA 1OH3A 3K51A 2D6OX 2DFBA 4AI0A 3M3CA 4YW6A 3I2IA 1W2OA 1BZWA 2DVFA 2WNOA 1ZVFA 1YQ5A 1WLTA 3KLSA 3ZFGC 4A44A 5F3IA 4BE3A 1H2MA 3BVCA 4MX3A 5F5QA 1GNYA 2RE9A 3RWNA 3WNPA 1KS5A 2DVGA 4XQ4A 3VKLA 4GMP3 4HT1T 2NZ9A 3ZXFA 4YARA 3NWKA 2JDUA 4XHXA 1KFXL 5I8SA 2Z2SB 3D60A 4UDJA 5D21A 3KSTA 1EYBA 1AR63 1ST8A 3ASIA 4CEWB 3K1UA 5T52A 5JR2A 5A7PA 2Y6LA 2VD7A 2TNFA 3ZYPA 1AR93 4XUQA 2G9GA 3A0KA 4OQ8A 2DVAA 2HYKA 1PGW1 4LO8A 4M3CF 1BEV1 1MQTA 2AH2A 2BW8A 2RS13 4PT6A 3ZPYA 4M3CA 3UV9A 4LJHA 5KR7A 4JKLA 4M3CE 2CGOA 4OYUA 1FOD1 4N90A 5BNOA 4NIIA 3R6SA 4Q4V3 5FV3A 5DDJ1 2EXJA 3JCIA 4QPIC 4ZS3A 1ENRA 3ZFEB 4EE2A 3H8XA 3QH7A 2ORXA 3JD71 4S2FA 2VZPA 2D5FA 3D0SA 3I4IA 3ZYRA 1UU6A 2IXJA 4M00A 2BWAA 5FYSA 3OCPA 1OD3A 1POV0 3FFZA 3VKOA 1H2KA 2QZ2A 2WNVA 3B01A 3B94A 2P6CA 4W4ZA 1QOSA 1QJY3 1FMD1 5FP9A 5C4WC 5SV8A 2GZWA 2ZXQA 1S0GA 5FYTA 3LDKA 3THCA 4GWJA 4U6DA 1LEDA 4L8QA 1H8TC 4FOQA 5FY8A 1O8PA 1QMJA 4CRQA 4OMDA 1HJFA 2OZJA 3MW2A 4P9YA 4CP9B 2X53S 1PGW2 5L9VA 2C0ZA 1BEV2 3VUOA 1DCSA 1SPPB 3LSEA 3K46A 1WCUA 2ZBJA 1JUHA 4FSJA 2YV8A 1FOD2 4QQSA 2ZX1A 4F7ZA 4DXSA 5DDJ2 2PHFA 2WT2A 3AMNA 1LHUA 2ZGQA 5I91A 1ND2C 4X8NA 3LPGA 5KWRA 1DYPA 1VMFA 4PHZA 4Y22A 3MW3A 5FAXA 3SEEA 1POV1 3PMEA 3ZVXA 5FFOC 1EP0A 1C1LA 1D2SA 5JR7B 3SMHA 3NO8A 1YYNA 1UZYA 3OGJA 3AKGA 1YFUA 3KVBA 4DXZA 2LTNA 2YYOA 3UT0A 2ZEZA 5FY9A 4UFLA 2VAUA 2DFCA 3PL0A 4XJAA 3H8UA 4NWVA 1AR81 2AR6A 5FUIA 4CU9A 3THPA 4YZ5A 4MH0E 1Y4WA 4CCLA 1ND3B 3TRSB 1VBC1 1K45A 2VCCA 2J1UA 1R1A1 3MYXA 4PLMA 1LOFA 5FMCA 3C7OA 4RR3C 2YZ4A 2P3KA 3WPUA 5AVAA 3U1XA 4H3WA 4C90A 2VOXA 2RDRA 4IE7A 2O0OA 3A21A 4AEMA 3PVNA 2XQXA 3WUCA 5DUVA 5BNNB 1IGOA 3KZ4C 4O8OA 4FQZA 5C3PA 2JDNA 1R081 1UNBA 2OPKA 4XUPA 3WP6A 5JPNB 5FTTC 2BOIA 1UX7A 4FPCA 3ZR6A 2ADDA 3O0XA 2VNOA 3S7IA 1PMIA 3WINE 3UKNA 1BEV3 1QGLA 3VD3A 4COZA 1GP5A 4R52A 2Z4FA 3MDPA 3LDRA 1UY2A 4NJ4A 5LBFA 1WW5A 1QNYA 4BM8A 1FOD3 1PO11 4MADA 4QQLA 4ZU7A 3VBOC 4O8NA 1X7NA 1SCSA 4BQ5A 2D6KA 1ENXA 3QD6A 2CSGA 4Y20A 5DDJ3 4LORA 2XONA 1W05A 1JU3A 2XOMA 2V4VA 2Y6KA 3JD73 3PJQA 2XMLA 2WLQA 1TMF2 1UY1A 3ACLA 4QPIB 1VBC2 5ANQA 3QOPA 2AZ5A 1R1A2 2E7AA 4P14A 5JIUA 1YCIA 4XOGA 1CJPA 4YGBA 4R9BA 5ANNA 1E5IA 4AEJA 4AF9A 3WDYA 5E1RA 4AFCA 1FMD3 1AXZA 1BKZA 4Q4W1 4BMEA 4Z92B 3LPFA 2IWGB 2ZMLA 3EO6A 4Y5TA 1R082 5A3PA 3HN1A 1MR5A 2BVBA 1OLMA 4QT6A 1F4HA 1W6OB 3WASA 4IV1C 1GZWB 3AVRA 2C5DA 3AM2A 4J1WA 1O91A 4P5YA 2OW4A 4PLNA 1AX2A 3WQBA 4TSVA 4R9DA 1W6QB 1QOOA 1US3A 5KXEA 1MZEA 3SCFA 1NUKA 2XJRA 1N1TA 2WZPP 3ZSLA 4BCUA 1PO12 5FWJA 2YFZA 2VZVA 2Q0AA 3M3IA 2D5HA 2D6LX 3IDBB 3OY8B 2QE3A 2D98A 3GHMA 2AEZA 2EF6A 1NLSA 3E6BA 3R05A 3RJRA 4UW6A 4AI8A 1POV3 2DCTA 3H3UA 1S0JA 3ZM8A 1D4VB 4LIUA 1QXPA 1MS0A 1WL7A 1J3QA 2XVGA 3AJYA 3VSSA 2B4KA 3TEXA 4IEQA 2Y26A 3WATA 3W21A 5BV6A 2YFTA 3BOWA 1ZX5A 1K42A 2BU9A 1XNCA 3O1RA 2B7YA 1RTVA 3KB5A 1AR83 4E9KA 1SZBA 2PQSA 1JZ8A 5GLQA 4CDWA 4FFFA 2ZEWA 1SBEA 3GBFA 1VBC3 4XCBA 1BLZA 1R1A3 1Z7S1 2D44A 2XKOA 3EMRA 4JGYC 2YDEA 4H7LA 4BXFA 5C33A 4MYEA 3ZSKA 5IAXA 2W68A 1NCQA 5IUQA 5DG2A 4MGIE 1RUG1 2BFUS 3I54A 1YRZA 1DZRA 3UYJA 2X8SA 1L7QA 1R083 1WWYA 1FT9A 2AEYA 3D5OA 4ORFA 4P00B 5C0PA 3AB0A 1UN1A 4XF3A 2OKXA 5FR3A 3O14A 1FI2A 3OBTA 5LBEA 3BTXA 2CGPA 2A3YA 2QBXA 2ZCWA 5IK7A 4NE9A 2QDRA 4XFHA 4CDXC 4L2NA 4JTNA 2A3WA 3MW4A 3RDIA 1XU1A 1PO13 2Y6HA 3I3EA 4XAAA 4A7ZA 4CP2A 3LSDA 4BMBA 4D8MA 3W58A 1EAH1 3B93A 3L2YA 3VHNA 4P5HA 5JOYA 2CWMA 3LOBA 3NNFA 1YFYA 2VW0A 3VBOB 2PQQA 1IPSA 4Q27A 1MS4A 2PTMA 5AYEA 2UU8A 1KD7A 2ARBA 5HXVA 1Z7S2 5JAXA 1S0BA 3JUUA 1W90A 5ERLA 3O1TA 2A6VA 2YB7A 1ACCA 2A6ZA 3AP5A 4QDRA 1W2NA 2VOTA 4XVHA 4YW7A 3WF0A 4KMIA 1RUG2 2WA4A 2RS52 2HWD2 2IVJA 4Q4W3 4QQHA 3GZTB 4KL1A 3W59A 3HT1A 3AZVA 3NV1A 5FXVA 3AFGA 2WZEA 2YPJA 1JH5A 1SDDB 2D93A 5KXBA 4GWNA 1IPKA 1B09A 2DCYA 2VZUA 3D0JA 1NQDA 2JE9A 3WPYA 4CU6A 5A32A 3FBYA 4XF0A 2K2SA 2EA7A 5LK5A 4ASKA 1WW4A 3ZO0B 5DAQA 1YQ8A 3WDWA 1EAH2 5EQUA 1OLQA 4CU8A 4D47A 2VOVA 4WV8A 1C8M1 4YVSC 1CAUA 3IIAA 5EP9A 4HL0A 2HKXA 4AFDA 5FDBA 5C70A 2RM22 3FZ3A 3S57A 1XSQA 4Q4X2 1UMZA 3D6EA 1K5MC 5FJHA 4LBNA 2GN7A 1DQ6A 1I5PA 1A8DA 2I07B 4OULA 4UYBA 5A1LA 3L9JT 4RQPC 3TNQA 2JG9C 5D8AA 3TN91 5A3LA 4ONUA 3RMXA 4DS0A 2HEYF 5F39A 3CU9A 4NVPA 2R072 4LBMA 2P1BA 5ABJC 3WNKA 1CIYA 1LESA 5IVVA 4LBOA 4XZPA 1S55A 4N9IA 4A6SA 4AW7A 3VDDA 1Z7S3 4D6SA 1SFYA 2C4XA 5FYBA 1V70A 4BK5A 3WZ1A 5GLZA 4YW4A 1O3QA 5LW9A 1YHFA 1YI9A 2PHDA 2VOKA 3AJZA 1JYIA 1QY4A 1RUG3 1W6NB 4GWIA 4CXWA 4DUXA 4IE6A 1OPMA 3OM5A 3LF7A 1AYN1 1JBCA 1H9WA 3GBWA 3SH5A 4D69A 2VUCA 2X05A 5KC6A 4E4DX 5LEKA 1C8M2 5I8TA 3BODA 4MGQA 2ZAHA 3NAPA 3LEKA 4YPJA 4ITCA 5A7NA 1BYHA 5EIYB 2YXSA 4IW3A 4CP0A 4QGMA 1O8SA 2KM2A 2B46X 4YM3A 1HB1A 2VNRA 3WCSA 4CZSA 4XJUA 1F5FA 4FTSA 1EAH3 2Z5WA 5FP7A 1HN0A 1VAVA 3WQ7A 2W1SA 3AKTA 2D6MA 2W95A 5BPXA 1HQWA 3BIWE 5I8YA 3NNJA 4XDQA 1VRBA 1W6MB 2HH9A 3N9MA 3AP9A 2BOJA 4IERA 1SMVA 2QTWB 1G9DA 3HD8B 3ME2A 5FP4A 4ZZ8A 3CJIC 2VQ0A 3HWJA 4QX1A 2VMGA 2EIDA 5AC91 2R1DA 4HK9A 2WSUA 3PU8A 3ZLIA 2QQNA 4IE4A 2ZGSA 5LB6A 4GZ9A 4B4PA 3GDBA 4CEYC 5IVCA 3V0AA 1OMIA 4QX0A 2VE1A 3DL3A 1AYN2 2VNVA 3A22A 3MPPG 4PBOA 3MIFA 4CPBD 2Q8DA 2Q5TA 2CY6A 5FZCA 4NMIA 1O59A 3ZX7A 4AEDC 4BIFA 2ET7A 2ZABA 4GIQA 1VR3A 3QZ4A 5FYUA 3AKFA 1W0NA 1URXA 2RG4A 4F83A 2FDKA 2WQ8A 1WBFA 1BXHA 4QM9A 5A7VA 3P3PA 4RS5B 1GZTA 1S0DA 1C8M3 3I3BA 4HZFA 4OZOA 4QDQA 4XEZA 4COTA 2IXIA 1RUE2 3BOPA 4A7YA 2GNDA 4CDQB 1DGWX 4YVSB 3D4KA 1IHMA 4YGCA 3VBUC 1B35A 4KU8A 4IUGA 1ASJ2 2VG9A 2X5IB 1LULA 5FZLA 1RB8G 2R062 4PDWB 1F9KA 2WQZC 4FPHA 4P9WA 5AC92 3TN93 2DTWA 2EXHA 4YLZA 4XPVA 1KRIA 2JG9B 5E8AA 4A3XA 1OURA 3CZUA 5A6ZA 3HQRA 3KHBA 4K40A 5DAPA 5ACA1 4MHRA 3NJVA 3AXDA 1W8TA 3LD8A 1CAVA 2JWPA 2R32A 4YZ4A 3UGFA 3VKFC 5JOZA 2YHJA 4CUGA 4XTPA 1DFQA 3CDZB 5CYYA 5JZGC 1VBB2 4NOTA 5KHIA 2ZEXA 5FKCA 1PZ9A 4G4FA 1W28A 4UBGA 1AYN3 3WF1A 3AK0A 4COVA 3PUSA 5JMOA 4HPKB 1OHFA 3JU9A 4XAEA 2RDSA 4AVBA 3FWEA 4NAOA 4G3YC 4NHYA 1DLCA 5FXWA 2W47A 2VQTA 1GR3A 2A7AA 2JICA 4QX3A 4ASMB 1WA6X 5BNPB 4XXAA 1HXS1 4UW3A 5DAWA 5C3QA 3H3LA 4GKYA 4KH9A 1ZZCA 2VY0A 2ID4A 2WBKA 4PIZA 1W06A 4LBQD 1PMHX 1VP6A 1REEA 1QJEA 3ZMNA 5CKNA 4Q4Y1 3MICA 1RUF1 2P17A 1WUVA 2WJSA 4CEWA 1US2A 4YM1A 5ACA2 3PTYA 3OJBA 4NHMA 3RZJA 3THTA 2E9QA 2QQKA 3CKHA 4Q0UA 4QHZA 3MIHA 4XILA 5FLHA 5AC93 4XFFA 3MFCA 1YWKA 4CYDA 3CJIB 2BEOA 3T4HB 3ZIWA 5JSOA 4XF1A 4P9LA 2WO2A 4QQOA 3LAGA 4A3ZA 2A71A 4P9XA 4WVZA 5GLWA 3P1IA 1ULFA 3IM0A 3NJYA 3S6PA 2VMDA 1QJU1 5IVYA 3HN3A 4XFCA 5C8CB 3V0BB 4GH4C 1OVSA 4LULA 5A7SA 1LGBA 1GV9A 5FOJB 4FP3A 5JOWA 4Z07A 2N7GA 5L9BA 1HXS2 1RGSA 2QQIA 4AHWA 3VBRB 4SLIA 5GZDA 4OHXA 2Z69A 2Q1MA 1YQCA 2P4EA 3LA2A 3QLQA 5IVJA 4DXRA 4XBLA 3C8XA 1NZCA 4EQVA 3WG2A 3WSOA 4KBBA 2XDVA 1MPXA 1NT0A 4Q4Y2 2VNGA 4EJRA 3VKNA 1NAEA 2ZHLA 1Q56A 5BXXA 1D4M1 1XE8A 2BTVC 2HBTA 4R9AA 2CHHA 3USUB 5A3MA 4LT5A 5GLOA 3UNPA 1CZSA 4CP9A 1HKDA 4LQRA 1LEMA 4YZ1A 1JYXA 3S0MA 4QKNA 2XB6C 3F2ZA 4ARXA 4CU7A 1V6MA 2GP3A 4WZFA 2NYYA 3KT7A 5FYHA 4LMFA 3KHCA 5JXIA 4KC7A 1QJU2 5ACA3 2JDMA 3MLLA 2X10A 5GLRA 4OZXA 5FMDA 1ZBE1 2BZDA 4WM8C 4UDKA 3AKPA 2W2IA 2XR4A 2ZKLA 3DECA 3HJRA 4UDKE 1CVNA 1NE6A 3FN9A 2JDHA 4P9JA 4QXHA 1D0GA 1YUDA 1MS3A 3LGRA 3ZFFB 4BDVB 4AK3A 2VUAA 1DYKA 4AQTA 2UY8A 1NQJA 5JZGB 1I5ZA 1APNA 1XC6A 3E6CC 3NJXA 1ZZ8A 4NRQA 4UF0B 1QOTA 1O6UA 4AFMA 1GOGA 2AUYA 2PHLA 1VRH1 3PDQA 1KJRA 5AFEA 1HXS3 1D4M2 4YYOA 1ND3A 3UGHA 3ACIA 4MXWB 4XYXA 2DTYA 3WMYA 1OA4A 2Y64A 1POQA 3DUIA 2B42B 5BUVA 1X8MA 3UKVA 3VZKA 3VDBA 1EY2A 4XF9A 3U4XA 5F5AA 2XGXA 2CAVA 4IQPA 1RUF3 4E4ZA 2YC4A 5BNNA 4AVSA 3WF2A 1YC61 1UV4A 1WMEA 2OA2A 1LTEA 3ES4A 5GLTA 3T1LA 5J09A 5J48A 1ZBE2 1W04A 2IUWA 1UOGA 2YUEA 3AKHA 3VBFC 2Q30A 2WT0A 3DPRB 3DXTA 4PLOA 4XJWA 1W2UA 2JD4A 2ZHNA 3PHMA 5FY5A 1PVC1 3KMHA 3POGA 3KF3A 3VDAA 1SEFA 1QDCA 4MV2A 1VBE1 2RJKA 1QJU3 4LLOA 4CUBA 5IVFA 1J59A 4Y1YA 3AZYA 3I8TA 2OXBA 2A6XA 4AXOA 3IPVB 1CQ9A 4XMIA 3AVSA 1OFSA 3BPSA 5FZMA 4P02B 1H1MA 2YROA 1MEC1 5T5JA 1VRH2 4KNCA 4GJYA 2P2KA 3MF6A 2B8MA 1LAJA 4QPIA 4L97A 1GFF2 1VBA2 4DUWA 2OZ6A 3S5AA 2D6PA 2TEPA 4IV3C 1ZBA1 4FFHA 3FC0A 1YIPA 4UDGA 3WMZA 5FZOB 1OFNA 2JB8A 2BYVE 2VC9A 1EV12 5DAXA 3WAUA 4JKKA 2ZMKA 1D4M3 4QPGC 3NKGA 5CBLA 1KITA 1NA1C 4PF5A 2W92A 1ULGA 1U5ZA 1RVF1 2C26A 4K9SA 5DPNA 1TZOA 3KCYA 2JDZA 1W6OA 5F5IA 4XJ9A 5FZAA 1GZWA 5FZ9A 3CL1A 1UL9A 3NNLA 1YQ6A 4MSVA 3AL5A 4QHBA 1SACA 4OMCA 1W6QA 3C7HA 4XABA 3IIIA 5EYYA 1Z0HA 3Q8BA 4XZUG 3UL2A 1VBE2 2CNAA 4BJ0A 5CFCC 1C57A 3KGZA 1ZBE3 1VBD2 2YU2A 5AYCA 3OY8A 2UWAA 1MEC2 1NY71 2D43A 1BBT1 4UOJA 4TXWA 4PF1A 4ONZA 1FYUA 4R9CA 1VE0A 4CTEA 2DBNA 4LHNA 4YRDA 3WN0A 4AK6A 1XRUA 4FBFA 5DXDA 4CDUC 1VRH3 1W9WA 4D0QA 3J4UH 2K0GA 1DQ2A 1VMHA 1OPOA 4XXPA 1GQPA 1RVF2 4GA9A 3R0RA 4LKFA 1RINA 2VMHA 2ET1A 3FHQA 3VHPA 3VDCA 2ZGMA 2WSVA 2VQUA 1WLCA 3VD4A 5FZBA 3A23A 5FQ0A 5DAVA 1DQ4A 1DGLA 4QM8A 1GZCA 2Y6JA 1AR71 1PK6B 2K46A 2VZ1A 3DYPA 3MEPA 4K1YA 3BYWA 2VZSA 1GYDB 1DGWA 4Y3OA 2WINB 1AVBA 2ARCA 1GLHA 4LOTA 4W50A 2J1RA 3WNOA 1NY72 1BBT2 4ISRA 2JKXA 2VCMA 1PVC3 1V9U1 1N1VA 4CA9A 5GJ6A 1CAXB 1VBE3 1ZRRA 2XVLA 4B29A 3VZJA 1JMUB 2JX9A 1GYHA 4FPFA 1OKOA 4D6RA 4U2AA 4XURA 1NCRC 1U0AA 1UY0A 1MEC3 2AYHA 2WN2A 3VBOA 3WUDA 1JZ5A 2YY1A 3APBA 4JDMA 4BOWA 2J1EA 1G9AA 3ABZA 3T2TA 5L36A 4UW4A 2AGSA 1YLLA 2PHUA 2VBPA 4PJYA 3SC7X 4MG2A 1MZ5A 4FTBA 1ZBA3 5GZEA 5CFDA 2X29A 3J8F2 4XUTA 3WT3A 3MZHA 1ZZ9A 2RR12 5L9RA 1AR72 2GNTA 1AHSA 3NV4A 3CZJA 5FZEA 4CCEA 1QHDA 1RVF3 2YFUA 1G86A 3GF6A 2JG8C 1LCLA 2TUNA 3KQRA 2WZR1 1OA2A 1LHOA 2WABA 5FO7B 4G9SB 1N1SA 1QJX2 4WM7B 3SLIA 1V9U2 5H9PA 1QJZA 1N3PA 2CGNA 3AFKA 1AL0G 3C3VA 3H1YA 3MLJA 5L7OA 4YZ2A 3L2HA 5A6XA 4C8DA 5A3WA 4HSJA 3THDA 1F35A 1BBT3 3WN1A 4XJ8A 5FZ4A 5B4XA 4GD4A 3N7JA 3TNPB 3WCRA 5FZDA 2WR9A 1LNSA 4QKFA 4ZPIA 4CCOA 3PNAA 4DOUA 4L11A 4OUMA 5HI0A 2UWCA 5K0UB 1PZ7A 3VL8A 3X29B 4BHPA 4I01A 5F8PA 2D40A 4B8EA 1ZM1A 4N2RA 4HKOA 1S2EA 2P3JA 4QB6A 2XJPA 4R8HA 4W6WA 4NRPA 3HBKA 1O4YA 3J7LA 3RSJA 5J3UA 3AP6A 4XACA 4JGZC 4LE4A 3AZWA 3LFMA 3ZSJA 5FY7A 2VJXA 2P6HA 2WZR2 2XL9A 4HBNA 2BP6A 4I2OA 1UZZA 1UMHA 1W6NA 3E5XA 5CADA 1AR73 4RFT0 3KV4A 4KGQA 4LIVA 2YU1A 3N7MA 1YXWA 4FPKA 5L19A 2W9XA 1KDKA 3ELNA 1OLRA 4N53C 2E53A 5T50A 1RJ7A 3N36A 3AZXA 1MVQA 1RUJ1 1L3JA 5FMOL 4ATEA 4IL7A 2VUDA 5A3TA 4IEPA 3OD4A 2LROA 4XF4A 4QGNA 3ATGA 1V9U3 5JI9A 4MUVA 1X82A 5A7QA 3O7OA 4WVVA 3UETA 3BTAA 3EBRA 2WWJA 4IEWA 1MZFA 1LECA 1E5RA 1C5IA 3G7DA 1DU3D 3RQ0A 4PVAA 4OFGA 3LKJA 1UXXX 1V6OA 4TYSA 1NCRB 1TMF1 3ZFGB 1XXNA 2IXHA 4AHZA 4BQ3A 1R1ZA 1OVPA 4L9BA 3SCGA 1OQDA 3M70A 4W8JA 1UQXA 2QQVA 3PVEA 3EB7A 5FBJA 3SH3A 3WW3A 2HLEA 5JXHA 2FZ1A 3RZZA 5CG9A 2WL1A 1NX9A 2QQLA 4DXTA 3MUY1 4UI9L 3LB9A 4HLTA 1RUH1 3OBAA 3GZEA 2GMEA 5T5OA 3RYKA 2C1FA 1XNBA 3DEMA 4HANA 4LBKA 2GP5A 1A6CA 1M06G 1RUJ2 1HV1A 2WZR3 4I09A 5DN2A 4K6BA 4K7JA 2VBDA 5FZ6A 1PX4A 4JHZA 3VBHC 5FP8A 2JB4A 5DQ0A 5A70A 2WQ4A 3RZGA 4BQWA 1PZ8A 3W5NA 3ZSEA 3WP5A 3HNMA 5IATA 3PIJA 3NV2A 4RS5A 2WNUC 2CL2A 2A5ZA 2B39A 4BQ4A 4CDQA 1AJKA 5JUVA 2R041 4E4SA 2Q8OA 4MGZE 3O0WA 2X5IA 3ITQA 4KU7A 1IKPA 1MS9A 1J83A 4PDWA 4GXLA 1PGL1 3HOBA 3AMQA 3LEMA 3MLKA 5JDBA 1HQNA 4MGTA 2JG9A 5C4WB 5I0DA 5A80A 2R7EB 1RUH2 1AZDA 4PIYA 2UYAA 3MIGA 2OYZA 1JUIA 5ISLA 3FLTA 4ET7A 3P3NA 5IFTA 1H8TB 1JN2P 3U0ZA 2DV9A 3WG1A 3CQOA 1OA3A 4AVVA 2QDNA 4E8CA 4FFGA 2JIJA 3ZSMA 3M1HA 3GHNA 2RVAA 2VOWA 1VAKA 2V5DA 4MLGA 5HXMA 2V5YA 5FKBA 4CP1A 3D61A 3I2OA 5FZFA 1QXJA 1TL2A 5CNAA 1RUJ3 4I0BA 3ZKUA 1O3RA 1ZYBA 1A8MA 1C5HA 1ND2B 2ILMA 2R042 3I59A 4HVOA 1PMJX 2VUJA 3KWVA 2WAAA 3EJKA 3LDBA 3RS6A 3OTFA 3T2QA 4E2SA 5BNPA 1MQTC 5DABA 5JLVA 4LE3A 1F5JA 3ETQA 3LEIA 1QIQA 2FBEA 1UOBA 1TG7A 1PGL2 5C7GA 2E63A 5BNOC 1MS5A 1KS4A 1GICA 3WG3A 4GKXA 3W20A 5HBAA 3WR0A 3FHAA 3T08A 2LW8A 1TMF3 4UDIA 4N7IA 3OPTA 5H9SA 1ZRCA 1QWRA 2E51A 3WQ1A 4ZHNA 5F6LB 5FXZA 1IS3A 1O3TA 2FCVA 2GAUA 3NL1A 2CDOA 2VZ3A 3AMMA 1JXNA 4RR3B 1UAIA 3CJIA 5FY0A 3UJQA 2RS51 2HWD1 1ZZBA 1VIWB 4PI0A 5E88A 2UYBA 3H9AA 3WDXA 1RUH3 1OQ1A 1SLCA 3ECQA 4SBVA 2ZGUA 4CCCA 3VSZA 1SBDA 3V0BA 3AYDA 5C8CA 1ULPA 3QC2A 4N43A 2VGDA 5KBFA 4NRMA 4TLFA 5J37A 3MF9A 4CCNA 1ODNA 3H1WA 3VB9A 4BH9A 4HKLA 3PVOA 2GU9A 3VBHB 4BU2A 5GLLA 1XU2A 2P37A 3VBRA 3D82A 5I0UA 1T6GC 3AL6A 1JYWA 1FV2A 3UESA 2W1WA 2WRAA 4H7MA 4NN0A 5EPAA 5EV7A 5H9QA 1HRV1 1TQ5A 1WCKA 1Y7BA 3A0NA 3DV8A 4DEVA 1LGNA 2J7MA 2RM21 3K77A 1N3OA 3OGRA 2PELA 2XJTA 4LKSA 2WNUB 4Q4X1 2R043 5T3NA 1JODA 4AI9A 4XHBA 3BN6A 1V6KA 4BLIA 4HVQA 2PLV1 1GU3A 1CZTA 2Y0IA 3U37A 2JEMA 4LNVA 1RUI1 4AHXA 5LEJA 3USUA 2EAKA 3BB6A 1GWKA 1WZXA 2DUPA 3HNBM 3MV11 2HWE1 2OQ6A 2R071 5FZIA 5TSWA 3OM7A 4O9EA 3MIDA 4EV0A 5F37A 5IK5A 2YBKA 4QKDA 5FYYA 1JZ4A 3M2MA 5F7UA 1DLLA 3RZLA 2LALA 1JU4A 2R16A 2QFEA 2XJSA 3GGLA 3WNXA 1J84A 2VZOA 4NWWA 4Z1VA 4IDZA 4MXVA 4JRLA 5I0SA 1A34A 3VZNA 2ZJCA 1LOFC 2GH8A 2HYXA 3I3DA 4IV1B 4AVTA 4XQWA 2GH2A 3ZFFA 4GAZA 3RYPA 1I1EA 2VTXJ 4XBNA 3HQXA 3KCCA 4DIQA 5JZGA 1X9TA 4OQ9A 1HRV2 3HNYM 4JDNA 1YO8A 5IJRA 1G9FA 2W1QA 1R092 3J9SA 4JQRA 1RUC1 2DVBA 4COYA 2BPA2 1SFPA 1OH4A 5FUNA 2RJ2A 2D3SA 3N9NA 2Y0OA 1K12A 4QKBA 3RG0A 2JE7A 2PLV2 4XFGA 3WOGA 3T4VA 3R4YA 1HN1A 1RUI2 5T54A 4MXWA 1SHWB 3CJXA 3POJA 5DUUA 2OQ7A 4XDOA 3AMHA 3VSRA 2HWE2 1BQPA 3JB8A 4Y5SA 5FY1A 3I2GA 5LRRA 2B4WA 2NPIA 3DF0A 2SBAA 2WIIB 4XFIA 1MS8A 3R4DB 4UT5A 4NPLA 3AX4A 1CN1A 2BWCA 4AQ6A 2A1XA 2J22A 4CSWA 3ZN6A 2SLIA 4RN5A 3B02A 3G6JB 4JGYB 4LPLA 4JHTA 4AWDA 5A8CA 4A2UA 3DPRA 2E26A 2QQJA 3HPNA 2RS53 2HWD3 4H2AA 4Q0SA 1GNZA 5C5TA 1DIWA 4LBLA 4PI2A 3O12A 1H30A 2WDBA 1OT5A 3H8OA 4FXGB 4MHUA 3O1OA 4HN0A 3RNSA 3N9OA 2WO3A 5FPVA 3N9QA 1W39A 1QF3A 2JDAA 3IPVA 1IZ3A 4XCAA 1RUC2 3ILNA 4QAWA 5KXDA 2J1TA 4DEQA 4INDA 3U78A 1F15A 5EWSA 2Y6GA 2QQWA 5HCFA 1CIWA 3VZLA 1LOEA 4HN1A 1ZNPA 3SXWA 3TEZA 3SH4A 3AYAA 4CDXB 1W8UA 2GC2A 3HAGA 3LV4A 1JOBA 1TVGA 1H6YA 2ZPXA 2ZA9A 3A4UA 1HRV3 2ADEA 2VECA 5EHDA 4AI1A 5FO8B 2PFWA 4QB2A 1RUE1 2RM23 5FZOA 3VHOA 4Q4X3 2EXIA 2IZWA 4YM0A 2A75A 4EWDA 2IXKA 1ASJ1 3WF4A 3AYCA 4FTEA 2PLV3 5DUWA 1S4CA 3S5QA 1EPWA 1RUI3 2R061 3Q8AA 4FPGA 4IE0A 2LRPA 4W6YA 2EAAA 1QQP2 4Y22B 3H3ZA 5CKQA 5C71A 2HWE3 4QXBA 2R073 2VL4A 3LA7A 2V72A 3PUQA 4EN8B 5FZ7A 4I02A 2G1MA 5DZEA 3VD5A 4AGGA 4K3UA 2QCSB 2HJIA 1R64A 1SLBA 1WLDA 1GZ9A 1IPJA 2H6CA 4FQ4A 4OHWA 1GOFA 4CDWC 1DQ0A 2LUWA 4LO6B 4YNIA 1SLAA 3Q8EA 4KI5M 2QQPA 4N1IA 3NKTA 1C28A 4B1LA 1VBB1 5SV5A 1NCQC 4BA6A 3CO2A 2ZGOA 3IMMA 3ZN4A 1X36A 3JQXA 2A3XA 5JIAA 4Y33A 4QPYA 2QQMA 1RUC3 3KV6A 3AP7A 4E27A 3FUQA 2Y60A 1FAYA 3T0BA 5JVVA 4IEVA 5JI7A 1K5MB 5B6TA 1FNYA 2ZACA 4XJZA 1G6NA 1NG0A 2YGMA 1GWMA 5M0TA 1UZVA 3K3OA 3KCXA 4LK6A 1UYZA 1WW6A 4QDSA 4RQPB 5FP3A 3VBSA 4LBQB 5FPUA 2VVFA 2AC1A 1SLLA 3VHRA 5ABJB 1WBLA 2ZGPA 1ZA4A 1S0EA 1LOCA 1K3IA 2BERA 1PK6A 5IYYA 1NXD1 1ZZ7A 1YQ2A 1LOGA 2VMCA 3QACA 3LWCA 1IS4A 2Q4SA 3DYOA 3M3QA 1BVP1 1O5UA 1CZVA 4AQ2A 3GJBA 5KHJA 4K1ZA 2F4PA 1YI7A 1SQ4A 2R6QA 3TAYA 3SITA 2CWSA 5IK4A 4PVIA 2Q1FA 1CAXA 3I97A 5IW0A 5J36A 2VZQA 3K4AA 2YC0A 3DGTA 4OLLA 4D3WA 1GOHA 1IG0A 4WVWA 4BB3A 1HB3A 4PQQA 4NR1A 2W52A 1JHNA 4HFSA 3RFRA 3T0AA 3D8CA 1PO22 3FHIB 3HEIA 1IS5A 2WFF2 3V56A 2HBUA 2IXLA 3SHRA 1QJFA 1UPIA 2JENA 5FPZA 2GC3A 4L92A 4Q0QA 4Q2FA 1GSLA 1FATA 3WPVA 5IVBA 1RUE3 3ZYFA 1Q5OA 3GALA 4FAGA 5JOXA 2ZHMA 1RUD2 3NMBA 1O4TA 1ASJ3 1RYYA 2FDIA 4ZONA 5LA2A 1AXKA 4XFAA 5J98B 2R063 2GC1A 4MGYE 3PLQA 2WO1A 4H14A 2PA7A 1ONAA 3ZDVA 5A7OA 4WM7A 4CEYB 3O1UA 1T2XA 4IEYA 4DY3A 5HV4A 1W6PB 4KWUA 5GLKA 4LA2A 2B9VA 2C24A 3VDDC 2VVEA 4AGVA 4NHXA 1X33A 4XBQA 3OBZA 1UYXA 1OUXA 4EWEA 3ZFEA 4DO0A 1VBB3 4YG6A 5FYMA 1WD3A 4AEDB 3AKIA 1CESA 3E6DA 5L73A 2H0BA 3KV9A 4V2WA 4XDPA 5GLPA 2VVDA 4XUOA 2BDRA 4HVRA 5K0UA 3Q8FA 4Y1VA 3LQCA 4LITA 4CCKA 2YGLA 3PUAA 3NAPC 1Y43B 2FDHA 3WPZA 1Q8SA 3EQEA 1U5YA 1WLWA 1H1IA 1W8HA 3J7HA 3VBUB 1QDOA 3ZMOA 3WD5A 1G8WA 2OPWA 3BUCA 2P34A 2WC2A 5GZFA 1SPPA 5E16A 2GN3A 4KWKA 3GZUC 3HT2A 1HRI1 1C1FA 2JDKA 5DZGA 3WQ0A 4AZZA 5IK8A 1F2NA 1XYNA 3AXEA 3ZXGA 3ZXLA 5K8SA 4Z82A 5A8DA 2ZEYA 5C9AC 1CPNA 1JS9A 1XNAA 2BNNA 4YM2A 4HONA 3BALA 2IVIB 3O1PA 1Z78A 2FHRA 4A42A 2NQYA 1YIFA 2CTVA 2FMYA 1W8FA 1OOPC 1AL21 3MHZA 2D97A 3OUIA 1ZRFA 3POYA 5FWEA 4OCTA 2JKBA 5D1IA 5FYIA 1PVXA 2JECA 2VCAA 4DZGA 4ZKTB 2ORZA 1PM7A 4R4XA 3RZKA 4IESA 5E6HA 1HLCA 4R4ZA 1BCXA 2ARAA 4XQDA 2E7TA 3ZFGA 4Z2AA 4AK7A 4QHOA 3P2NA 3HIFA 1VBA1 4EN9B 3RZMA 3OPZA 2W0XA 3S30A 1F8VA 1V6LA 1Y3TA 1COV1 2XJUA 5E89A 4ZU4A 2B5HA 4Q4Y3 1CONA 1V6IA 4YW2A 1EV11 1HRI2 1Y9QA 3T30A 4ZU5A 3WF3A 3KF5A 3VT2A 3NQHA 3BYLA 2QJVA 1CAUB 1LU1A 2DDUA 3HBZA 1B35C 2VULA 3LZZA 5GM0A 4YZ3A 2JIGA 2RMU1 4A41A 4DRRA 1T6BX 5LASA 4IEXA 2VZRA 1KEXA 2FMDA 1BMV1 3RPQA 1SBFA 5GLUA 4DMIA 4AYUA 1QKQA 4BZ4A 3IN9A 3WP4A 2UWBA 1AL22 2R49A 2PYTA 3NNGA 1UXZA 4HXCA 3ZYJB 3PMSA 3P6BA 1XNKA 4FPYA 2D3PA 3S7EA 5GLNA 1H1AA 4CUCA 5CIRA 1VBD1 4K21A 3B3QE 4GH4B 3DCQA 1KJLA 4YVWC 1S0CA 3KVAA 1CWPA 3BU0A 2ETEA 1RJ8A 3KM5A 4B7KA 1UY3A 1U5IA 1W2AX 1VAMA 4NIAA 4Y26A 4BISA 1COV2 4KBZA 1FXZA 1P8JA 2O8QA 2IFRA 4EN0A 3BYNA 3ZYHA 3RI8A 4M01A 5C4WA 4PCRA 3CNAA 4YW5A 1SCRA 3MIBA 2PXJA 3BIEA 1KGYA 3OUHA 2XG3A 3IAQA 4YW3A 2GNMA 2E7QA 1OC1A 2RMU2 2XHNA 4I30A 4NROA 4WZCA 1H8TA 4YFWA 5GKAC 2Q8CA 3ZOIA 2VO5A 4QGLA 2NMOA 1BMV2 1F31A 2EICA 1VMJA 4N9HA 2HWC2 2QKDA 1S2KA 3K4DA 1HRI3 4Z2WA 2FD8A 4O8PA 1FNZA 3SEPA 1UX6A 3LE0A 3V65A 3I3MA 1UOFA 3NV3A 1QEXA 4CEWC 2WWSA 2XWJB 4S2HA 3U14A 1UIJA 3N35A 4ZS2A 5F5CA 4Y1UA 4WM8B 3WDUA 5LBBA 2ZX0A 3SKVA 5C9AB 2WWUA 3NNMA 4DUVA 5LCWL 1ND2A 1S0IA 3OG2A 2I45A 2VTFA 5FY4A 1AL23 2NLRA 1OXCA 4X6QB 4CCJA 4BQ1A 1GUIA 1MACA 5A1AA 1OOPB 4UFJA 2ARXA 3V0AB 4XFBA 2RS11 4O61A 5A3UA 3UKTA 4KCBA 4NPMA 4O7XA 3CHXA 1W9YA 1UKGA 3WX5A 2P5BA 1VPHA 1L7LA 2OS2A 3VD9A 3VT1A 2Y8KA 1W18A 3M3EA 2ZX4A 1VBA3 3WVJA 5F3CA 3R67A 2ATFA 3WDVA 1ENQA 3KT1A 4AI3A 4BXSV 2J1VA 4COUA 3K2OA 1COV3 5C5UA 2BFUL 3J8F1 4RR3A 1CD3G 2FZ2A 2RR11 5F32A 3T2OA 1XQNA 1EV13 5A7VB 4EROA 1LKNA 2IC1A 3C2UA 2XJVA 4LXLA 3IDEA 4RL7A 1QJY1 2RMU3 2YBPA 4GULA 4RGKA 4OI1A 3U10A 4EYUA 1AR62 1PX3A 4JZRA 3ZXDA 5LA9A 1GKBA 3VBFB 4A6OA 1QJX1 3IDCB 5B2GB 1XNDA 5GZCA 2ZGRA 3VBHA 3TAWA 2AACA 4QQ2A 4IE5A 4Q1RA 1VBD3 2RS12 3NJZA 4EN7B 2BRTA 4HMZA 4JRAA 4EZ4A 4V1PA 2DUQA 4DINB 2QNKA 1REFA 4FCAA 1XE0A 1G7YA 4CUAA 3QEFA 5FPBA 2J1SA 2WNUA 2OVUA 4NAMA 3N9PA 4HKWA 4YVWB 1W8WA 1TME1 1OUSA 1N47A 2XLFA 4URTA 2XBO1 3H0OA 4CCMA 1H2LA 2W91A 2XQRA 3OYWB 1JTZX 2WA3A 2CDPA 1UYYA 4IV3B 4FPOB 4QXKA 3RI9A 2NN8A 1IS6A 1U12A 2YC2A 1ULOA 1PNFA 1GWLA 5A33B 4LHKA 1W8NA 3GM8A 4PIXA 3QEEA 2ENRA 1QJY2 1PIV1 1WD4A 2GMPA 1NA1B 1ND3C 2V09A 3IAPA 3PTRB 4QPGB 5FJKA 5F1RA 1JYVA 1C3HA 1WCQA 2VTXA 2E32A 3ETPA 4IV1A 2W3JA 3ACHA
chains in the Genus database with same CATH topology
5AYCA 4UFMA 1Y4WA 2EXKA 4N4BA 4ONZA 3LIGA 5FMCA 3C7OA 4UFIA 3WPUA 4B1MA 3U1XA 2QQWA 2X8TA 4UDIA 4U6BA 5JOYA 3BYNA 3ZR5A 3WN0A 5GLOA 5GLMA 4AK6A 3U75A 3LV4A 5GLKA 4O8OA 3QZ4A 2ADEA 3AKFA 4U6DA 5AYEA 5AY9A 4KC7A 5FMBA 3ZR6A 2EXIA 2ADDA 5A7VA 5GLRA 3AKIA 5FMDA 4KC8A 4UDKA 3C7GA 4KMIA 3D5YA 4N2ZA 4CCCA 3S5QA 4O8PA 5GLPA 3VSZA 4COTA 3BYKA 3QC2A 4UDKE 3LDRA 4PVAA 3U14A 4AK5A 5FK8A 4O8NA 5GLLA 3ZXKA 3D60A 4UDJA 1GYDB 3WN2A 1Y9MA 3KSTA 3WPZA 2EXHA 4NOVA 1ST8A 2QQVA 3K1UA 3WPYA 3ZXJA 2QQUA 1Y7BA 4KCAA 4UFJA 4N1IA 4KCBA 5ANNA 3UGHA 3R4ZA 4B1LA 2VDTA 3WMYA 3D5ZA 4D47A 3OM4A 3RWKX 3IMMA 4AZZA 3VT1A 3UGFA 5JOZA 1GYHA 1W18A 3ZXLA 3VT0A 3C7FA 4UFKA 3R67A 5A8DA 5FKCA 3OM7A 3WASA 1UV4A 3PIGA 2EXJA 3CU9A 1YIFA 3AKHA 3SC7X 5A7VB 5B6TA 5FIXA 3PIJA 3C2UA 3QEDA 1UYPA 3KF3A 3OM6A 3H3LA 1GYEB 5B6SA 2AC1A 4CCEA 2AEZA 2OXBA 3UGGA 3LDKA 1PT2A 3TAWA 3P2NA 4AK7A 3LEMA 1WL7A 3VSFA 3VSSA 3OM5A 4UFHA 3LF7A 3C7EA 3WATA 5AYDA 1YI7A 2YFTA 4QHZA 3R4YA 4JQTA 3QEFA 3KF5A 4PVIA 3VT2A 4FFHA 3NQHA 3BYLA 5FLWA 4UDGA 5GLQA 3WMZA 3VSRA 4FFFA 3WN1A 2XQRA 4QQSA 4FFGA 3WAUA 4CCDA 2B4WA 1Y9GA 4MLGA 3BYJA 4FFIA 2X8FA 5FKBA 3D61A 1W2TA 1YRZA 5JOWA 4HXCA 3OM2A 5GLNA 3QEEA 3OSDA 2X8SA 5A8CA 3LIHA 4N2RA 2YFSA 3C7HA 5FK7A 2AEYA 1OYGA 3AKGA 5C0PA 3WPVA 1VKDA 3LFIA 3HBKA 5JOXA 2YFRA 3NMBA 4UFLA 4EQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYC A;  4UFM A;  1Y4W A;  2EXK A;  4N4B A;  4ONZ A;  3LIG A;  5FMC A;  3C7O A;  4UFI A;  3WPU A;  4B1M A;  3U1X A;  2QQW A;  2X8T A;  4UDI A;  4U6B A;  5JOY A;  3BYN A;  3ZR5 A;  3WN0 A;  5GLO A;  5GLM A;  4AK6 A;  3U75 A;  3LV4 A;  5GLK A;  4O8O A;  3QZ4 A;  2ADE A;  3AKF A;  4U6D A;  5AYE A;  5AY9 A;  4KC7 A;  5FMB A;  3ZR6 A;  2EXI A;  2ADD A;  5A7V A;  5GLR A;  3AKI A;  5FMD A;  4KC8 A;  4UDK A;  3C7G A;  4KMI A;  3D5Y A;  4N2Z A;  4CCC A;  3S5Q A;  4O8P A;  5GLP A;  3VSZ A;  4COT A;  3BYK A;  3QC2 A;  4UDK E;  3LDR A;  4PVA A;  3U14 A;  4AK5 A;  5FK8 A;  4O8N A;  5GLL A;  3ZXK A;  3D60 A;  4UDJ A;  1GYD B;  3WN2 A;  1Y9M A;  3KST A;  3WPZ A;  2EXH A;  4NOV A;  1ST8 A;  2QQV A;  3K1U A;  3WPY A;  3ZXJ A;  2QQU A;  1Y7B A;  4KCA A;  4UFJ A;  4N1I A;  4KCB A;  5ANN A;  3UGH A;  3R4Z A;  4B1L A;  2VDT A;  3WMY A;  3D5Z A;  4D47 A;  3OM4 A;  3RWK X;  3IMM A;  4AZZ A;  3VT1 A;  3UGF A;  5JOZ A;  1GYH A;  1W18 A;  3ZXL A;  3VT0 A;  3C7F A;  4UFK A;  3R67 A;  5A8D A;  5FKC A;  3OM7 A;  3WAS A;  1UV4 A;  3PIG A;  2EXJ A;  3CU9 A;  1YIF A;  3AKH A;  3SC7 X;  5A7V B;  5B6T A;  5FIX A;  3PIJ A;  3C2U A;  3QED A;  1UYP A;  3KF3 A;  3OM6 A;  3H3L A;  1GYE B;  5B6S A;  2AC1 A;  4CCE A;  2AEZ A;  2OXB A;  3UGG A;  3LDK A;  1PT2 A;  3TAW A;  3P2N A;  4AK7 A;  3LEM A;  1WL7 A;  3VSF A;  3VSS A;  3OM5 A;  4UFH A;  3LF7 A;  3C7E A;  3WAT A;  5AYD A;  1YI7 A;  2YFT A;  4QHZ A;  3R4Y A;  4JQT A;  3QEF A;  3KF5 A;  4PVI A;  3VT2 A;  4FFH A;  3NQH A;  3BYL A;  5FLW A;  4UDG A;  5GLQ A;  3WMZ A;  3VSR A;  4FFF A;  3WN1 A;  2XQR A;  4QQS A;  4FFG A;  3WAU A;  4CCD A;  2B4W A;  1Y9G A;  4MLG A;  3BYJ A;  4FFI A;  2X8F A;  5FKB A;  3D61 A;  1W2T A;  1YRZ A;  5JOW A;  4HXC A;  3OM2 A;  5GLN A;  3QEE A;  3OSD A;  2X8S A;  5A8C A;  3LIH A;  4N2R A;  2YFS A;  3C7H A;  5FK7 A;  2AEY A;  1OYG A;  3AKG A;  5C0P A;  3WPV A;  1VKD A;  3LFI A;  3HBK A;  5JOX A;  2YFR A;  3NMB A;  4UFL A;  4EQV A; 
#chains in the Genus database with same CATH topology
 3CEW A;  1SFN A;  3PUR A;  3ORJ A;  5BNN C;  4AHY A;  5CFC B;  4C1W A;  5HCA A;  4XMA A;  3O1S A;  3NW4 A;  4LO4 B;  3LOI A;  1MZ6 A;  2YPD A;  2ZGL A;  1LHN A;  1TME 2;  1UU5 A;  2O1Q A;  3LCP A;  5JCT A;  2XBO 2;  4F3J A;  4TLG A;  3BU7 A;  1A78 A;  2VCB A;  2XHK A;  3PU3 A;  1LR5 A;  1NZI A;  2JD9 A;  1UZW A;  4HSL A;  2IFW A;  3P5B A;  2VBB A;  1DGR A;  4XW3 A;  3D5Y A;  4CDU B;  3BYK A;  1UIK A;  4B3N A;  1X8E A;  5FRA A;  1BK1 A;  1PIV 2;  1Q8V A;  1H2N A;  3VV1 A;  4JGY A;  1LRH A;  3J8F 3;  1VJ2 A;  4JVA A;  2RR1 3;  4Q1P A;  3IBM A;  4CXY A;  2D6N A;  4K8F A;  3ZXJ A;  5DUX A;  4FPJ A;  2F6B A;  3RYR A;  4I3P A;  4NUB A;  3BI3 A;  4FOV A;  5K7P A;  1S2B A;  2TBV A;  2GDF A;  2VR4 A;  2HWB 1;  2WZ8 A;  3CF6 E;  3HR9 A;  3K75 B;  1QJX 3;  4CPB A;  1OQE A;  2K9Z A;  2ZX2 A;  1OSG A;  3VT0 A;  3I2J A;  4XET A;  4MZU A;  2LM3 A;  4LR4 A;  3AKQ A;  4OI2 A;  3JZV A;  2Z42 A;  4CDX A;  3KQ4 B;  2H6B A;  4IEZ A;  2ZGN A;  4YW1 A;  1Q43 A;  3AYE A;  5IWF A;  4AEK A;  4XTM A;  3IWZ A;  4H55 A;  2CYF A;  1JOJ A;  2A6Y A;  1W6M A;  2PAM A;  3NRU A;  4I0W B;  5HV0 A;  4YGE A;  4NID A;  4LKD A;  1TNF A;  1VAL A;  1TME 3;  1AF9 A;  2X8T A;  1H0B A;  2XBO 3;  4Q8K A;  3JXS A;  3I2K A;  4FP2 A;  4GAL A;  4BK4 A;  3LA3 A;  1UZ0 A;  2OUJ A;  3JD7 2;  2NM1 A;  4QXC A;  3RVH A;  4AQS A;  3R4S A;  2G9F A;  2WS9 1;  1O5L A;  3I3Q A;  5J1X A;  5FYZ A;  4Y5Z 0;  4Y24 A;  2QUO A;  2PN5 A;  1HDK A;  5T5L A;  3GXU A;  5CG8 A;  1H6X A;  2QZ3 A;  4M0H A;  2ZZQ A;  1AUY A;  1FMD 2;  1PIV 3;  5KC5 A;  3N3H A;  2HWB 2;  4F8A A;  4LEJ A;  4CXX A;  2JG8 B;  3W5M A;  1RXF A;  4KG8 A;  4J25 A;  1JHJ A;  4YG3 A;  5F2S A;  5FYC A;  5CIS A;  4XC9 A;  4JDO A;  4RSU A;  3WV6 A;  1U5X A;  2EIE A;  4C0B A;  4FI9 A;  4FT8 A;  5T55 A;  1NLQ A;  4CCD A;  2BNM A;  2DUO A;  4PBP A;  2WUH A;  4QD2 A;  2F17 A;  4Y4R A;  4GQ7 A;  4E4H A;  2ZS6 B;  3Q9O A;  2BVV A;  2HEV F;  4YVS A;  3AZZ A;  1ODM A;  5EYX A;  3VZO A;  1Q8O A;  5GLM A;  1JZ3 A;  3DXU A;  3RRD A;  3BTZ A;  4XIO A;  1K5M A;  3MI8 A;  5G05 L;  2BNO A;  5FZ3 A;  2HEW F;  2W87 A;  1QNW A;  2JE8 A;  3B69 A;  5FK7 A;  3U11 A;  1V0A A;  2WS9 2;  5APA A;  3URF A;  4RQP A;  2VXR A;  4O9G A;  1JZ7 A;  4LOS A;  4WVM B;  4LBQ A;  1DYO A;  2UUR A;  1G9B A;  5GAL A;  2R0F A;  2VMF A;  5EJZ B;  5ABJ A;  3AP4 A;  2FDG A;  4JTO A;  3AC0 A;  1CAW B;  1H8V A;  1AR8 2;  4ZZ5 A;  4JGZ B;  3T1M A;  1CX1 A;  2WN3 A;  1OF3 A;  2XXZ A;  2XWB B;  3KV5 A;  3R4U A;  3WNM A;  5FZH A;  5CFD C;  5LZ6 A;  4NIH A;  4Q8L A;  3U07 A;  1DF0 A;  2RDQ A;  3UJO A;  5F3G A;  3K48 A;  1KDM A;  4HPK A;  3SNM A;  3HMY A;  2E6V A;  1DQ5 A;  3GJA A;  5GZG A;  1W9S A;  4D7T A;  2HWB 3;  4N53 B;  5LK7 B;  2O8O A;  3B9I A;  5FCC A;  1AX1 A;  4IGQ A;  1O7F A;  1DG6 A;  2RS3 1;  2Y33 A;  1W3V A;  1BHG A;  1HQL A;  1GAN A;  1LEN A;  4HET A;  4BWO A;  2FCT A;  2VME A;  1OLM E;  4M0N A;  5L7O C;  5FXX A;  4IEU A;  3GYD A;  3O1M A;  1RC6 A;  1D0H A;  2JDP A;  2ZX3 A;  4RGA A;  3E1F 1;  3VGI A;  1Y9M A;  5CKM A;  1QH6 A;  1K5J A;  4BIO A;  3WN2 A;  2PHR A;  3W9A A;  5K9Y A;  1LGC A;  4DFS A;  3PUH A;  4YFZ A;  2GC0 A;  3FL7 A;  5A7W B;  4HOO A;  4AR2 A;  4RHV 1;  2XPJ A;  3WW1 A;  1HB2 A;  3D5Z A;  3INA A;  2ZOE B;  2E33 A;  2WS9 3;  5B4N A;  1JI6 A;  2VQA A;  2WNV C;  3ACG A;  2VZT A;  4Y1X A;  4OHZ A;  3KT4 A;  3CLP A;  3VN4 A;  5KHK A;  3C7F A;  3I2F A;  3JBG 1;  1FPN 1;  2ARE A;  2QQO A;  3I7D A;  4CEY A;  1JYT A;  3MFA A;  4V2V A;  3ILF A;  4MO3 M;  1W6P A;  1RXG A;  3RJ2 X;  3FBM A;  1UMI A;  4Q4W 2;  4MLO A;  1UF2 C;  4KQ7 A;  2R0H A;  5FZ8 A;  4ZY9 A;  4NHK A;  5F6K A;  2RS3 2;  5FIX A;  5F9T A;  2J1A A;  4K20 A;  3QED A;  4AED A;  1AYM 1;  1GP6 A;  1I9R A;  1UYP A;  5F3E A;  1TNR A;  1HX6 A;  2V73 A;  1JZ6 A;  4IGP A;  1UW8 A;  5D2A A;  5FQ0 B;  2ERF A;  5JXG A;  1RUN A;  1R09 1;  3OGS A;  3O0V A;  1WA4 A;  2NP0 A;  1RUO A;  3UGG A;  3OGV A;  4U36 A;  5A3N A;  3KGL A;  1RIR A;  3F95 A;  2E31 A;  4BQX A;  4AG4 A;  1M4W A;  2P3Y A;  3SCH A;  3J26 N;  5A1F A;  3O1V A;  3GCW A;  3OUJ A;  4RHV 2;  2PHX A;  2A6W A;  3VBU A;  4DRV A;  1VB2 A;  1NE4 A;  5AYD A;  1UWW A;  2ZGT A;  2XKP A;  5JSR A;  4JQT A;  1CPM A;  1ULC A;  2EIB A;  5FPX A;  3JBG 2;  1FPN 2;  3WY6 A;  5AFB A;  5CB7 A;  1E5H A;  1ALY A;  5HCH A;  2KR2 A;  3T09 A;  2LS6 A;  1WMD A;  3IZO A;  4JC1 A;  2H0V A;  4DNY A;  1OF4 A;  4MGK E;  4X6R B;  1RMU 1;  1VLN A;  1DBN A;  3WHU A;  3H50 A;  1DGR N;  2CAU A;  2ZMN A;  4HK8 A;  4W65 A;  1HW5 A;  1AYM 2;  2BUK A;  1X9P A;  1TE1 B;  5EJ3 A;  3ZPO A;  1GP4 A;  2VXJ A;  5CFD B;  2YFS A;  1UU4 A;  2VW1 A;  3OBR A;  1PM4 A;  5EXO A;  1UCX A;  3LFI A;  1BJQ A;  1J1L A;  4C1X A;  5EFU A;  3MUZ 1;  4J1X A;  4JKM A;  4UF0 A;  4D94 A;  2GSY A;  3BKZ A;  4JCK A;  4QU1 A;  4BLJ A;  4M4R A;  2RS3 3;  4MGS A;  2WNE A;  4K8R B;  1H4G A;  3LIG A;  4S2D A;  2KA3 A;  4UFI A;  1MQT B;  2ZKN A;  4B1M A;  1GQG A;  2MNG A;  1MVE A;  4M3C B;  3ZR5 A;  3K3N A;  4U6B A;  5C6C A;  4FPL A;  1RIT A;  2DVD A;  3M3O A;  5L7O B;  5BNO B;  4RS5 C;  1SLI A;  2NMN A;  1C4R A;  4S2G A;  4D6Q A;  3SKJ E;  5CU1 A;  3WDT A;  4CDQ C;  4EZH A;  3OEB A;  2Q8E A;  4ISQ A;  4LHS A;  1IG3 A;  4CVU A;  4RHV 3;  1UD1 A;  2W5F A;  2XLA A;  4TN7 A;  1QQP 1;  2X5I C;  4QB1 A;  4I3G A;  3ZXA C;  1W9T A;  4YWA A;  1RMU 2;  4PDW C;  3FLP A;  3C7G A;  5DZF A;  4ZXK A;  5DMY A;  5FO9 B;  3TBD A;  1ZA7 A;  3JBG 3;  1FPN 3;  2WNV B;  1H9P A;  1CGP A;  5FUP A;  5IHR A;  5LWB A;  5FK8 A;  4FVV A;  5JPM B;  3OEA A;  1Q8P A;  2VPV A;  3A7Q A;  5LY2 A;  3ZYI B;  4ES8 A;  4P9G A;  3HVD A;  3CU7 A;  1E57 A;  4GH4 A;  5LA0 A;  1FX5 A;  2WT1 A;  2G9Z A;  1AYM 3;  3N7K A;  1YJK A;  3WLU A;  4KCA A;  1HIX A;  2DCJ A;  1DZT A;  3RZH A;  2KD7 A;  2PMW B;  2VDT A;  1LU2 A;  4NO4 A;  2OT7 A;  1O3S A;  1XYP A;  1JZ2 A;  1R09 3;  3WW4 A;  3SQO A;  4Q0P A;  2GNB A;  5FZK A;  2X8K A;  2C6S A;  4LUM A;  3V64 A;  3E97 A;  2FCU A;  5FRE A;  1CX4 A;  1W8O A;  2XH6 A;  1OBN A;  2BGC A;  5FMO S;  5H9R A;  5BNP C;  4RD7 A;  3DYM A;  4RYD A;  1OD5 A;  3VKM A;  3VZM A;  3O5S A;  4AFB A;  3K4Z A;  2PHT A;  1GMM A;  1C8N A;  3GNE A;  2DF7 A;  1J3R A;  1JOP A;  1Q3E A;  3WW2 A;  4EWA A;  3TN9 2;  4LA3 A;  1OKQ A;  4MVT A;  3I49 A;  3AKR A;  1GYE B;  4LO7 A;  4IXL A;  4LUK A;  1RMU 3;  3CIH A;  3ENR A;  4WM8 A;  3LEG A;  4AVA A;  3ZIX A;  5C9A A;  1PT2 A;  3ACF A;  1XPW A;  4QWN A;  3OPW A;  1LOB A;  2FDJ A;  4LBJ A;  4ATF A;  3VSF A;  3C7E A;  4IGO A;  2DU1 A;  4KWL A;  2OII A;  4IET A;  5C8W A;  1OOP A;  2XVK A;  3WNL A;  5C8C C;  4AI2 A;  2WKK A;  4OI0 A;  4N43 C;  1DHK B;  1PO2 1;  5BYN A;  2WFF 1;  2A70 A;  3EYP A;  2Q1Z B;  1Y9G A;  1WMF A;  3VBR C;  1AJO A;  4FAH A;  2X8F A;  2O14 A;  1PHM A;  4FXK B;  2R1B A;  4LK7 A;  4NPR A;  3BCW A;  3AKS A;  3H7J A;  2G19 A;  1XBF A;  1SDW A;  1RUD 1;  3ZYB A;  4AFA A;  2DCZ A;  4J6G A;  4Y20 B;  1YEW A;  5JSP A;  1WGP A;  3MBW A;  3B5L B;  4QX7 A;  3QH6 A;  1AXY A;  4UWD A;  2DCK A;  4JV4 A;  1QQP 3;  5A3O A;  5LBC A;  3QCW A;  3FMG A;  3GZA A;  4N7U A;  3ES1 A;  3VBF A;  2RV9 A;  4X8P A;  1O4Z A;  1S0F A;  2R30 A;  5G04 L;  2XUM A;  4DY5 A;  1IQD C;  3WHT A;  4B4Q A;  5HPO A;  3WP3 A;  3PJY A;  4FO9 A;  4A4A A;  4QPW A;  3FLR A;  1AX0 A;  1OI6 A;  2W94 A;  4ARY A;  3ALQ A;  1ZRD A;  5AY9 A;  4QMA A;  1HJG A;  1YFW A;  4N8M A;  4YVW A;  5FMB A;  1J58 A;  2DU0 A;  3ZFF C;  5I93 A;  3ILR A;  2BV4 A;  1QH7 A;  4UAP A;  3OYW A;  2HWF 1;  1RHI 1;  3OGG A;  5I0R A;  4N2Z A;  1GYK A;  3EHK A;  2OUH A;  4IV3 A;  3H42 B;  1W3X A;  3SIS A;  3T3Y A;  2EAL A;  4LHL A;  4OVE A;  1XNT A;  5A33 A;  2Y6F A;  3GCX A;  3ZYG A;  5JWP A;  2OX0 A;  4C0H A;  3ZXK A;  5KHG A;  4AGR A;  3I59 B;  4QPG A;  1EPZ A;  2ZHK A;  1NA1 A;  2KXL A;  3I2H A;  4RA0 A;  2ZTN A;  5D8A C;  3BTY A;  3TEY A;  4E2G A;  1PGS A;  1CJD A;  4E2Q A;  1QU0 A;  4LTA A;  4RGG A;  3FX3 A;  3B9C A;  4WBB A;  1ULD A;  3FFQ A;  2WLP A;  3R4Z A;  3PUI A;  5FBZ A;  4GB3 1;  1HB4 A;  3RWK X;  4CDW B;  1JYC A;  3HQU A;  5CFC A;  2BBV A;  3OM4 A;  1UO9 A;  2L9L A;  3J7N A;  4ES9 A;  1NKG A;  3DPR C;  4UFK A;  5IFP A;  1D2Q A;  3KSC A;  1UY4 A;  4COW A;  3TOJ A;  1NCQ B;  5FPL A;  3PIG A;  3ZKY A;  2HWF 2;  4KWJ A;  1RHI 2;  1STM A;  1WMX A;  1JW6 A;  4Y1Z A;  3WXP A;  1DP0 A;  1LJ7 A;  1PO2 3;  2BQP A;  2PHW A;  3POB A;  4LLF A;  4P9I A;  5CZK A;  5J96 B;  2WFF 3;  5C3O A;  1N1Y A;  1SLT A;  4KG0 A;  4JX0 A;  4UW5 A;  4CDU A;  1A3K A;  1V6J A;  4N43 B;  1NYW A;  3N7L A;  3OM6 A;  4YGD A;  4DQA A;  5B6S A;  3VL9 A;  3POE A;  3OB8 A;  1DZQ A;  2VMI A;  4A45 A;  4AAP A;  2YBS A;  2W08 A;  5IVE A;  2V4A A;  1PNG A;  1W03 A;  2JDY A;  2XLG A;  5C3R A;  2ES3 A;  5BY5 A;  1RUD 3;  1OYG A;  2BGP A;  2ZAA A;  3CMG A;  5C2M A;  2VW2 A;  1LOD A;  4UFH A;  4Y4Y A;  3MIE A;  5JMC A;  1WKY A;  3POS A;  4GB3 2;  3H7Y A;  4LO5 B;  1RUF 2;  2RHP A;  3B00 A;  1KXG A;  2I74 A;  5FLW A;  5CVR A;  3WG4 A;  2PAK A;  3POI A;  4QX2 A;  1UOJ A;  2XJQ A;  4AOC A;  3JQW A;  2J42 A;  2BGO A;  1MS1 A;  2ZZJ A;  1GNH A;  3GBG A;  1GQH A;  4FFI A;  5BNQ A;  1YNA A;  5I0T A;  2GAL A;  3OF1 A;  2W46 A;  1W2T A;  5IT6 A;  5LY1 A;  2XL7 A;  5FOB B;  3OM2 A;  2EVX A;  2C9K A;  5GLV A;  2AEN A;  4AE2 A;  4YG0 A;  1QXR A;  4OI4 A;  4EN6 B;  5CEH A;  3LIH A;  3NST A;  1XSR A;  1NCR A;  1XOY A;  5FZG A;  3WNN A;  1E5S A;  2FQP A;  4D7S A;  4UXA A;  4NIG A;  3OOX A;  2WO7 A;  4O65 A;  5HCB A;  5A32 B;  1W0P A;  4PQ9 A;  4MOA A;  1W9F A;  2HWF 3;  2WFP A;  4OUS A;  5FPA A;  2CV6 A;  1UKR A;  1RHI 3;  2MPF A;  3IDA A;  4UFM A;  4XUN A;  4URA A;  3T0D A;  4LKE A;  1ZRI A;  1XE7 A;  2EXK A;  2Y38 A;  2JJ6 A;  1EUT A;  3Q8C A;  1XB9 A;  2P3I A;  3FUO A;  2D3R A;  2X09 A;  5LA1 A;  5KHH A;  3U4S A;  3U75 A;  1GBG A;  5CA6 A;  2JG8 A;  2FDF A;  1LOA A;  2HWC 1;  5EZW A;  2XUE A;  5AVP A;  3VBS C;  2I2S A;  5D8A B;  1BK0 A;  2WYF A;  1W8Z A;  3M7A A;  4OHY A;  4GMP 0;  1XJA A;  4FPE A;  1PK6 C;  1WW7 A;  2MEV 1;  3MO4 A;  4GB3 3;  3CBN A;  3ST7 A;  4BYY A;  5J7M A;  3N4M A;  4KC8 A;  3VDD B;  3FJS A;  1LB2 A;  2W39 A;  1ENS A;  1YJL A;  1IQA A;  1J3P A;  4XE9 A;  4KMQ A;  3E5U A;  3ZN6 B;  1FV3 A;  4AK5 A;  1NLR A;  1S1A A;  2B45 X;  4TWT A;  5FZ1 A;  4Q29 A;  5IAV A;  4Q5O A;  3MV0 1;  5LAT A;  1TEI A;  3M8L A;  1XYO A;  3MGU A;  1DQ1 A;  1WCD J;  1L7R A;  3IMN A;  4NOV A;  3ZXE A;  3BPZ A;  3EXU A;  3B7M A;  2QQU A;  4BPZ A;  4GWM A;  4WVM A;  3IB3 A;  2WAO A;  1ULE A;  4D7Y A;  4L0P A;  3NAP B;  5A6Q A;  4JAA A;  3TWI A;  1I3H A;  1RL3 A;  1W0O A;  5FZ0 A;  4W6X A;  5JXJ A;  3RGB A;  1NXM A;  4C91 A;  1G9C A;  1CAW A;  3J7M A;  4JGZ A;  3UK9 A;  3AMP A;  4BQY A;  4GMP 1;  4B4R A;  3DKQ A;  4NHL A;  4DB5 A;  2PAE A;  3WEZ A;  5K4L A;  3USS A;  2QVS B;  2EIG A;  5FYV A;  4IEO A;  2MEV 2;  5LRS A;  4P08 A;  2VU9 A;  1AR6 1;  2IXC A;  4TZD A;  3QBQ A;  1W99 A;  3BGA A;  4AL9 A;  1BVV A;  4N53 A;  1N3Q A;  2ZGK A;  3DN7 A;  4HG6 B;  1V00 A;  4QQP A;  4OUE A;  1VB4 A;  4BQ2 A;  2JXA A;  4YSF A;  1ZRE A;  1AR9 1;  4WM7 C;  4GJZ A;  2A73 B;  2B9U A;  3KS7 A;  5CAZ A;  1KFU L;  1PVC 2;  2YG0 A;  4OHV A;  3E5Q A;  5FLI A;  4Z8B A;  2BBA A;  5FLJ A;  3D3A A;  3H1M A;  3N9L A;  3NVC A;  4MET A;  1EUU A;  3TEW A;  4A7K A;  3ZFE C;  4Q4V 1;  1D7P M;  1UPS A;  5A7W A;  3ZDS A;  1Q8Q A;  5A6Y A;  2BJS A;  4AVC A;  1CR7 A;  3OD0 A;  2DYC A;  5T5P A;  1HV0 A;  5EJ1 B;  3JB4 C;  4Q0V A;  4QX5 A;  2RDN A;  5K0U C;  1RED A;  5DG1 A;  1IKQ A;  4E8D A;  1I6X A;  1DDL A;  3ZN5 A;  2DUR A;  1LHW A;  3FE5 A;  1F4A A;  2G4I A;  2W1U A;  1ZBA 2;  2CU5 A;  3BYJ A;  3IKW A;  4AAX A;  2MHF A;  4CE8 A;  4XIK A;  1B35 B;  2WYS A;  2GMM A;  1WCS A;  3H8R A;  3KD4 A;  3VD7 A;  3RMY A;  4TTG A;  2HWC 3;  3OSD A;  3T2P A;  3ON7 A;  3IT8 A;  1JYN A;  1NOV A;  4ZXE A;  1V6N A;  2RJL A;  3I2D A;  3ROU A;  4B7E A;  1AR9 2;  1J1T A;  2C9A A;  4DPN A;  5C3S A;  1VKD A;  3VBS B;  5KXC A;  2YFR A;  2DWR A;  2MEV 3;  2Y34 A;  1ZZ6 A;  3VLB B;  2YMZ A;  1IOA A;  4I0A A;  3POW A;  3M4F A;  4Q26 A;  4QU2 A;  2VH9 A;  2Z79 A;  4L99 A;  1LHV A;  2D7F A;  2F4L A;  4FOY A;  4FOW A;  4QX8 A;  5F2W A;  3TB0 A;  2VM9 A;  4N4B A;  1KQR A;  1CAV B;  4Q4V 2;  4UBH A;  2DBI A;  3DKW A;  4KGG A;  2UY9 A;  4M4P A;  3POF A;  3TYJ A;  3MPB A;  1YFX A;  1SG3 A;  3PVB B;  4RFR B;  4ASL A;  1X50 A;  1H4H A;  1OH3 A;  3K51 A;  2D6O X;  2DFB A;  4AI0 A;  3M3C A;  4YW6 A;  3I2I A;  1W2O A;  1BZW A;  2DVF A;  2WNO A;  1ZVF A;  1YQ5 A;  1WLT A;  3KLS A;  3ZFG C;  4A44 A;  5F3I A;  4BE3 A;  1H2M A;  3BVC A;  4MX3 A;  5F5Q A;  1GNY A;  2RE9 A;  3RWN A;  3WNP A;  1KS5 A;  2DVG A;  4XQ4 A;  3VKL A;  4GMP 3;  4HT1 T;  2NZ9 A;  3ZXF A;  4YAR A;  3NWK A;  2JDU A;  4XHX A;  1KFX L;  5I8S A;  2Z2S B;  3D60 A;  4UDJ A;  5D21 A;  3KST A;  1EYB A;  1AR6 3;  1ST8 A;  3ASI A;  4CEW B;  3K1U A;  5T52 A;  5JR2 A;  5A7P A;  2Y6L A;  2VD7 A;  2TNF A;  3ZYP A;  1AR9 3;  4XUQ A;  2G9G A;  3A0K A;  4OQ8 A;  2DVA A;  2HYK A;  1PGW 1;  4LO8 A;  4M3C F;  1BEV 1;  1MQT A;  2AH2 A;  2BW8 A;  2RS1 3;  4PT6 A;  3ZPY A;  4M3C A;  3UV9 A;  4LJH A;  5KR7 A;  4JKL A;  4M3C E;  2CGO A;  4OYU A;  1FOD 1;  4N90 A;  5BNO A;  4NII A;  3R6S A;  4Q4V 3;  5FV3 A;  5DDJ 1;  2EXJ A;  3JCI A;  4QPI C;  4ZS3 A;  1ENR A;  3ZFE B;  4EE2 A;  3H8X A;  3QH7 A;  2ORX A;  3JD7 1;  4S2F A;  2VZP A;  2D5F A;  3D0S A;  3I4I A;  3ZYR A;  1UU6 A;  2IXJ A;  4M00 A;  2BWA A;  5FYS A;  3OCP A;  1OD3 A;  1POV 0;  3FFZ A;  3VKO A;  1H2K A;  2QZ2 A;  2WNV A;  3B01 A;  3B94 A;  2P6C A;  4W4Z A;  1QOS A;  1QJY 3;  1FMD 1;  5FP9 A;  5C4W C;  5SV8 A;  2GZW A;  2ZXQ A;  1S0G A;  5FYT A;  3LDK A;  3THC A;  4GWJ A;  4U6D A;  1LED A;  4L8Q A;  1H8T C;  4FOQ A;  5FY8 A;  1O8P A;  1QMJ A;  4CRQ A;  4OMD A;  1HJF A;  2OZJ A;  3MW2 A;  4P9Y A;  4CP9 B;  2X53 S;  1PGW 2;  5L9V A;  2C0Z A;  1BEV 2;  3VUO A;  1DCS A;  1SPP B;  3LSE A;  3K46 A;  1WCU A;  2ZBJ A;  1JUH A;  4FSJ A;  2YV8 A;  1FOD 2;  4QQS A;  2ZX1 A;  4F7Z A;  4DXS A;  5DDJ 2;  2PHF A;  2WT2 A;  3AMN A;  1LHU A;  2ZGQ A;  5I91 A;  1ND2 C;  4X8N A;  3LPG A;  5KWR A;  1DYP A;  1VMF A;  4PHZ A;  4Y22 A;  3MW3 A;  5FAX A;  3SEE A;  1POV 1;  3PME A;  3ZVX A;  5FFO C;  1EP0 A;  1C1L A;  1D2S A;  5JR7 B;  3SMH A;  3NO8 A;  1YYN A;  1UZY A;  3OGJ A;  3AKG A;  1YFU A;  3KVB A;  4DXZ A;  2LTN A;  2YYO A;  3UT0 A;  2ZEZ A;  5FY9 A;  4UFL A;  2VAU A;  2DFC A;  3PL0 A;  4XJA A;  3H8U A;  4NWV A;  1AR8 1;  2AR6 A;  5FUI A;  4CU9 A;  3THP A;  4YZ5 A;  4MH0 E;  1Y4W A;  4CCL A;  1ND3 B;  3TRS B;  1VBC 1;  1K45 A;  2VCC A;  2J1U A;  1R1A 1;  3MYX A;  4PLM A;  1LOF A;  5FMC A;  3C7O A;  4RR3 C;  2YZ4 A;  2P3K A;  3WPU A;  5AVA A;  3U1X A;  4H3W A;  4C90 A;  2VOX A;  2RDR A;  4IE7 A;  2O0O A;  3A21 A;  4AEM A;  3PVN A;  2XQX A;  3WUC A;  5DUV A;  5BNN B;  1IGO A;  3KZ4 C;  4O8O A;  4FQZ A;  5C3P A;  2JDN A;  1R08 1;  1UNB A;  2OPK A;  4XUP A;  3WP6 A;  5JPN B;  5FTT C;  2BOI A;  1UX7 A;  4FPC A;  3ZR6 A;  2ADD A;  3O0X A;  2VNO A;  3S7I A;  1PMI A;  3WIN E;  3UKN A;  1BEV 3;  1QGL A;  3VD3 A;  4COZ A;  1GP5 A;  4R52 A;  2Z4F A;  3MDP A;  3LDR A;  1UY2 A;  4NJ4 A;  5LBF A;  1WW5 A;  1QNY A;  4BM8 A;  1FOD 3;  1PO1 1;  4MAD A;  4QQL A;  4ZU7 A;  3VBO C;  4O8N A;  1X7N A;  1SCS A;  4BQ5 A;  2D6K A;  1ENX A;  3QD6 A;  2CSG A;  4Y20 A;  5DDJ 3;  4LOR A;  2XON A;  1W05 A;  1JU3 A;  2XOM A;  2V4V A;  2Y6K A;  3JD7 3;  3PJQ A;  2XML A;  2WLQ A;  1TMF 2;  1UY1 A;  3ACL A;  4QPI B;  1VBC 2;  5ANQ A;  3QOP A;  2AZ5 A;  1R1A 2;  2E7A A;  4P14 A;  5JIU A;  1YCI A;  4XOG A;  1CJP A;  4YGB A;  4R9B A;  5ANN A;  1E5I A;  4AEJ A;  4AF9 A;  3WDY A;  5E1R A;  4AFC A;  1FMD 3;  1AXZ A;  1BKZ A;  4Q4W 1;  4BME A;  4Z92 B;  3LPF A;  2IWG B;  2ZML A;  3EO6 A;  4Y5T A;  1R08 2;  5A3P A;  3HN1 A;  1MR5 A;  2BVB A;  1OLM A;  4QT6 A;  1F4H A;  1W6O B;  3WAS A;  4IV1 C;  1GZW B;  3AVR A;  2C5D A;  3AM2 A;  4J1W A;  1O91 A;  4P5Y A;  2OW4 A;  4PLN A;  1AX2 A;  3WQB A;  4TSV A;  4R9D A;  1W6Q B;  1QOO A;  1US3 A;  5KXE A;  1MZE A;  3SCF A;  1NUK A;  2XJR A;  1N1T A;  2WZP P;  3ZSL A;  4BCU A;  1PO1 2;  5FWJ A;  2YFZ A;  2VZV A;  2Q0A A;  3M3I A;  2D5H A;  2D6L X;  3IDB B;  3OY8 B;  2QE3 A;  2D98 A;  3GHM A;  2AEZ A;  2EF6 A;  1NLS A;  3E6B A;  3R05 A;  3RJR A;  4UW6 A;  4AI8 A;  1POV 3;  2DCT A;  3H3U A;  1S0J A;  3ZM8 A;  1D4V B;  4LIU A;  1QXP A;  1MS0 A;  1WL7 A;  1J3Q A;  2XVG A;  3AJY A;  3VSS A;  2B4K A;  3TEX A;  4IEQ A;  2Y26 A;  3WAT A;  3W21 A;  5BV6 A;  2YFT A;  3BOW A;  1ZX5 A;  1K42 A;  2BU9 A;  1XNC A;  3O1R A;  2B7Y A;  1RTV A;  3KB5 A;  1AR8 3;  4E9K A;  1SZB A;  2PQS A;  1JZ8 A;  5GLQ A;  4CDW A;  4FFF A;  2ZEW A;  1SBE A;  3GBF A;  1VBC 3;  4XCB A;  1BLZ A;  1R1A 3;  1Z7S 1;  2D44 A;  2XKO A;  3EMR A;  4JGY C;  2YDE A;  4H7L A;  4BXF A;  5C33 A;  4MYE A;  3ZSK A;  5IAX A;  2W68 A;  1NCQ A;  5IUQ A;  5DG2 A;  4MGI E;  1RUG 1;  2BFU S;  3I54 A;  1YRZ A;  1DZR A;  3UYJ A;  2X8S A;  1L7Q A;  1R08 3;  1WWY A;  1FT9 A;  2AEY A;  3D5O A;  4ORF A;  4P00 B;  5C0P A;  3AB0 A;  1UN1 A;  4XF3 A;  2OKX A;  5FR3 A;  3O14 A;  1FI2 A;  3OBT A;  5LBE A;  3BTX A;  2CGP A;  2A3Y A;  2QBX A;  2ZCW A;  5IK7 A;  4NE9 A;  2QDR A;  4XFH A;  4CDX C;  4L2N A;  4JTN A;  2A3W A;  3MW4 A;  3RDI A;  1XU1 A;  1PO1 3;  2Y6H A;  3I3E A;  4XAA A;  4A7Z A;  4CP2 A;  3LSD A;  4BMB A;  4D8M A;  3W58 A;  1EAH 1;  3B93 A;  3L2Y A;  3VHN A;  4P5H A;  5JOY A;  2CWM A;  3LOB A;  3NNF A;  1YFY A;  2VW0 A;  3VBO B;  2PQQ A;  1IPS A;  4Q27 A;  1MS4 A;  2PTM A;  5AYE A;  2UU8 A;  1KD7 A;  2ARB A;  5HXV A;  1Z7S 2;  5JAX A;  1S0B A;  3JUU A;  1W90 A;  5ERL A;  3O1T A;  2A6V A;  2YB7 A;  1ACC A;  2A6Z A;  3AP5 A;  4QDR A;  1W2N A;  2VOT A;  4XVH A;  4YW7 A;  3WF0 A;  4KMI A;  1RUG 2;  2WA4 A;  2RS5 2;  2HWD 2;  2IVJ A;  4Q4W 3;  4QQH A;  3GZT B;  4KL1 A;  3W59 A;  3HT1 A;  3AZV A;  3NV1 A;  5FXV A;  3AFG A;  2WZE A;  2YPJ A;  1JH5 A;  1SDD B;  2D93 A;  5KXB A;  4GWN A;  1IPK A;  1B09 A;  2DCY A;  2VZU A;  3D0J A;  1NQD A;  2JE9 A;  3WPY A;  4CU6 A;  5A32 A;  3FBY A;  4XF0 A;  2K2S A;  2EA7 A;  5LK5 A;  4ASK A;  1WW4 A;  3ZO0 B;  5DAQ A;  1YQ8 A;  3WDW A;  1EAH 2;  5EQU A;  1OLQ A;  4CU8 A;  4D47 A;  2VOV A;  4WV8 A;  1C8M 1;  4YVS C;  1CAU A;  3IIA A;  5EP9 A;  4HL0 A;  2HKX A;  4AFD A;  5FDB A;  5C70 A;  2RM2 2;  3FZ3 A;  3S57 A;  1XSQ A;  4Q4X 2;  1UMZ A;  3D6E A;  1K5M C;  5FJH A;  4LBN A;  2GN7 A;  1DQ6 A;  1I5P A;  1A8D A;  2I07 B;  4OUL A;  4UYB A;  5A1L A;  3L9J T;  4RQP C;  3TNQ A;  2JG9 C;  5D8A A;  3TN9 1;  5A3L A;  4ONU A;  3RMX A;  4DS0 A;  2HEY F;  5F39 A;  3CU9 A;  4NVP A;  2R07 2;  4LBM A;  2P1B A;  5ABJ C;  3WNK A;  1CIY A;  1LES A;  5IVV A;  4LBO A;  4XZP A;  1S55 A;  4N9I A;  4A6S A;  4AW7 A;  3VDD A;  1Z7S 3;  4D6S A;  1SFY A;  2C4X A;  5FYB A;  1V70 A;  4BK5 A;  3WZ1 A;  5GLZ A;  4YW4 A;  1O3Q A;  5LW9 A;  1YHF A;  1YI9 A;  2PHD A;  2VOK A;  3AJZ A;  1JYI A;  1QY4 A;  1RUG 3;  1W6N B;  4GWI A;  4CXW A;  4DUX A;  4IE6 A;  1OPM A;  3OM5 A;  3LF7 A;  1AYN 1;  1JBC A;  1H9W A;  3GBW A;  3SH5 A;  4D69 A;  2VUC A;  2X05 A;  5KC6 A;  4E4D X;  5LEK A;  1C8M 2;  5I8T A;  3BOD A;  4MGQ A;  2ZAH A;  3NAP A;  3LEK A;  4YPJ A;  4ITC A;  5A7N A;  1BYH A;  5EIY B;  2YXS A;  4IW3 A;  4CP0 A;  4QGM A;  1O8S A;  2KM2 A;  2B46 X;  4YM3 A;  1HB1 A;  2VNR A;  3WCS A;  4CZS A;  4XJU A;  1F5F A;  4FTS A;  1EAH 3;  2Z5W A;  5FP7 A;  1HN0 A;  1VAV A;  3WQ7 A;  2W1S A;  3AKT A;  2D6M A;  2W95 A;  5BPX A;  1HQW A;  3BIW E;  5I8Y A;  3NNJ A;  4XDQ A;  1VRB A;  1W6M B;  2HH9 A;  3N9M A;  3AP9 A;  2BOJ A;  4IER A;  1SMV A;  2QTW B;  1G9D A;  3HD8 B;  3ME2 A;  5FP4 A;  4ZZ8 A;  3CJI C;  2VQ0 A;  3HWJ A;  4QX1 A;  2VMG A;  2EID A;  5AC9 1;  2R1D A;  4HK9 A;  2WSU A;  3PU8 A;  3ZLI A;  2QQN A;  4IE4 A;  2ZGS A;  5LB6 A;  4GZ9 A;  4B4P A;  3GDB A;  4CEY C;  5IVC A;  3V0A A;  1OMI A;  4QX0 A;  2VE1 A;  3DL3 A;  1AYN 2;  2VNV A;  3A22 A;  3MPP G;  4PBO A;  3MIF A;  4CPB D;  2Q8D A;  2Q5T A;  2CY6 A;  5FZC A;  4NMI A;  1O59 A;  3ZX7 A;  4AED C;  4BIF A;  2ET7 A;  2ZAB A;  4GIQ A;  1VR3 A;  3QZ4 A;  5FYU A;  3AKF A;  1W0N A;  1URX A;  2RG4 A;  4F83 A;  2FDK A;  2WQ8 A;  1WBF A;  1BXH A;  4QM9 A;  5A7V A;  3P3P A;  4RS5 B;  1GZT A;  1S0D A;  1C8M 3;  3I3B A;  4HZF A;  4OZO A;  4QDQ A;  4XEZ A;  4COT A;  2IXI A;  1RUE 2;  3BOP A;  4A7Y A;  2GND A;  4CDQ B;  1DGW X;  4YVS B;  3D4K A;  1IHM A;  4YGC A;  3VBU C;  1B35 A;  4KU8 A;  4IUG A;  1ASJ 2;  2VG9 A;  2X5I B;  1LUL A;  5FZL A;  1RB8 G;  2R06 2;  4PDW B;  1F9K A;  2WQZ C;  4FPH A;  4P9W A;  5AC9 2;  3TN9 3;  2DTW A;  2EXH A;  4YLZ A;  4XPV A;  1KRI A;  2JG9 B;  5E8A A;  4A3X A;  1OUR A;  3CZU A;  5A6Z A;  3HQR A;  3KHB A;  4K40 A;  5DAP A;  5ACA 1;  4MHR A;  3NJV A;  3AXD A;  1W8T A;  3LD8 A;  1CAV A;  2JWP A;  2R32 A;  4YZ4 A;  3UGF A;  3VKF C;  5JOZ A;  2YHJ A;  4CUG A;  4XTP A;  1DFQ A;  3CDZ B;  5CYY A;  5JZG C;  1VBB 2;  4NOT A;  5KHI A;  2ZEX A;  5FKC A;  1PZ9 A;  4G4F A;  1W28 A;  4UBG A;  1AYN 3;  3WF1 A;  3AK0 A;  4COV A;  3PUS A;  5JMO A;  4HPK B;  1OHF A;  3JU9 A;  4XAE A;  2RDS A;  4AVB A;  3FWE A;  4NAO A;  4G3Y C;  4NHY A;  1DLC A;  5FXW A;  2W47 A;  2VQT A;  1GR3 A;  2A7A A;  2JIC A;  4QX3 A;  4ASM B;  1WA6 X;  5BNP B;  4XXA A;  1HXS 1;  4UW3 A;  5DAW A;  5C3Q A;  3H3L A;  4GKY A;  4KH9 A;  1ZZC A;  2VY0 A;  2ID4 A;  2WBK A;  4PIZ A;  1W06 A;  4LBQ D;  1PMH X;  1VP6 A;  1REE A;  1QJE A;  3ZMN A;  5CKN A;  4Q4Y 1;  3MIC A;  1RUF 1;  2P17 A;  1WUV A;  2WJS A;  4CEW A;  1US2 A;  4YM1 A;  5ACA 2;  3PTY A;  3OJB A;  4NHM A;  3RZJ A;  3THT A;  2E9Q A;  2QQK A;  3CKH A;  4Q0U A;  4QHZ A;  3MIH A;  4XIL A;  5FLH A;  5AC9 3;  4XFF A;  3MFC A;  1YWK A;  4CYD A;  3CJI B;  2BEO A;  3T4H B;  3ZIW A;  5JSO A;  4XF1 A;  4P9L A;  2WO2 A;  4QQO A;  3LAG A;  4A3Z A;  2A71 A;  4P9X A;  4WVZ A;  5GLW A;  3P1I A;  1ULF A;  3IM0 A;  3NJY A;  3S6P A;  2VMD A;  1QJU 1;  5IVY A;  3HN3 A;  4XFC A;  5C8C B;  3V0B B;  4GH4 C;  1OVS A;  4LUL A;  5A7S A;  1LGB A;  1GV9 A;  5FOJ B;  4FP3 A;  5JOW A;  4Z07 A;  2N7G A;  5L9B A;  1HXS 2;  1RGS A;  2QQI A;  4AHW A;  3VBR B;  4SLI A;  5GZD A;  4OHX A;  2Z69 A;  2Q1M A;  1YQC A;  2P4E A;  3LA2 A;  3QLQ A;  5IVJ A;  4DXR A;  4XBL A;  3C8X A;  1NZC A;  4EQV A;  3WG2 A;  3WSO A;  4KBB A;  2XDV A;  1MPX A;  1NT0 A;  4Q4Y 2;  2VNG A;  4EJR A;  3VKN A;  1NAE A;  2ZHL A;  1Q56 A;  5BXX A;  1D4M 1;  1XE8 A;  2BTV C;  2HBT A;  4R9A A;  2CHH A;  3USU B;  5A3M A;  4LT5 A;  5GLO A;  3UNP A;  1CZS A;  4CP9 A;  1HKD A;  4LQR A;  1LEM A;  4YZ1 A;  1JYX A;  3S0M A;  4QKN A;  2XB6 C;  3F2Z A;  4ARX A;  4CU7 A;  1V6M A;  2GP3 A;  4WZF A;  2NYY A;  3KT7 A;  5FYH A;  4LMF A;  3KHC A;  5JXI A;  4KC7 A;  1QJU 2;  5ACA 3;  2JDM A;  3MLL A;  2X10 A;  5GLR A;  4OZX A;  5FMD A;  1ZBE 1;  2BZD A;  4WM8 C;  4UDK A;  3AKP A;  2W2I A;  2XR4 A;  2ZKL A;  3DEC A;  3HJR A;  4UDK E;  1CVN A;  1NE6 A;  3FN9 A;  2JDH A;  4P9J A;  4QXH A;  1D0G A;  1YUD A;  1MS3 A;  3LGR A;  3ZFF B;  4BDV B;  4AK3 A;  2VUA A;  1DYK A;  4AQT A;  2UY8 A;  1NQJ A;  5JZG B;  1I5Z A;  1APN A;  1XC6 A;  3E6C C;  3NJX A;  1ZZ8 A;  4NRQ A;  4UF0 B;  1QOT A;  1O6U A;  4AFM A;  1GOG A;  2AUY A;  2PHL A;  1VRH 1;  3PDQ A;  1KJR A;  5AFE A;  1HXS 3;  1D4M 2;  4YYO A;  1ND3 A;  3UGH A;  3ACI A;  4MXW B;  4XYX A;  2DTY A;  3WMY A;  1OA4 A;  2Y64 A;  1POQ A;  3DUI A;  2B42 B;  5BUV A;  1X8M A;  3UKV A;  3VZK A;  3VDB A;  1EY2 A;  4XF9 A;  3U4X A;  5F5A A;  2XGX A;  2CAV A;  4IQP A;  1RUF 3;  4E4Z A;  2YC4 A;  5BNN A;  4AVS A;  3WF2 A;  1YC6 1;  1UV4 A;  1WME A;  2OA2 A;  1LTE A;  3ES4 A;  5GLT A;  3T1L A;  5J09 A;  5J48 A;  1ZBE 2;  1W04 A;  2IUW A;  1UOG A;  2YUE A;  3AKH A;  3VBF C;  2Q30 A;  2WT0 A;  3DPR B;  3DXT A;  4PLO A;  4XJW A;  1W2U A;  2JD4 A;  2ZHN A;  3PHM A;  5FY5 A;  1PVC 1;  3KMH A;  3POG A;  3KF3 A;  3VDA A;  1SEF A;  1QDC A;  4MV2 A;  1VBE 1;  2RJK A;  1QJU 3;  4LLO A;  4CUB A;  5IVF A;  1J59 A;  4Y1Y A;  3AZY A;  3I8T A;  2OXB A;  2A6X A;  4AXO A;  3IPV B;  1CQ9 A;  4XMI A;  3AVS A;  1OFS A;  3BPS A;  5FZM A;  4P02 B;  1H1M A;  2YRO A;  1MEC 1;  5T5J A;  1VRH 2;  4KNC A;  4GJY A;  2P2K A;  3MF6 A;  2B8M A;  1LAJ A;  4QPI A;  4L97 A;  1GFF 2;  1VBA 2;  4DUW A;  2OZ6 A;  3S5A A;  2D6P A;  2TEP A;  4IV3 C;  1ZBA 1;  4FFH A;  3FC0 A;  1YIP A;  4UDG A;  3WMZ A;  5FZO B;  1OFN A;  2JB8 A;  2BYV E;  2VC9 A;  1EV1 2;  5DAX A;  3WAU A;  4JKK A;  2ZMK A;  1D4M 3;  4QPG C;  3NKG A;  5CBL A;  1KIT A;  1NA1 C;  4PF5 A;  2W92 A;  1ULG A;  1U5Z A;  1RVF 1;  2C26 A;  4K9S A;  5DPN A;  1TZO A;  3KCY A;  2JDZ A;  1W6O A;  5F5I A;  4XJ9 A;  5FZA A;  1GZW A;  5FZ9 A;  3CL1 A;  1UL9 A;  3NNL A;  1YQ6 A;  4MSV A;  3AL5 A;  4QHB A;  1SAC A;  4OMC A;  1W6Q A;  3C7H A;  4XAB A;  3III A;  5EYY A;  1Z0H A;  3Q8B A;  4XZU G;  3UL2 A;  1VBE 2;  2CNA A;  4BJ0 A;  5CFC C;  1C57 A;  3KGZ A;  1ZBE 3;  1VBD 2;  2YU2 A;  5AYC A;  3OY8 A;  2UWA A;  1MEC 2;  1NY7 1;  2D43 A;  1BBT 1;  4UOJ A;  4TXW A;  4PF1 A;  4ONZ A;  1FYU A;  4R9C A;  1VE0 A;  4CTE A;  2DBN A;  4LHN A;  4YRD A;  3WN0 A;  4AK6 A;  1XRU A;  4FBF A;  5DXD A;  4CDU C;  1VRH 3;  1W9W A;  4D0Q A;  3J4U H;  2K0G A;  1DQ2 A;  1VMH A;  1OPO A;  4XXP A;  1GQP A;  1RVF 2;  4GA9 A;  3R0R A;  4LKF A;  1RIN A;  2VMH A;  2ET1 A;  3FHQ A;  3VHP A;  3VDC A;  2ZGM A;  2WSV A;  2VQU A;  1WLC A;  3VD4 A;  5FZB A;  3A23 A;  5FQ0 A;  5DAV A;  1DQ4 A;  1DGL A;  4QM8 A;  1GZC A;  2Y6J A;  1AR7 1;  1PK6 B;  2K46 A;  2VZ1 A;  3DYP A;  3MEP A;  4K1Y A;  3BYW A;  2VZS A;  1GYD B;  1DGW A;  4Y3O A;  2WIN B;  1AVB A;  2ARC A;  1GLH A;  4LOT A;  4W50 A;  2J1R A;  3WNO A;  1NY7 2;  1BBT 2;  4ISR A;  2JKX A;  2VCM A;  1PVC 3;  1V9U 1;  1N1V A;  4CA9 A;  5GJ6 A;  1CAX B;  1VBE 3;  1ZRR A;  2XVL A;  4B29 A;  3VZJ A;  1JMU B;  2JX9 A;  1GYH A;  4FPF A;  1OKO A;  4D6R A;  4U2A A;  4XUR A;  1NCR C;  1U0A A;  1UY0 A;  1MEC 3;  2AYH A;  2WN2 A;  3VBO A;  3WUD A;  1JZ5 A;  2YY1 A;  3APB A;  4JDM A;  4BOW A;  2J1E A;  1G9A A;  3ABZ A;  3T2T A;  5L36 A;  4UW4 A;  2AGS A;  1YLL A;  2PHU A;  2VBP A;  4PJY A;  3SC7 X;  4MG2 A;  1MZ5 A;  4FTB A;  1ZBA 3;  5GZE A;  5CFD A;  2X29 A;  3J8F 2;  4XUT A;  3WT3 A;  3MZH A;  1ZZ9 A;  2RR1 2;  5L9R A;  1AR7 2;  2GNT A;  1AHS A;  3NV4 A;  3CZJ A;  5FZE A;  4CCE A;  1QHD A;  1RVF 3;  2YFU A;  1G86 A;  3GF6 A;  2JG8 C;  1LCL A;  2TUN A;  3KQR A;  2WZR 1;  1OA2 A;  1LHO A;  2WAB A;  5FO7 B;  4G9S B;  1N1S A;  1QJX 2;  4WM7 B;  3SLI A;  1V9U 2;  5H9P A;  1QJZ A;  1N3P A;  2CGN A;  3AFK A;  1AL0 G;  3C3V A;  3H1Y A;  3MLJ A;  5L7O A;  4YZ2 A;  3L2H A;  5A6X A;  4C8D A;  5A3W A;  4HSJ A;  3THD A;  1F35 A;  1BBT 3;  3WN1 A;  4XJ8 A;  5FZ4 A;  5B4X A;  4GD4 A;  3N7J A;  3TNP B;  3WCR A;  5FZD A;  2WR9 A;  1LNS A;  4QKF A;  4ZPI A;  4CCO A;  3PNA A;  4DOU A;  4L11 A;  4OUM A;  5HI0 A;  2UWC A;  5K0U B;  1PZ7 A;  3VL8 A;  3X29 B;  4BHP A;  4I01 A;  5F8P A;  2D40 A;  4B8E A;  1ZM1 A;  4N2R A;  4HKO A;  1S2E A;  2P3J A;  4QB6 A;  2XJP A;  4R8H A;  4W6W A;  4NRP A;  3HBK A;  1O4Y A;  3J7L A;  3RSJ A;  5J3U A;  3AP6 A;  4XAC A;  4JGZ C;  4LE4 A;  3AZW A;  3LFM A;  3ZSJ A;  5FY7 A;  2VJX A;  2P6H A;  2WZR 2;  2XL9 A;  4HBN A;  2BP6 A;  4I2O A;  1UZZ A;  1UMH A;  1W6N A;  3E5X A;  5CAD A;  1AR7 3;  4RFT 0;  3KV4 A;  4KGQ A;  4LIV A;  2YU1 A;  3N7M A;  1YXW A;  4FPK A;  5L19 A;  2W9X A;  1KDK A;  3ELN A;  1OLR A;  4N53 C;  2E53 A;  5T50 A;  1RJ7 A;  3N36 A;  3AZX A;  1MVQ A;  1RUJ 1;  1L3J A;  5FMO L;  4ATE A;  4IL7 A;  2VUD A;  5A3T A;  4IEP A;  3OD4 A;  2LRO A;  4XF4 A;  4QGN A;  3ATG A;  1V9U 3;  5JI9 A;  4MUV A;  1X82 A;  5A7Q A;  3O7O A;  4WVV A;  3UET A;  3BTA A;  3EBR A;  2WWJ A;  4IEW A;  1MZF A;  1LEC A;  1E5R A;  1C5I A;  3G7D A;  1DU3 D;  3RQ0 A;  4PVA A;  4OFG A;  3LKJ A;  1UXX X;  1V6O A;  4TYS A;  1NCR B;  1TMF 1;  3ZFG B;  1XXN A;  2IXH A;  4AHZ A;  4BQ3 A;  1R1Z A;  1OVP A;  4L9B A;  3SCG A;  1OQD A;  3M70 A;  4W8J A;  1UQX A;  2QQV A;  3PVE A;  3EB7 A;  5FBJ A;  3SH3 A;  3WW3 A;  2HLE A;  5JXH A;  2FZ1 A;  3RZZ A;  5CG9 A;  2WL1 A;  1NX9 A;  2QQL A;  4DXT A;  3MUY 1;  4UI9 L;  3LB9 A;  4HLT A;  1RUH 1;  3OBA A;  3GZE A;  2GME A;  5T5O A;  3RYK A;  2C1F A;  1XNB A;  3DEM A;  4HAN A;  4LBK A;  2GP5 A;  1A6C A;  1M06 G;  1RUJ 2;  1HV1 A;  2WZR 3;  4I09 A;  5DN2 A;  4K6B A;  4K7J A;  2VBD A;  5FZ6 A;  1PX4 A;  4JHZ A;  3VBH C;  5FP8 A;  2JB4 A;  5DQ0 A;  5A70 A;  2WQ4 A;  3RZG A;  4BQW A;  1PZ8 A;  3W5N A;  3ZSE A;  3WP5 A;  3HNM A;  5IAT A;  3PIJ A;  3NV2 A;  4RS5 A;  2WNU C;  2CL2 A;  2A5Z A;  2B39 A;  4BQ4 A;  4CDQ A;  1AJK A;  5JUV A;  2R04 1;  4E4S A;  2Q8O A;  4MGZ E;  3O0W A;  2X5I A;  3ITQ A;  4KU7 A;  1IKP A;  1MS9 A;  1J83 A;  4PDW A;  4GXL A;  1PGL 1;  3HOB A;  3AMQ A;  3LEM A;  3MLK A;  5JDB A;  1HQN A;  4MGT A;  2JG9 A;  5C4W B;  5I0D A;  5A80 A;  2R7E B;  1RUH 2;  1AZD A;  4PIY A;  2UYA A;  3MIG A;  2OYZ A;  1JUI A;  5ISL A;  3FLT A;  4ET7 A;  3P3N A;  5IFT A;  1H8T B;  1JN2 P;  3U0Z A;  2DV9 A;  3WG1 A;  3CQO A;  1OA3 A;  4AVV A;  2QDN A;  4E8C A;  4FFG A;  2JIJ A;  3ZSM A;  3M1H A;  3GHN A;  2RVA A;  2VOW A;  1VAK A;  2V5D A;  4MLG A;  5HXM A;  2V5Y A;  5FKB A;  4CP1 A;  3D61 A;  3I2O A;  5FZF A;  1QXJ A;  1TL2 A;  5CNA A;  1RUJ 3;  4I0B A;  3ZKU A;  1O3R A;  1ZYB A;  1A8M A;  1C5H A;  1ND2 B;  2ILM A;  2R04 2;  3I59 A;  4HVO A;  1PMJ X;  2VUJ A;  3KWV A;  2WAA A;  3EJK A;  3LDB A;  3RS6 A;  3OTF A;  3T2Q A;  4E2S A;  5BNP A;  1MQT C;  5DAB A;  5JLV A;  4LE3 A;  1F5J A;  3ETQ A;  3LEI A;  1QIQ A;  2FBE A;  1UOB A;  1TG7 A;  1PGL 2;  5C7G A;  2E63 A;  5BNO C;  1MS5 A;  1KS4 A;  1GIC A;  3WG3 A;  4GKX A;  3W20 A;  5HBA A;  3WR0 A;  3FHA A;  3T08 A;  2LW8 A;  1TMF 3;  4UDI A;  4N7I A;  3OPT A;  5H9S A;  1ZRC A;  1QWR A;  2E51 A;  3WQ1 A;  4ZHN A;  5F6L B;  5FXZ A;  1IS3 A;  1O3T A;  2FCV A;  2GAU A;  3NL1 A;  2CDO A;  2VZ3 A;  3AMM A;  1JXN A;  4RR3 B;  1UAI A;  3CJI A;  5FY0 A;  3UJQ A;  2RS5 1;  2HWD 1;  1ZZB A;  1VIW B;  4PI0 A;  5E88 A;  2UYB A;  3H9A A;  3WDX A;  1RUH 3;  1OQ1 A;  1SLC A;  3ECQ A;  4SBV A;  2ZGU A;  4CCC A;  3VSZ A;  1SBD A;  3V0B A;  3AYD A;  5C8C A;  1ULP A;  3QC2 A;  4N43 A;  2VGD A;  5KBF A;  4NRM A;  4TLF A;  5J37 A;  3MF9 A;  4CCN A;  1ODN A;  3H1W A;  3VB9 A;  4BH9 A;  4HKL A;  3PVO A;  2GU9 A;  3VBH B;  4BU2 A;  5GLL A;  1XU2 A;  2P37 A;  3VBR A;  3D82 A;  5I0U A;  1T6G C;  3AL6 A;  1JYW A;  1FV2 A;  3UES A;  2W1W A;  2WRA A;  4H7M A;  4NN0 A;  5EPA A;  5EV7 A;  5H9Q A;  1HRV 1;  1TQ5 A;  1WCK A;  1Y7B A;  3A0N A;  3DV8 A;  4DEV A;  1LGN A;  2J7M A;  2RM2 1;  3K77 A;  1N3O A;  3OGR A;  2PEL A;  2XJT A;  4LKS A;  2WNU B;  4Q4X 1;  2R04 3;  5T3N A;  1JOD A;  4AI9 A;  4XHB A;  3BN6 A;  1V6K A;  4BLI A;  4HVQ A;  2PLV 1;  1GU3 A;  1CZT A;  2Y0I A;  3U37 A;  2JEM A;  4LNV A;  1RUI 1;  4AHX A;  5LEJ A;  3USU A;  2EAK A;  3BB6 A;  1GWK A;  1WZX A;  2DUP A;  3HNB M;  3MV1 1;  2HWE 1;  2OQ6 A;  2R07 1;  5FZI A;  5TSW A;  3OM7 A;  4O9E A;  3MID A;  4EV0 A;  5F37 A;  5IK5 A;  2YBK A;  4QKD A;  5FYY A;  1JZ4 A;  3M2M A;  5F7U A;  1DLL A;  3RZL A;  2LAL A;  1JU4 A;  2R16 A;  2QFE A;  2XJS A;  3GGL A;  3WNX A;  1J84 A;  2VZO A;  4NWW A;  4Z1V A;  4IDZ A;  4MXV A;  4JRL A;  5I0S A;  1A34 A;  3VZN A;  2ZJC A;  1LOF C;  2GH8 A;  2HYX A;  3I3D A;  4IV1 B;  4AVT A;  4XQW A;  2GH2 A;  3ZFF A;  4GAZ A;  3RYP A;  1I1E A;  2VTX J;  4XBN A;  3HQX A;  3KCC A;  4DIQ A;  5JZG A;  1X9T A;  4OQ9 A;  1HRV 2;  3HNY M;  4JDN A;  1YO8 A;  5IJR A;  1G9F A;  2W1Q A;  1R09 2;  3J9S A;  4JQR A;  1RUC 1;  2DVB A;  4COY A;  2BPA 2;  1SFP A;  1OH4 A;  5FUN A;  2RJ2 A;  2D3S A;  3N9N A;  2Y0O A;  1K12 A;  4QKB A;  3RG0 A;  2JE7 A;  2PLV 2;  4XFG A;  3WOG A;  3T4V A;  3R4Y A;  1HN1 A;  1RUI 2;  5T54 A;  4MXW A;  1SHW B;  3CJX A;  3POJ A;  5DUU A;  2OQ7 A;  4XDO A;  3AMH A;  3VSR A;  2HWE 2;  1BQP A;  3JB8 A;  4Y5S A;  5FY1 A;  3I2G A;  5LRR A;  2B4W A;  2NPI A;  3DF0 A;  2SBA A;  2WII B;  4XFI A;  1MS8 A;  3R4D B;  4UT5 A;  4NPL A;  3AX4 A;  1CN1 A;  2BWC A;  4AQ6 A;  2A1X A;  2J22 A;  4CSW A;  3ZN6 A;  2SLI A;  4RN5 A;  3B02 A;  3G6J B;  4JGY B;  4LPL A;  4JHT A;  4AWD A;  5A8C A;  4A2U A;  3DPR A;  2E26 A;  2QQJ A;  3HPN A;  2RS5 3;  2HWD 3;  4H2A A;  4Q0S A;  1GNZ A;  5C5T A;  1DIW A;  4LBL A;  4PI2 A;  3O12 A;  1H30 A;  2WDB A;  1OT5 A;  3H8O A;  4FXG B;  4MHU A;  3O1O A;  4HN0 A;  3RNS A;  3N9O A;  2WO3 A;  5FPV A;  3N9Q A;  1W39 A;  1QF3 A;  2JDA A;  3IPV A;  1IZ3 A;  4XCA A;  1RUC 2;  3ILN A;  4QAW A;  5KXD A;  2J1T A;  4DEQ A;  4IND A;  3U78 A;  1F15 A;  5EWS A;  2Y6G A;  2QQW A;  5HCF A;  1CIW A;  3VZL A;  1LOE A;  4HN1 A;  1ZNP A;  3SXW A;  3TEZ A;  3SH4 A;  3AYA A;  4CDX B;  1W8U A;  2GC2 A;  3HAG A;  3LV4 A;  1JOB A;  1TVG A;  1H6Y A;  2ZPX A;  2ZA9 A;  3A4U A;  1HRV 3;  2ADE A;  2VEC A;  5EHD A;  4AI1 A;  5FO8 B;  2PFW A;  4QB2 A;  1RUE 1;  2RM2 3;  5FZO A;  3VHO A;  4Q4X 3;  2EXI A;  2IZW A;  4YM0 A;  2A75 A;  4EWD A;  2IXK A;  1ASJ 1;  3WF4 A;  3AYC A;  4FTE A;  2PLV 3;  5DUW A;  1S4C A;  3S5Q A;  1EPW A;  1RUI 3;  2R06 1;  3Q8A A;  4FPG A;  4IE0 A;  2LRP A;  4W6Y A;  2EAA A;  1QQP 2;  4Y22 B;  3H3Z A;  5CKQ A;  5C71 A;  2HWE 3;  4QXB A;  2R07 3;  2VL4 A;  3LA7 A;  2V72 A;  3PUQ A;  4EN8 B;  5FZ7 A;  4I02 A;  2G1M A;  5DZE A;  3VD5 A;  4AGG A;  4K3U A;  2QCS B;  2HJI A;  1R64 A;  1SLB A;  1WLD A;  1GZ9 A;  1IPJ A;  2H6C A;  4FQ4 A;  4OHW A;  1GOF A;  4CDW C;  1DQ0 A;  2LUW A;  4LO6 B;  4YNI A;  1SLA A;  3Q8E A;  4KI5 M;  2QQP A;  4N1I A;  3NKT A;  1C28 A;  4B1L A;  1VBB 1;  5SV5 A;  1NCQ C;  4BA6 A;  3CO2 A;  2ZGO A;  3IMM A;  3ZN4 A;  1X36 A;  3JQX A;  2A3X A;  5JIA A;  4Y33 A;  4QPY A;  2QQM A;  1RUC 3;  3KV6 A;  3AP7 A;  4E27 A;  3FUQ A;  2Y60 A;  1FAY A;  3T0B A;  5JVV A;  4IEV A;  5JI7 A;  1K5M B;  5B6T A;  1FNY A;  2ZAC A;  4XJZ A;  1G6N A;  1NG0 A;  2YGM A;  1GWM A;  5M0T A;  1UZV A;  3K3O A;  3KCX A;  4LK6 A;  1UYZ A;  1WW6 A;  4QDS A;  4RQP B;  5FP3 A;  3VBS A;  4LBQ B;  5FPU A;  2VVF A;  2AC1 A;  1SLL A;  3VHR A;  5ABJ B;  1WBL A;  2ZGP A;  1ZA4 A;  1S0E A;  1LOC A;  1K3I A;  2BER A;  1PK6 A;  5IYY A;  1NXD 1;  1ZZ7 A;  1YQ2 A;  1LOG A;  2VMC A;  3QAC A;  3LWC A;  1IS4 A;  2Q4S A;  3DYO A;  3M3Q A;  1BVP 1;  1O5U A;  1CZV A;  4AQ2 A;  3GJB A;  5KHJ A;  4K1Z A;  2F4P A;  1YI7 A;  1SQ4 A;  2R6Q A;  3TAY A;  3SIT A;  2CWS A;  5IK4 A;  4PVI A;  2Q1F A;  1CAX A;  3I97 A;  5IW0 A;  5J36 A;  2VZQ A;  3K4A A;  2YC0 A;  3DGT A;  4OLL A;  4D3W A;  1GOH A;  1IG0 A;  4WVW A;  4BB3 A;  1HB3 A;  4PQQ A;  4NR1 A;  2W52 A;  1JHN A;  4HFS A;  3RFR A;  3T0A A;  3D8C A;  1PO2 2;  3FHI B;  3HEI A;  1IS5 A;  2WFF 2;  3V56 A;  2HBU A;  2IXL A;  3SHR A;  1QJF A;  1UPI A;  2JEN A;  5FPZ A;  2GC3 A;  4L92 A;  4Q0Q A;  4Q2F A;  1GSL A;  1FAT A;  3WPV A;  5IVB A;  1RUE 3;  3ZYF A;  1Q5O A;  3GAL A;  4FAG A;  5JOX A;  2ZHM A;  1RUD 2;  3NMB A;  1O4T A;  1ASJ 3;  1RYY A;  2FDI A;  4ZON A;  5LA2 A;  1AXK A;  4XFA A;  5J98 B;  2R06 3;  2GC1 A;  4MGY E;  3PLQ A;  2WO1 A;  4H14 A;  2PA7 A;  1ONA A;  3ZDV A;  5A7O A;  4WM7 A;  4CEY B;  3O1U A;  1T2X A;  4IEY A;  4DY3 A;  5HV4 A;  1W6P B;  4KWU A;  5GLK A;  4LA2 A;  2B9V A;  2C24 A;  3VDD C;  2VVE A;  4AGV A;  4NHX A;  1X33 A;  4XBQ A;  3OBZ A;  1UYX A;  1OUX A;  4EWE A;  3ZFE A;  4DO0 A;  1VBB 3;  4YG6 A;  5FYM A;  1WD3 A;  4AED B;  3AKI A;  1CES A;  3E6D A;  5L73 A;  2H0B A;  3KV9 A;  4V2W A;  4XDP A;  5GLP A;  2VVD A;  4XUO A;  2BDR A;  4HVR A;  5K0U A;  3Q8F A;  4Y1V A;  3LQC A;  4LIT A;  4CCK A;  2YGL A;  3PUA A;  3NAP C;  1Y43 B;  2FDH A;  3WPZ A;  1Q8S A;  3EQE A;  1U5Y A;  1WLW A;  1H1I A;  1W8H A;  3J7H A;  3VBU B;  1QDO A;  3ZMO A;  3WD5 A;  1G8W A;  2OPW A;  3BUC A;  2P34 A;  2WC2 A;  5GZF A;  1SPP A;  5E16 A;  2GN3 A;  4KWK A;  3GZU C;  3HT2 A;  1HRI 1;  1C1F A;  2JDK A;  5DZG A;  3WQ0 A;  4AZZ A;  5IK8 A;  1F2N A;  1XYN A;  3AXE A;  3ZXG A;  3ZXL A;  5K8S A;  4Z82 A;  5A8D A;  2ZEY A;  5C9A C;  1CPN A;  1JS9 A;  1XNA A;  2BNN A;  4YM2 A;  4HON A;  3BAL A;  2IVI B;  3O1P A;  1Z78 A;  2FHR A;  4A42 A;  2NQY A;  1YIF A;  2CTV A;  2FMY A;  1W8F A;  1OOP C;  1AL2 1;  3MHZ A;  2D97 A;  3OUI A;  1ZRF A;  3POY A;  5FWE A;  4OCT A;  2JKB A;  5D1I A;  5FYI A;  1PVX A;  2JEC A;  2VCA A;  4DZG A;  4ZKT B;  2ORZ A;  1PM7 A;  4R4X A;  3RZK A;  4IES A;  5E6H A;  1HLC A;  4R4Z A;  1BCX A;  2ARA A;  4XQD A;  2E7T A;  3ZFG A;  4Z2A A;  4AK7 A;  4QHO A;  3P2N A;  3HIF A;  1VBA 1;  4EN9 B;  3RZM A;  3OPZ A;  2W0X A;  3S30 A;  1F8V A;  1V6L A;  1Y3T A;  1COV 1;  2XJU A;  5E89 A;  4ZU4 A;  2B5H A;  4Q4Y 3;  1CON A;  1V6I A;  4YW2 A;  1EV1 1;  1HRI 2;  1Y9Q A;  3T30 A;  4ZU5 A;  3WF3 A;  3KF5 A;  3VT2 A;  3NQH A;  3BYL A;  2QJV A;  1CAU B;  1LU1 A;  2DDU A;  3HBZ A;  1B35 C;  2VUL A;  3LZZ A;  5GM0 A;  4YZ3 A;  2JIG A;  2RMU 1;  4A41 A;  4DRR A;  1T6B X;  5LAS A;  4IEX A;  2VZR A;  1KEX A;  2FMD A;  1BMV 1;  3RPQ A;  1SBF A;  5GLU A;  4DMI A;  4AYU A;  1QKQ A;  4BZ4 A;  3IN9 A;  3WP4 A;  2UWB A;  1AL2 2;  2R49 A;  2PYT A;  3NNG A;  1UXZ A;  4HXC A;  3ZYJ B;  3PMS A;  3P6B A;  1XNK A;  4FPY A;  2D3P A;  3S7E A;  5GLN A;  1H1A A;  4CUC A;  5CIR A;  1VBD 1;  4K21 A;  3B3Q E;  4GH4 B;  3DCQ A;  1KJL A;  4YVW C;  1S0C A;  3KVA A;  1CWP A;  3BU0 A;  2ETE A;  1RJ8 A;  3KM5 A;  4B7K A;  1UY3 A;  1U5I A;  1W2A X;  1VAM A;  4NIA A;  4Y26 A;  4BIS A;  1COV 2;  4KBZ A;  1FXZ A;  1P8J A;  2O8Q A;  2IFR A;  4EN0 A;  3BYN A;  3ZYH A;  3RI8 A;  4M01 A;  5C4W A;  4PCR A;  3CNA A;  4YW5 A;  1SCR A;  3MIB A;  2PXJ A;  3BIE A;  1KGY A;  3OUH A;  2XG3 A;  3IAQ A;  4YW3 A;  2GNM A;  2E7Q A;  1OC1 A;  2RMU 2;  2XHN A;  4I30 A;  4NRO A;  4WZC A;  1H8T A;  4YFW A;  5GKA C;  2Q8C A;  3ZOI A;  2VO5 A;  4QGL A;  2NMO A;  1BMV 2;  1F31 A;  2EIC A;  1VMJ A;  4N9H A;  2HWC 2;  2QKD A;  1S2K A;  3K4D A;  1HRI 3;  4Z2W A;  2FD8 A;  4O8P A;  1FNZ A;  3SEP A;  1UX6 A;  3LE0 A;  3V65 A;  3I3M A;  1UOF A;  3NV3 A;  1QEX A;  4CEW C;  2WWS A;  2XWJ B;  4S2H A;  3U14 A;  1UIJ A;  3N35 A;  4ZS2 A;  5F5C A;  4Y1U A;  4WM8 B;  3WDU A;  5LBB A;  2ZX0 A;  3SKV A;  5C9A B;  2WWU A;  3NNM A;  4DUV A;  5LCW L;  1ND2 A;  1S0I A;  3OG2 A;  2I45 A;  2VTF A;  5FY4 A;  1AL2 3;  2NLR A;  1OXC A;  4X6Q B;  4CCJ A;  4BQ1 A;  1GUI A;  1MAC A;  5A1A A;  1OOP B;  4UFJ A;  2ARX A;  3V0A B;  4XFB A;  2RS1 1;  4O61 A;  5A3U A;  3UKT A;  4KCB A;  4NPM A;  4O7X A;  3CHX A;  1W9Y A;  1UKG A;  3WX5 A;  2P5B A;  1VPH A;  1L7L A;  2OS2 A;  3VD9 A;  3VT1 A;  2Y8K A;  1W18 A;  3M3E A;  2ZX4 A;  1VBA 3;  3WVJ A;  5F3C A;  3R67 A;  2ATF A;  3WDV A;  1ENQ A;  3KT1 A;  4AI3 A;  4BXS V;  2J1V A;  4COU A;  3K2O A;  1COV 3;  5C5U A;  2BFU L;  3J8F 1;  4RR3 A;  1CD3 G;  2FZ2 A;  2RR1 1;  5F32 A;  3T2O A;  1XQN A;  1EV1 3;  5A7V B;  4ERO A;  1LKN A;  2IC1 A;  3C2U A;  2XJV A;  4LXL A;  3IDE A;  4RL7 A;  1QJY 1;  2RMU 3;  2YBP A;  4GUL A;  4RGK A;  4OI1 A;  3U10 A;  4EYU A;  1AR6 2;  1PX3 A;  4JZR A;  3ZXD A;  5LA9 A;  1GKB A;  3VBF B;  4A6O A;  1QJX 1;  3IDC B;  5B2G B;  1XND A;  5GZC A;  2ZGR A;  3VBH A;  3TAW A;  2AAC A;  4QQ2 A;  4IE5 A;  4Q1R A;  1VBD 3;  2RS1 2;  3NJZ A;  4EN7 B;  2BRT A;  4HMZ A;  4JRA A;  4EZ4 A;  4V1P A;  2DUQ A;  4DIN B;  2QNK A;  1REF A;  4FCA A;  1XE0 A;  1G7Y A;  4CUA A;  3QEF A;  5FPB A;  2J1S A;  2WNU A;  2OVU A;  4NAM A;  3N9P A;  4HKW A;  4YVW B;  1W8W A;  1TME 1;  1OUS A;  1N47 A;  2XLF A;  4URT A;  2XBO 1;  3H0O A;  4CCM A;  1H2L A;  2W91 A;  2XQR A;  3OYW B;  1JTZ X;  2WA3 A;  2CDP A;  1UYY A;  4IV3 B;  4FPO B;  4QXK A;  3RI9 A;  2NN8 A;  1IS6 A;  1U12 A;  2YC2 A;  1ULO A;  1PNF A;  1GWL A;  5A33 B;  4LHK A;  1W8N A;  3GM8 A;  4PIX A;  3QEE A;  2ENR A;  1QJY 2;  1PIV 1;  1WD4 A;  2GMP A;  1NA1 B;  1ND3 C;  2V09 A;  3IAP A;  3PTR B;  4QPG B;  5FJK A;  5F1R A;  1JYV A;  1C3H A;  1WCQ A;  2VTX A;  2E32 A;  3ETP A;  4IV1 A;  2W3J A;  3ACH A; 
#chains in the Genus database with same CATH homology
 5AYC A;  4UFM A;  1Y4W A;  2EXK A;  4N4B A;  4ONZ A;  3LIG A;  5FMC A;  3C7O A;  4UFI A;  3WPU A;  4B1M A;  3U1X A;  2QQW A;  2X8T A;  4UDI A;  4U6B A;  5JOY A;  3BYN A;  3ZR5 A;  3WN0 A;  5GLO A;  5GLM A;  4AK6 A;  3U75 A;  3LV4 A;  5GLK A;  4O8O A;  3QZ4 A;  2ADE A;  3AKF A;  4U6D A;  5AYE A;  5AY9 A;  4KC7 A;  5FMB A;  3ZR6 A;  2EXI A;  2ADD A;  5A7V A;  5GLR A;  3AKI A;  5FMD A;  4KC8 A;  4UDK A;  3C7G A;  4KMI A;  3D5Y A;  4N2Z A;  4CCC A;  3S5Q A;  4O8P A;  5GLP A;  3VSZ A;  4COT A;  3BYK A;  3QC2 A;  4UDK E;  3LDR A;  4PVA A;  3U14 A;  4AK5 A;  5FK8 A;  4O8N A;  5GLL A;  3ZXK A;  3D60 A;  4UDJ A;  1GYD B;  3WN2 A;  1Y9M A;  3KST A;  3WPZ A;  2EXH A;  4NOV A;  1ST8 A;  2QQV A;  3K1U A;  3WPY A;  3ZXJ A;  2QQU A;  1Y7B A;  4KCA A;  4UFJ A;  4N1I A;  4KCB A;  5ANN A;  3UGH A;  3R4Z A;  4B1L A;  2VDT A;  3WMY A;  3D5Z A;  4D47 A;  3OM4 A;  3RWK X;  3IMM A;  4AZZ A;  3VT1 A;  3UGF A;  5JOZ A;  1GYH A;  1W18 A;  3ZXL A;  3VT0 A;  3C7F A;  4UFK A;  3R67 A;  5A8D A;  5FKC A;  3OM7 A;  3WAS A;  1UV4 A;  3PIG A;  2EXJ A;  3CU9 A;  1YIF A;  3AKH A;  3SC7 X;  5A7V B;  5B6T A;  5FIX A;  3PIJ A;  3C2U A;  3QED A;  1UYP A;  3KF3 A;  3OM6 A;  3H3L A;  1GYE B;  5B6S A;  2AC1 A;  4CCE A;  2AEZ A;  2OXB A;  3UGG A;  3LDK A;  1PT2 A;  3TAW A;  3P2N A;  4AK7 A;  3LEM A;  1WL7 A;  3VSF A;  3VSS A;  3OM5 A;  4UFH A;  3LF7 A;  3C7E A;  3WAT A;  5AYD A;  1YI7 A;  2YFT A;  4QHZ A;  3R4Y A;  4JQT A;  3QEF A;  3KF5 A;  4PVI A;  3VT2 A;  4FFH A;  3NQH A;  3BYL A;  5FLW A;  4UDG A;  5GLQ A;  3WMZ A;  3VSR A;  4FFF A;  3WN1 A;  2XQR A;  4QQS A;  4FFG A;  3WAU A;  4CCD A;  2B4W A;  1Y9G A;  4MLG A;  3BYJ A;  4FFI A;  2X8F A;  5FKB A;  3D61 A;  1W2T A;  1YRZ A;  5JOW A;  4HXC A;  3OM2 A;  5GLN A;  3QEE A;  3OSD A;  2X8S A;  5A8C A;  3LIH A;  4N2R A;  2YFS A;  3C7H A;  5FK7 A;  2AEY A;  1OYG A;  3AKG A;  5C0P A;  3WPV A;  1VKD A;  3LFI A;  3HBK A;  5JOX A;  2YFR A;  3NMB A;  4UFL A;  4EQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...