3C7FA

Crystal structure of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis in complex with xylotriose.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
487
structure length
487
Chain Sequence
ATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase in complex with xylotetraose reveals a different binding mechanism compared with other members of the same family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
total genus 135
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c7fA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3c7fA02
4XURA 3VD5A 2VZQA 1GQPA 4CU8A 4ZXEA 1VKDA 3BYLA 3MV11 4DXRA 4FFIA 1PMHX 1D7PM 1TG7A 1W8NA 2RJ2A 5JXJA 2VOTA 3OGRA 4BDVB 4UDIA 2QQJA 2Y64A 3D5ZA 3MUY1 2J1AA 1GYEB 1UWWA 4E8CA 4N4BA 3OM6A 3MUZ1 4XZUG 2HLEA 1WCQA 2WZEA 3I3EA 2BGOA 2V72A 3AKIA 1TVGA 2Y6HA 2BGPA 4P08A 1UY2A 4YPJA 2AC1A 2VZTA 5JOYA 3LPGA 3UETA 5FK8A 2VMDA 4N2ZA 4DUWA 4FFGA 5IFTA 3HOBA 4BXSV 5IFPA 2J22A 1XC6A 1GUIA 5LA2A 3BYJA 3QEFA 3T2OA 2B4KA 3OBAA 3WF2A 3IB3A 3E1F1 4BK4A 5I0DA 4BJ0A 3A21A 2EIEA 5J1XA 5JOXA 3WN0A 1W9WA 3F2ZA 1GOHA 4UOJA 3R4YA 3CQOA 4D0QA 3LE0A 3LIGA 1DP0A 4JKKA 1P8JA 3WQBA 2W1QA 3K75B 1ST8A 3THDA 3HJRA 4FI9A 1W2TA 3T2PA 2OXBA 3QZ4A 3CZJA 2QBXA 3LEIA 4MADA 4QX0A 1XNTA 3J7HA 1J84A 1IQDC 2JKXA 4A6OA 5A7VA 5HXMA 5C0PA 2VO5A 4QX1A 1JHJA 1GMMA 4A41A 3SEPA 4FFHA 1Y4WA 3NJXA 1CX1A 3LF7A 3P2NA 1YRZA 1GU3A 1CZVA 2YFTA 1GNYA 3WF0A 3UGHA 4UDKE 2JE8A 2X8FA 2QQKA 5HPOA 4JKLA 3WF3A 5A1AA 3WNPA 4QX2A 4JKMA 4QB6A 4CVUA 4QB2A 1L7QA 3BN6A 2WUHA 2YC4A 4GWIA 3WPZA 3WNNA 3MV01 5FK7A 4DUXA 4XUOA 3DYMA 1K3IA 2EIDA 2Z4FA 5EIYB 5DMYA 5LA1A 3FHAA 1K12A 2E26A 2CDPA 1MPXA 3VD3A 3W5MA 2QQWA 4GZ9A 3TAWA 1UYZA 2DDUA 4MO3M 4P5YA 3U75A 1I5PA 1WKYA 4P00B 2EXHA 3BYKA 3K4AA 3VD7A 5GLKA 2PQSA 4KWUA 3D3AA 3KF5A 2B4WA 1ULPA 4W8JA 2WQ8A 3MO4A 2RVAA 3AKFA 3LEMA 4Z2AA 1HN1A 4OYUA 2W3JA 4KI5M 3VSFA 3I3DA 4QX3A 3WF4A 5DN2A 2WO3A 4W50A 1OF3A 2VR4A 3JXSA 1H6YA 3HNBM 4CUBA 3D5YA 1T2XA 2VZRA 1JI6A 2YFZA 4CU9A 1W9SA 4ZZ5A 3IAPA 5JXGA 3R4ZA 3T09A 2QQVA 2YFRA 3WMYA 2VZ3A 1NKGA 3KF3A 2W1SA 1UMIA 4DXSA 3VD9A 3I2FA 3OGVA 3VD4A 2VC9A 1JZ5A 1OF4A 2Y6LA 4NOVA 1O8PA 2LW8A 3PUHA 3VSZA 4QAWA 4QQSA 1CIYA 1UXXX 3ECQA 3A22A 3OGSA 3WMZA 1NX9A 3OEBA 3ACIA 2VQUA 3A7QA 3VT0A 2CDOA 2ADDA 1F4AA 4XUNA 2VZUA 1JYWA 2RV9A 1RYYA 1W9TA 2W94A 2QQNA 3AKGA 2J1UA 4KMIA 3T0BA 3DYOA 3I3BA 3ZM8A 1JU3A 1UMHA 4PVAA 1ULOA 4D8MA 4QB1A 3EB7A 1XNAA 2W1WA 4EQVA 3WF1A 3ACGA 4QPWA 5EJ1B 3C2UA 2J7MA 3W5NA 4XUPA 3I97A 2VZ1A 4N1IA 3OG2A 2KD7A 3I2IA 4GWJA 5GLRA 3WSOA 2Y6KA 3LEGA 5A8CA 2ORXA 1J83A 3ABZA 2W92A 4MLGA 5CZKA 4AK7A 3P6BA 3I2HA 3VDBA 4FFFA 1JYNA 1O59A 4MGSA 2LS6A 2WO1A 5JXIA 3D60A 5FMBA 2WAAA 3GGLA 3IDAA 5FMCA 5B4XA 1W18A 2XONA 3QC2A 3GM8A 1US3A 4ET7A 1SHWB 1F4HA 2WAOA 3CDZB 4D47A 2VZSA 3FL7A 4KCBA 2V5DA 1R64A 2EICA 1GOFA 5AYDA 3WN2A 1W99A 1OYGA 1UZ0A 1KEXA 5JUVA 3EYPA 4U6DA 2W1UA 2YFUA 3BGAA 4MOAA 4PQQA 3VSSA 4LKSA 3C7HA 1JZ4A 4XVHA 4QDSA 3SKJE 2VMFA 2C9KA 3LDRA 2X09A 3WAUA 4ARXA 2WN2A 3CU9A 2E33A 4CUAA 5JR2A 1GOGA 4O8NA 2BBAA 1UXZA 5CYYA 5JMOA 4L0PA 2XOMA 5FLWA 4PF1A 5A8DA 2WABA 1XPWA 2VL4A 3ZXJA 3GXUA 3GDBA 2XQRA 2QQIA 2E32A 1PX3A 3ACHA 4KMQA 5LA0A 5GLOA 3NJVA 4QDQA 5LCWL 5DPNA 1L7RA 3LQCA 4A3ZA 3T0DA 3WPUA 5GLNA 4RN5A 5FMDA 3VT1A 1JZ8A 3A23A 3IAQA 4LPLA 2XQXA 3CIHA 3ZXKA 1JZ2A 3THCA 3LIHA 4PT6A 4P02B 2YFSA 3PIJA 2QQMA 2WBKA 3U14A 4E8DA 1UYYA 2VMEA 3K77A 4LHSA 4ONZA 5B4NA 2V4VA 4QDRA 5G04L 2J1VA 4W4ZA 5FKBA 5GLQA 2VCBA 3SKVA 2Y8KA 2ZEZA 1CZTA 1BHGA 1US2A 1OD3A 2WN3A 3C7OA 3LDKA 2W87A 2EXJA 3NRUA 2B9VA 2EXKA 2DCKA 2ID4A 2R7EB 3VDCA 2WDBA 3KSTA 3K46A 2BERA 4BK5A 3C7FA 3WASA 1WL7A 4UAPA 4KC8A 4AAXA 4ZY9A 2J1RA 1JZ7A 2DCJA 2QQLA 2VCAA 3HPNA 5GLLA 2AEZA 4A42A 3WNOA 1UY4A 4XUQA 2W47A 4A44A 3OM4A 1EUTA 1UY1A 1KGYA 4KC7A 3I2KA 4O8PA 1UYXA 1O8SA 2VZOA 3T08A 2AEYA 2ZEXA 5AY9A 3C7GA 1YQ2A 1OT5A 1W8OA 2YB7A 5JXHA 3DYPA 1CZSA 3VT2A 3WEZA 2E31A 1JZ6A 4COTA 1LNSA 3WNKA 2BZDA 2YG0A 2WO2A 4CU7A 1NUKA 2JD9A 4UDKA 1SDDB 2WYSA 1PT2A 3HN3A 4XUTA 4ZZ8A 1UY0A 3T2QA 2OKXA 3U37A 3NQHA 3VDAA 4N2RA 5C71A 4UDGA 3AKHA 4ARYA 2JDAA 3OEAA 5FKCA 4DUVA 4OMCA 3C8XA 2HYXA 4M4PA 5ANNA 1JYXA 2X8SA 3UGFA 4A4AA 3K1UA 1EUUA 2X10A 3P1IA 2X05A 3OB8A 4DEVA 2C26A 4A45A 5C70A 3OM2A 2J1TA 2J1SA 3CKHA 3WNMA 3QEDA 5B6SA 4OZOA 1UY3A 2VMCA 2VM9A 4UI9L 4HG6B 3FHQA 4M4RA 4DEQA 4AK6A 2ZEYA 3R67A 2QQOA 2ZEWA 1Y7BA 3ACFA 5DQ0A 5F7UA 2WZ8A 1DLCA 2X8TA 4OUEA 2VQTA 2L9LA 3C7EA 3HNMA 3K4DA 2QQUA 5AYCA 1K45A 5EJZB 1JU4A 4OMDA 2ADEA 2VCCA 4CU6A 1UYPA 4IUGA 4TXWA 3HEIA 3VSRA 1NAEA 2W46A 3LEKA 1UV4A 5B6TA 4CUCA 4TTGA 3CMGA 2VDTA 1PX4A 1SG3A 3BYNA 4PVIA 3WN1A 1H6XA 3ETPA 3WPVA 3HNYM 5IJRA 3LV4A 5IYYA 2J1EA 4KCAA 2W5FA 2VTFA 5C7GA 1JZ3A 2W95A 3QEEA 2VZVA 5A7VB 1OH4A 3PIGA 3WPYA 4RYDA 3WNLA 3ZXLA 2ZXQA 1YI7A 3OM7A 3DECA 1GYDB 3D61A 2XHNA 2YC2A 5FUIA 3SEEA 5GLMA 2ORZA 3FN9A 2W91A 1W0NA 5FIXA 3T0AA 1JYVA 4MGQA 3UESA 2VZPA 2Y6JA 3NNGA 4AG4A 5IHRA 3RWKX 1YIFA 4O8OA 3I2GA 5GLPA 2EIBA 4JHZA 4U6BA 5JOZA 3SC7X 3UNPA 1Y9MA 3PUIA 3LPFA 3LFIA 1UX7A 3K4ZA 5AYEA 1DYOA 1GYHA 3IIIA 4AK5A 5JOWA 2W9XA 1PMJX 2Y6GA 5G05L 1K42A 2EXIA 3WATA 1Y9GA 4DXTA 3I2JA 2C4XA 4JX0A 4LQRA 3AC0A 4UDJA 3OM5A 3CZUA 3UGGA 3MBWA 2VJXA
chains in the Genus database with same CATH superfamily
1VBA1 3RYRA 4XURA 3V0BB 4NOTA 2ZHMA 4XAAA 4ZXEA 3VGIA 4MXWB 3CJIB 4DXRA 1W8NA 4Y5Z0 4XXAA 4PIZA 3WCRA 2E7AA 2VOTA 3NV4A 1LESA 4BDVB 4UDIA 2QQJA 2RR11 3D5ZA 4F7ZA 1WW7A 3NSTA 4G4FA 5L73A 4B8EA 1ZBE2 4E8CA 1QJX3 3WW1A 3OGJA 2IXCA 3MUZ1 4XDQA 4Q1RA 4XZUG 3IM0A 3WW4A 3RZGA 2WZEA 2PAKA 3I3EA 4R9AA 1PIV1 3AKIA 3OBRA 2BU9A 2R0FA 1CPNA 3NWKA 4XCBA 3RS6A 3BOPA 5JOYA 4X6QB 4XQWA 3UETA 5F8PA 2E6VA 1C1LA 1RUJ1 3JUUA 4X8PA 4AYUA 2OQ6A 2ET1A 3OOXA 4N2ZA 4IEOA 3VBHC 1OHFA 2HEVF 2WIIB 4B1MA 4YZ1A 1ENSA 3RPQA 4FFGA 2BEOA 1R081 1STMA 3ZIXA 5IFTA 3ZR5A 3MZHA 1QJZA 5IFPA 5GZDA 2J22A 1GUIA 2FD8A 1RINA 2GAUA 3T2OA 4CA9A 3KD4A 3E1F1 3I49A 5KHHA 1CAVA 1WBFA 5A7NA 1H4GA 3EQEA 2NPIA 3H1WA 4BK4A 3HBZA 3S57A 3ZPOA 3A21A 1ZZ6A 2D6OX 2X29A 4QXBA 5JOXA 5LRSA 1ASJ3 1BZWA 3OD0A 4Z07A 1PIV3 3BKZA 2R6QA 3R0RA 3USSA 2ZGUA 1BVP1 3CQOA 4XQDA 2P3YA 3BPSA 4ZKTB 3MLLA 2XLGA 4WZCA 4JKKA 2HYKA 4CP2A 1LU1A 3WQBA 3K75B 3GZAA 2HWE2 1AJOA 1FAYA 4FI9A 3VL9A 4HT1T 5FUPA 4NIAA 4XOGA 3PDQA 1ASJ2 5HXVA 1SLTA 3LEIA 5F9TA 1DZRA 2ZAAA 4MADA 3VZJA 3S0MA 4XF9A 4N53C 4KG0A 3WQ1A 5J36A 1HJGA 1V6KA 1U5ZA 3KQRA 1J84A 1S0IA 4LHNA 4XHBA 4LBNA 3GZUC 1WW4A 5HI0A 3CJXA 1JHJA 2ZGSA 5CAZA 3VLBB 3SEPA 1FNYA 5FYUA 3N9NA 3FLPA 1Y4WA 2R061 1YHFA 3NJXA 3W9AA 1DGRA 1PGW2 3ZKUA 3H42B 5FXVA 1GU3A 1QJEA 4XZPA 3WF0A 2YFTA 1UIJA 1U5IA 1VR3A 1OFSA 3V0AB 1CAWA 1I1EA 1CAXB 2JE8A 3PUSA 2N7GA 1NXMA 4N53A 3KHCA 4EJRA 2JG8C 5A3PA 3WUCA 4JDNA 3OF1A 3WNPA 1PK6A 1Q3EA 4QB6A 5BNOA 2WKKA 3J9SA 4FO9A 4YVWC 4M3CF 3JBG2 2XL9A 4Q5OA 4CXWA 5FZFA 3H8UA 2C0ZA 5C8CA 3UK9A 1ONAA 4FTSA 4CSWA 3RQ0A 2WNVC 1SLAA 5FK7A 4C0BA 2JEMA 3AKRA 5FWEA 3DYMA 3MI8A 5GKAC 5DMYA 4BQ1A 3BTAA 4SLIA 1NCRA 1H1IA 1POQA 2XJQA 2JIGA 2E26A 1R1A1 3GZEA 3W5MA 1OVSA 1VMFA 5A3WA 4MO3M 4P5YA 3U75A 3K51A 1RUE3 1WKYA 1GP5A 3KVBA 1MQTA 1AR92 1UAIA 3UJOA 2VUDA 3HBKA 3DPRA 3K4AA 5GLKA 4NAMA 4RS5A 4KWUA 1IG0A 3D3AA 2WSVA 2IFRA 3LOIA 4UF0A 4O61A 2VPVA 1XSQA 4JTOA 2FZ2A 1MS9A 2WQ8A 4Y22A 4UFMA 1C8M3 1AJKA 2RVAA 3WP3A 4LO5B 2F6BA 3SISA 1ZRDA 4Z2AA 1H30A 3O14A 2W3JA 4QPYA 4OHYA 1AXYA 3VSFA 2XL7A 4W50A 3HQUA 1G8WA 2HWB3 3U11A 3U78A 2QZ2A 3B9CA 3PL0A 2JDZA 4LORA 1HRV3 1JI6A 5DUWA 2XHKA 2YFZA 1W9SA 1LKNA 2QQVA 4O9GA 3WMYA 1TNFA 4QQ2A 5DDJ1 4DXSA 4UFJA 5EQUA 3O1TA 1C1FA 2VC9A 3RZHA 1OF4A 4ES9A 4XFAA 3J8F3 1S1AA 2GC0A 2O8QA 3DXUA 5A7OA 3PUHA 1XE7A 4LKEA 2BJSA 3JB4C 5A3LA 4QQSA 2UYAA 4RHV2 3U4SA 4URAA 1JOJA 2GP5A 2AYHA 3AYEA 2BOJA 1NX9A 4IE0A 1PO22 3A7QA 3TNPB 1G9AA 2BP6A 4IL7A 1L3JA 4XHXA 1GNHA 2JG9B 3JB8A 5JAXA 2VZUA 2GH2A 2RV9A 5SV8A 4QQLA 4JVAA 1AF9A 2QQNA 3AKGA 2W68A 5EJ3A 3T0BA 3RG0A 1EAH3 4N43C 1C28A 1GQHA 1JU3A 1ZNPA 2BVBA 2K0GA 2K2SA 3HWJA 4JV4A 1XU2A 2Q1MA 4MGYE 4YVWB 5FZOB 4AQSA 4D8MA 2JDKA 4M3CA 3EB7A 3VKOA 1XNAA 4Q8LA 4EQVA 1Z7S2 2V73A 3WQ0A 1JUHA 2BBVA 4XUPA 5A6ZA 2XVKA 3BOWA 3BTZA 3OG2A 5KHGA 4CP0A 1AL22 1ZYBA 2Y6KA 5A8CA 2DVGA 3KT1A 2AREA 5L9VA 5CB7A 3MEPA 4MG2A 3ABZA 2CTVA 4AVAA 4MLGA 4FTBA 3INAA 4WVWA 4UT5A 4AK7A 5F5IA 1GANA 1KFXL 2P4EA 5GLWA 1UO9A 5J37A 3KGLA 3H3ZA 2B7YA 2LS6A 4KU8A 4MGSA 3V0AA 4Q0PA 3D4KA 2CY6A 5JXIA 2BV4A 1MZ6A 4IV1C 1RHI3 2C6SA 1UMZA 3DEMA 2XONA 3ES1A 3GM8A 5EYXA 1TL2A 1OVPA 3QC2A 4PLOA 5A3NA 4UFIA 4PLNA 5FY7A 3CDZB 2WAOA 4D47A 3G7DA 3R4DB 2D3PA 2V5DA 4IQPA 1DIWA 2EICA 4IE4A 1VAMA 1WWYA 5BUVA 2GN3A 3PJYA 3WN2A 1O7FA 4LOTA 1VAKA 1KEXA 4XJAA 3IDCB 3M3EA 1IPSA 2W1UA 2YFUA 4MGIE 3X29B 4MOAA 4YGDA 1BKZA 4NJ4A 4LKSA 1OKQA 5T55A 5F5CA 4XFBA 1ACCA 3VUOA 3LDRA 1NA1C 2XJVA 3ZFEC 3TEXA 4ARXA 2WN2A 3AZYA 1N3QA 3M8LA 1K5JA 3ES4A 5FY8A 4HXCA 5JR2A 2IUWA 1GOGA 1X9PA 5BXXA 4BQ2A 2OPKA 3WG4A 2EA7A 1WMFA 1E57A 4QU2A 1AYM2 5BNPA 2ZZQA 1B35C 2MEV3 5C3OA 5JMOA 2G9GA 1CR7A 3HQRA 5A7QA 3RDIA 3VBOA 2WABA 1G9CA 3ZXJA 1D2SA 2OZ6A 2WZR1 3GXUA 4IV1B 4WM7A 4I0BA 3VHNA 1W9FA 2W39A 3QCWA 3WDUA 5BNPC 3ACHA 1ND3A 3CLPA 3POBA 5IK4A 3NJVA 5SV5A 4CDQA 4CDXB 2JIJA 5DPNA 5ANQA 1QNWA 3ELNA 4LK7A 3ST7A 4CP9B 4LPLA 4QQPA 1LOBA 3CIHA 2ZPXA 3DN7A 1AR73 3MIHA 5FREA 3S7IA 4P02B 3U14A 2DCTA 4P9XA 3LSEA 2CWSA 4XMAA 5JSPA 2V4VA 3GHNA 2J1VA 1ZRIA 1CN1A 1ZVFA 3B7MA 2XWJB 4K20A 3WUDA 2D3RA 1QJY3 1JN2P 3NAPA 2A1XA 2WN3A 3LDKA 2P2KA 5DAVA 2QDNA 5T5JA 3M3IA 3VDCA 3KSTA 4R9CA 1I6XA 5A80A 1CIWA 2GC3A 4GQ7A 3CEWA 1RUH1 5T5PA 3AYCA 3VBRA 1RUE1 1FX5A 4LBQA 4UAPA 4KC8A 1RUH3 1MZ5A 2F4LA 3DKWA 3AP7A 1PGL2 2JDHA 1OQ1A 2J1RA 3P5BA 2QQLA 4NPRA 3DKQA 3FHIB 3HPNA 4QPIB 1IKPA 1U5YA 1GZTA 3WNOA 1UY4A 3KT4A 4R4ZA 4XUQA 2JKBA 4A44A 3OM4A 1W3VA 2DBNA 3ZXGA 2VBPA 4CDQB 1V6OA 2VTXJ 4XIOA 2D6PA 3S5QA 4NR1A 3VBFB 3C7GA 2PLV3 1IOAA 2OS2A 2ZX0A 3ROUA 3VV1A 1OT5A 1OLQA 4EN0A 4GMP1 1E5HA 1W8OA 4W6XA 3CF6E 3WCSA 2I07B 3VT2A 5A3MA 2WSUA 1QJFA 2E31A 4L11A 3O1VA 3MICA 3V56A 5AFBA 4FQ4A 2BZDA 2VW0A 1TE1B 2RDRA 3HD8B 4LIUA 2VQAA 3U4XA 1NUKA 2E7TA 2JD9A 1FNZA 3ZDVA 2XXZA 1OPOA 4KGGA 2XKPA 3HN3A 4RHV3 1WD4A 3T2QA 1K5MA 2OKXA 1VBB3 3A0NA 1PVC3 2PHDA 3B94A 3PTYA 2WZR3 2YBPA 1HB1A 4DUVA 1SEFA 5LB6A 2J42A 2HH9A 1AHSA 2ZMKA 2EALA 3AK0A 3VBRB 3VBHA 4E4ZA 5DXDA 1J1LA 3P1IA 5BNQA 1O3QA 3OB8A 1AXZA 3TN93 1GLHA 2C26A 4E2SA 2HWF2 5DZFA 1ND3C 2AH2A 2F17A 1POV1 1OKOA 2HWB2 1PGSA 5C9AC 2A6XA 3CKHA 5B6SA 1UN1A 1UY3A 2VMCA 4K8RB 4P9JA 1W2OA 3FX3A 4QKBA 4NRMA 3ASIA 1ZZCA 4AEMA 4NIHA 1FMD1 5AVPA 3ILNA 1RUE2 3KT7A 4AK6A 3BODA 3DXTA 1N47A 3PU8A 5K7PA 1Y7BA 1BMV1 4K8FA 2RJKA 2WZ8A 1RGSA 1H9WA 3ZVXA 2GC2A 2X8TA 3OPWA 2L9LA 1TME3 1ZA7A 4YGBA 5AYCA 3MIEA 2ADEA 4OMDA 2MHFA 4JZRA 4IUGA 4CDUC 5FZ9A 2HWC2 1NAEA 4Q1PA 4F8AA 2YXSA 1QOSA 5B6TA 3LD8A 4HK8A 4QD2A 4WVVA 5LY1A 1RUJ3 3H1YA 3ZR6A 2VDTA 1W04A 3QH7A 1WGPA 4PVIA 3WN1A 3ILRA 3ETPA 4Y26A 4JGZA 1OUSA 2CNAA 2YY1A 2D7FA 5JI7A 4UFHA 2JE7A 2JG8B 1H8VA 5FYZA 3H8XA 3NV1A 2WNUB 3LZZA 1MR5A 4QGLA 4LO8A 4Y5SA 2J1EA 2W5FA 2KA3A 1S0FA 2VTFA 3TWIA 2TNFA 2KR2A 3WT3A 5CEHA 4Y1UA 2FHRA 2VVFA 4CDUA 3ILFA 5C3PA 2WL1A 1OMIA 3OUJA 4FOVA 5FP3A 5JLVA 3RZKA 2JD4A 3NAPB 3PIGA 1OFNA 3WPYA 1RMU1 1RXGA 1UPSA 4RQPA 1KXGA 1AVBA 2E63A 2P1BA 4ATEA 4SBVA 2Q0AA 2ZBJA 2ZXQA 5FY5A 3MW3A 2G9FA 4AL9A 2BFUS 3DECA 5E89A 5FY0A 2VXJA 3SEEA 1VBC2 4N7UA 4LBQB 2W91A 1H2LA 1XB9A 2RG4A 2ATFA 5IK5A 1DZQA 1RTVA 2VZPA 1X36A 3BALA 2E53A 4W65A 3AL5A 5GJ6A 5IHRA 2NQYA 1W8FA 3VZMA 5A3TA 4D3WA 2GNDA 1QDCA 1KJLA 1NT0A 3KV4A 1REEA 1J59A 4QX8A 1QXRA 2Z69A 2EIBA 5JOZA 2PLV1 1AX0A 1Y9MA 1JBCA 3PUIA 4NO4A 4UXAA 1RUF1 3LFIA 2D6LX 2XJSA 1ODMA 1VIWB 2GSYA 5FCCA 1UOFA 4AFBA 4GH4B 1QQP2 1DYOA 3VBUB 4B3NA 3POJA 1GYHA 3EHKA 2PMWB 3FFQA 2FDFA 1GV9A 4NWWA 4AK5A 2EVXA 5D8AB 3Q8BA 4P14A 5G05L 1W6QB 3ZN6B 4QQHA 5C9AB 3O1MA 3ZSEA 1O3TA 1Y9GA 1QMJA 4XF0A 4XXPA 1V6MA 4LQRA 1UW8A 3K2OA 3CZUA 4LJHA 4RR3B 3GBFA 4CPBD 3NKGA 1ALYA 3VD5A 2VZQA 4Q4Y1 2HWF1 3MPBA 5CIRA 5GZCA 3ORJA 5IUQA 2ZGKA 4FFIA 4CCEA 4RQPC 3U10A 4Y22B 3ACLA 4I0AA 3HVDA 5I8YA 4U2AA 2R062 2HEWF 3QD6A 3OPTA 1PVC1 5CU1A 1RVF1 4MGZE 2FBEA 2VNRA 4QX5A 3MF6A 3MUY1 4IEVA 1GYEB 5FZ4A 2CHHA 4OZXA 5HV0A 3LA3A 3S5AA 4AI2A 3CO2A 2HLEA 2DVDA 1E5RA 2LUWA 2XKOA 2BGOA 5LBCA 1IPJA 2V72A 4GMP0 1RHI1 3B5LB 2BGPA 2ETEA 2VBBA 4NN0A 4CEYB 5I93A 2ZOEB 5IVFA 4DB5A 1HX6A 3AVSA 4AQTA 2EAKA 4OHVA 1LOFA 4H55A 2BWAA 1HDKA 3ZXAC 4DY3A 3CU7A 4IGPA 4E4SA 4I02A 4DUWA 2DVAA 1DQ0A 5GZEA 4HSJA 1LGBA 1EV11 2V5YA 2RDSA 2IWGB 3VKLA 1MEC2 2NLRA 1FI2A 4HSLA 3AMHA 1TME1 3HOBA 1SPPA 4IERA 3WXPA 2SLIA 2VOWA 3BB6A 2ZGQA 3OBAA 1W6QA 3IB3A 4QGNA 3WF2A 3ZN6A 1QIQA 2Q8EA 5JMCA 1D4VB 3O12A 3DF0A 5J09A 1W03A 3IBMA 1SFNA 4BJ0A 1S0JA 1SMVA 2EIEA 4BQXA 4OI2A 4PBPA 1AR91 5FYSA 3F2ZA 1PO12 1PM4A 1GOHA 4UOJA 3SCHA 1VPHA 1W6MB 2R042 1A6CA 4PIXA 2Y34A 3CJIA 3N9MA 1DP0A 3OPZA 3QH6A 1QJX1 4AEDA 1ST8A 4DFSA 3BIEA 1RUC1 3HJRA 4YFZA 4H7LA 3WY6A 5IK8A 1KS4A 2OXBA 3JU9A 2V09A 1UPIA 3JZVA 2QBXA 1JTZX 1QXPA 3QOPA 1OC1A 1S0DA 3TEYA 3PLQA 4YVSA 5CBLA 2R30A 2A6YA 4QHZA 4CYDA 4EWDA 4EZ4A 4A7YA 1GYKA 1FV3A 1IS3A 3UL2A 1IQDC 1OOPB 1PZ7A 2DTWA 2JJ6A 2D5HA 2EIGA 2XWBB 3GYDA 3NW4A 4YVSC 4AFCA 5C0PA 1MS1A 4WVMA 1NE4A 5KHJA 4A41A 3UKVA 5BNNA 1W8HA 1LOGA 3LA2A 4FFHA 2RS52 4YW6A 3ZYPA 2W52A 1LODA 3BPZA 3ME2A 5LASA 3P2NA 2VVDA 1GNYA 2ZACA 5FZ3A 3ZSMA 5FP7A 3P3NA 2Q1FA 2YZ4A 4UDKE 1GZWA 2X8FA 5F2WA 2QQKA 2OUJA 3KV9A 1O4TA 1O6UA 5A1AA 1YC61 4BMBA 4QX2A 4JKMA 3UKNA 4QB2A 1L7QA 5CKQA 1GZ9A 1FOD1 2XUEA 4Y1XA 3BN6A 1LOAA 1JH5A 4M00A 4MX3A 5IATA 2OA2A 3WNNA 2IXHA 2BOIA 2A70A 3H0OA 1W6MA 1MS3A 1K3IA 4P9YA 5LA1A 5CISA 4Q4Y2 1ZX5A 3KCYA 2CAVA 5FPVA 4QPIC 1S0BA 4J1WA 4MV2A 4N8MA 3T2TA 3VD3A 3HT2A 1LGNA 4MGKE 3ZOIA 5FQ0A 2BDRA 1WD3A 1F9KA 2Q1ZB 3APBA 4WBBA 3WG1A 4YVSB 4GB32 1G7YA 1TNRA 3RSJA 1VP6A 4FT8A 4AEKA 3BYKA 3N7LA 2ILMA 1BJQA 2UU8A 2VQ0A 1WA4A 1YNAA 4YW7A 3U07A 1SACA 4PDWA 4CP1A 4LHKA 3KF5A 2B4WA 3GBGA 4HZFA 3E5XA 1SBDA 5DZEA 4LTAA 4N90A 1NCQB 1QH7A 5T5OA 1KD7A 4RS5C 1WBLA 3AKFA 4MH0E 5GLTA 3VHOA 1HN1A 5FMOL 4FPYA 2R072 3AFGA 4HETA 2WO3A 4CDXC 3PVBB 1OF3A 3JXSA 4JC1A 4BQ3A 1XNCA 4IEPA 5A33B 3AMMA 3HNBM 1ZA4A 4N9IA 3G6JB 1T2XA 2TEPA 1TMF2 2VZRA 5ABJA 2XLAA 3IPVB 1N1VA 2XBO2 4M0NA 4AHZA 3AKSA 1WLDA 3AYDA 3GCWA 4O65A 4HOOA 3T09A 2YFRA 5KXEA 1QKQA 3BU0A 1PK6C 2W1SA 2PELA 3T1MA 4BZ4A 2ZGNA 5JPNB 1QHDA 1ZZ8A 4LKDA 3VD9A 3I2FA 3OGVA 1JZ5A 3ZIWA 4IEXA 4LLOA 1O4YA 3ZYGA 4BM8A 2XG3A 4NOVA 4NE9A 4ITCA 5DZGA 4QAWA 1C8M2 5FYYA 5CNAA 3ZYJB 1UXXX 1PZ9A 2IVJA 3ZFFA 2GC1A 3ZYRA 1T6GC 2YV8A 2HWE1 3AMPA 5A6XA 4H14A 3T4HB 2C9AA 3Q8CA 3ZFGA 4COWA 4COZA 4WM8B 1RMU2 4PF5A 3VT0A 4A3XA 5F32A 1WCUA 2XLFA 1F4AA 1FPN1 1MS0A 2P34A 4XUNA 1ENRA 1ZM1A 4GD4A 1QJU1 1RYYA 3N35A 1W9TA 3HN1A 1WLWA 3VKMA 4NHXA 4XJUA 5FP4A 3JD71 1CWPA 2I74A 4R9DA 3ZXFA 2J1UA 1XE0A 3RYPA 4CUGA 4KMIA 1G86A 2VMGA 2PXJA 3MW2A 3E6DA 1RUG3 3UJQA 1UMHA 4BYYA 1UZWA 4BQ5A 2WFPA 4OI1A 1OURA 3NNLA 5FYBA 4N7IA 3URFA 5KXCA 4L9BA 3ACGA 4QPWA 4XAEA 5EJ1B 3N9PA 2J7MA 2JX9A 4L99A 3VZKA 1Z7S3 3OYWA 4TLFA 3SMHA 5DUUA 5DUXA 2WC2A 3TOJA 4I3PA 3Q9OA 3EBRA 5EYYA 2JWPA 2AACA 2GALA 4GWJA 1ZZ7A 5GLRA 3BYWA 4DO0A 3ZYIB 3OJBA 4XFIA 4YGCA 3H3UA 1AUYA 4Q4W1 4AGRA 5JZGA 3VBOB 5EHDA 1EV13 1UOGA 4K6BA 4LA2A 5HCFA 4XJZA 4COVA 3KS7A 4QPGA 1O59A 2R073 2WFF2 5CADA 1HB2A 3GF6A 1PNFA 3R4SA 1GZWB 4ZXKA 4C91A 4OFGA 2RS11 3DPRC 5FJHA 5JR7B 3ZSLA 1R1A2 2LALA 1VMHA 2BWCA 2HBTA 1TMF3 5F3IA 4FBFA 5F6KA 1H8TB 3IDAA 4WM8A 5FMCA 5B4XA 3WP5A 1W18A 4AK3A 4P9WA 4E2QA 4D7YA 1ZRRA 3PURA 3JQXA 5CG9A 2DF7A 2W0XA 3M2MA 5FBJA 3E6CC 1GOFA 4YWAA 2ZKNA 2VMHA 2IVIB 2VNVA 1LHVA 5K0UB 1MVEA 5LBBA 4YVWA 3WD5A 4CE8A 3VSSA 3OD4A 4Q27A 1NXD1 4Q4Y3 4DZGA 3N4MA 4XVHA 5A3UA 1LR5A 2BW8A 4CCLA 2C9KA 4RS5B 4XF4A 4BQYA 1W28A 4LNVA 4PDWB 2X09A 3MYXA 2AR6A 3OYWB 1BYHA 4Y4RA 4JRAA 1UCXA 3IMMA 5LY2A 1B09A 1W6NA 4TSVA 4XBNA 1XBFA 4OHZA 1A3KA 3ALQA 4O8NA 5FZDA 1R082 5CYYA 1W8ZA 3MGUA 5JZGB 4BLJA 4IE7A 1OLMA 2VL4A 2DV9A 2RS31 5FPBA 4XFGA 4JGYA 4CCJA 1YCIA 1RUG2 3WR0A 2CYFA 4BOWA 2OPWA 2E32A 2QQIA 2WWSA 1KDMA 3I4IA 4YW4A 1W39A 4V1PA 4TLGA 4YLZA 3BTYA 2PQQA 1X82A 2VTXA 4RHV1 4Z8BA 4TZDA 2BQPA 4DOUA 5GLOA 1PO11 1R083 2Z5WA 3CBNA 4Y3OA 4A3ZA 2XGXA 5GLNA 1UF2C 1QJX2 3AM2A 1ENXA 2G9ZA 4HKWA 2B46X 1X33A 3ZXKA 2ZZJA 1DGLA 2HKXA 2OT7A 4LBJA 4LE3A 4QMAA 2KM2A 3LIHA 3WDXA 4GMP3 1QJU2 4I30A 4PT6A 4C1WA 2YFSA 3PIJA 2QQMA 1YXWA 2WBKA 2A73B 5K0UA 3K77A 1ZBA1 5H9QA 3OBZA 4RR3C 1W0PA 4ONZA 5FKBA 4K21A 4KBZA 4W6YA 2R043 1K5MB 1LGCA 3ZFGC 5HV4A 5FLHA 4CCOA 2FMYA 1BHGA 4U36A 1OD3A 1RUD1 2W87A 1YFXA 3NRUA 5A6YA 2DCKA 2ID4A 2WDBA 1Q8VA 1UZYA 4IEWA 1O3SA 2BERA 1W6NB 4BK5A 3C7FA 4IETA 4KWKA 2FDJA 2VULA 3RZJA 5BNPB 4PIYA 4AAXA 1W3XA 4UW6A 3W59A 1HN0A 1BEV3 4HVRA 3J8F2 1L7LA 1CAUB 4Q4X1 4LBKA 1V6LA 1JZ7A 2DCJA 3GJBA 3GHMA 2K46A 4WM7B 5GLLA 1UU6A 2AEZA 2BFUL 4A7ZA 5T3NA 4LLFA 4COYA 4F3JA 5ACA1 1WCDJ 5F39A 3M1HA 4E9KA 5A1FA 4IEZA 4KC7A 2AGSA 3IWZA 1M06G 3UV9A 3NJZA 3RZMA 3Q8EA 3T08A 3ZX7A 3FLTA 4FVVA 5FZ8A 2ZEXA 5AY9A 1UZZA 1QWRA 4C0HA 3VN4A 4LKFA 1AX2A 5BPXA 4HPKB 4GULA 3VZLA 4C1XA 3DYPA 1CZSA 4N43B 2QTWB 3WEZA 1BXHA 3TB0A 1O5LA 3LA7A 5EZWA 4KG8A 2A3XA 4QXHA 3USUB 1LNSA 2H0VA 2YG0A 3WNKA 5FLJA 3ZYBA 1VBE1 5FZ1A 4K3UA 4Q8KA 1VMJA 1XOYA 2R063 5AC91 2VOXA 5CKNA 1SDDB 2WYSA 5LZ6A 2JDUA 1BBT1 1OSGA 2HEYF 4ZZ8A 3V0BA 4XMIA 1W6OB 3S6PA 3NV2A 4MXWA 1VLNA 1IPKA 4ZS2A 3U37A 4FPKA 1COV3 3MPPG 4TWTA 4AHWA 5C71A 2NZ9A 1MS5A 1DCSA 2WNOA 4FPLA 3AKHA 4UDGA 5BNOC 2QZ3A 4ARYA 2JDAA 3OEAA 1RMU3 4OMCA 4E27A 1KRIA 4E4DX 4XW3A 3BI3A 1ND2B 4A4AA 4KWJA 2X10A 1PZ8A 5L7OC 1YQ8A 4OUSA 4Q4V1 1Q8PA 1VBB1 3D0JA 3OGGA 4CDUB 4D6QA 5IVJA 3LOBA 1COV2 1UOBA 2E7QA 3OM2A 4YZ3A 1LULA 3VBOC 2PHWA 3FBYA 4X8NA 2ZGMA 5I8TA 1SDWA 4B4PA 1OUXA 3QEDA 4OZOA 2UYBA 3WDVA 3RZLA 4B1LA 1RIRA 2WS92 1ND2C 4DS0A 3FHQA 5D2AA 2VECA 1C8NA 2YU1A 4GAZA 3S30A 3T3YA 5LWBA 1FOD3 3B93A 4K9SA 2R1DA 2ARAA 3OUIA 3RGBA 2PN5A 3ZSKA 3VBSC 1DLCA 2NM1A 4OHWA 5ISLA 3C7EA 4FPGA 1S2EA 4GA9A 4MHRA 5EJZB 1URXA 1CAVB 3NNFA 3O1RA 5H9SA 2VCCA 3PVNA 4TXWA 1HIXA 4YFWA 3AP4A 1FPN2 3HEIA 1HV1A 4GH4C 2WQ4A 1BCXA 1NQJA 1YJKA 3VBUC 2OUHA 3CL1A 3SNMA 4C90A 4LBLA 4CUCA 4YG6A 1UKRA 5GALA 1PX4A 1VRH1 2NYYA 1H6XA 1AX1A 3LB9A 3DV8A 1VBC3 2BTVC 1NOVA 4RFRB 5CFDB 2HJIA 5CA6A 2XJPA 3AKTA 3LFMA 1W8UA 2UURA 1SLBA 1UIKA 1EAH1 2JDNA 3VZNA 2WT1A 5JIAA 3JD73 4AI1A 2Y33A 1PIV2 1GSLA 2VZVA 1RUI1 3GBWA 1QJU3 4LIVA 1OH4A 3T1LA 2Y0IA 2EAAA 4ASLA 4Z92B 4Q4V3 3PVEA 4YW2A 3LAGA 1RUJ2 2CAUA 5BY5A 2DUQA 3OM7A 4JDOA 4BISA 4AZZA 1N1SA 4QXCA 3D61A 1GZCA 5GLMA 2ORZA 1VALA 1W0NA 1TME2 4J6GA 4AI0A 1COV1 5JSOA 4MGQA 1DU3D 2RS12 2FCUA 5C33A 2Y6JA 1APNA 3BVCA 4QPIA 4AWDA 1BVVA 4O8OA 5CKMA 3SH5A 4DRVA 4MVTA 1UU4A 1D0GA 2A71A 3GALA 1LHOA 3UYJA 2Y38A 2C1FA 5C8CB 3N7KA 1AR72 3VDDB 3ZMNA 2D6NA 4AI9A 4MZUA 3SC7X 4L2NA 4FTEA 3RJRA 4K1YA 4DINB 5FY9A 4NIIA 4JGZB 1RUC2 4BLIA 3AMQA 1OI6A 4IEYA 2X53S 1DGWA 2W9XA 4OUMA 3LDBA 1PMJX 5FPAA 5KHKA 3FMGA 2EXIA 1H1MA 2WA4A 3DUIA 4XTPA 5JSRA 3AYAA 3I2JA 1WMEA 4NAOA 4HANA 1FATA 1HRI3 3AC0A 2UWBA 4UDJA 4D6SA 4GJYA 3OM5A 1DFQA 1RVF3 1MACA 1LEMA 3AB0A 3MBWA 2GH8A 1NA1B 2GN7A 4XFHA 3AJYA 5FUNA 1VBB2 1GQPA 3J7MA 1W6OA 3NVCA 5KXBA 5TSWA 1VKDA 3MV11 2BNOA 1PMHX 1D7PM 1U12A 4FOQA 2RJ2A 4UBGA 4AEDB 1Q43A 5JXJA 4ZS3A 1X50A 4EN6B 3OGRA 4QKDA 2BGCA 1G6NA 1JODA 2O8OA 2QNKA 2Y64A 4W6WA 5LBFA 4FPJA 4LITA 1UWWA 4QHOA 3PNAA 5T54A 3FE5A 4OQ8A 3J7NA 4D94A 2D5FA 1MQTC 2OIIA 3RJ2X 3WZ1A 5JCTA 1PNGA 2YGMA 2Y6HA 1UY2A 1WW5A 5A7PA 4NIDA 1ZBA3 2Q30A 3LPGA 4XC9A 5J3UA 3AZWA 3VDDA 1FOD2 1QNYA 4COUA 2AZ5A 3IN9A 2A7AA 3PVOA 3W21A 2H6BA 2P5BA 4RA0A 5FDBA 5KXDA 3K48A 4RGKA 3OBTA 5C4WB 3TEZA 5IK7A 4MGTA 2B4KA 5CFCC 1GP4A 1Z78A 5FO7B 4CEWA 3O0XA 2K9ZA 3I59A 2G1MA 5I0DA 3U0ZA 1DHKB 2VD7A 4Y1VA 3WG2A 3WVJA 1ZRCA 3H3LA 3WN0A 1W9WA 5BV6A 5J7MA 1YFUA 3HIFA 4D69A 3R4YA 3W58A 3ZFFC 4NHMA 2CGNA 1P8JA 1R093 3POGA 4FXGB 1W06A 2W1QA 3O5SA 4Q0QA 3ZSJA 2ZCWA 4BIFA 2ZS6B 1W2TA 1GWKA 4QM8A 1DZTA 1Y43B 3CZJA 2JENA 5FZOA 5LK5A 4ASKA 3QZ4A 2VW1A 3D0SA 4UW5A 3N9QA 5GLVA 4PDWC 2XBO1 4NMIA 3D5OA 4RSUA 1TQ5A 1IS6A 1R092 2YPDA 2DYCA 2LM3A 5A7VA 4DMIA 4NRPA 5HXMA 4AHXA 5KC5A 2ZGPA 1EYBA 4AOCA 4AFMA 1NCQA 2E9QA 2VO5A 4QX1A 3AX4A 1GMMA 3TRSB 3E5QA 2QKDA 1CX4A 4I2OA 3LF7A 3IT8A 1YRZA 1HB4A 2XR4A 4WVZA 4Z1VA 5FZCA 3FUOA 1QQP1 2FDIA 1XNDA 1IG3A 2QUOA 4GJZA 1BBT2 4KGQA 4NUBA 2RMU3 1JHNA 2B45X 1SLLA 3THPA 1Y3TA 4GWMA 1IZ3A 1H4HA 4CVUA 1WCKA 4LHLA 2WUHA 2NMOA 2YC4A 4GWIA 5FXWA 3WPZA 1KFUL 5FO8B 3ZPYA 3MV01 5JPMB 4DUXA 5FZHA 4XUOA 5C8CC 5DAXA 2C24A 2EF6A 2EIDA 3D8CA 1X7NA 2I2SA 1GBGA 1S55A 3PUQA 4BQ4A 1K12A 2CDPA 1W2NA 1MPXA 4KNCA 5LW9A 1IQAA 3TAWA 3K3OA 4Y1YA 5DAPA 2VCMA 1UYZA 4M0HA 5IVYA 4S2GA 1I5PA 1RVF2 1Z7S1 2EXHA 4PLMA 4YRDA 3VD7A 4XQ4A 5K8SA 1XRUA 4LOSA 1UNBA 3AKPA 1BEV2 3MW4A 3OY8A 2RE9A 3PHMA 1DYKA 1RHI2 2BNMA 2D3SA 3MO4A 4W8JA 3WQ7A 1OA3A 2G19A 5FPXA 4UW3A 3LEMA 2RR13 3I3DA 4WM7C 2DTYA 2P3IA 3MDPA 2VR4A 1XYOA 3SH4A 5FYMA 4LR4A 1R091 4CUBA 3D5YA 1DGRN 1D4M3 4CTEA 4EV0A 3SITA 3I2DA 4NHYA 1VBA3 3POIA 4CU9A 1HRI2 2JXAA 3IAPA 1VRH2 3R4ZA 3AFKA 5BNOB 3ZFEA 1NKGA 1QEXA 4HONA 1JXNA 5A7WB 4EE2A 4H3WA 2VUCA 3HT1A 1PMIA 5C4WC 4Q0VA 3MIFA 3WV6A 3I2OA 4YM3A 3NNJA 1CJPA 1XJAA 1GFF2 2LW8A 3MFAA 3VSZA 4D7TA 4FPOB 3TAYA 3ECQA 3RVHA 1RB8G 4RFT0 3WLUA 3A22A 5K4LA 1JYIA 1ZREA 3R4UA 2GDFA 1SCRA 1M4WA 2OX0A 3KB5A 4R9BA 4AFAA 1NE6A 3OEBA 4WM8C 3PU3A 1JYTA 4YW5A 1AR62 5KC6A 4XILA 4CEYC 2CDOA 2ADDA 4CDWB 1RXFA 3N3HA 5FZMA 1NCQC 2YPJA 5FZAA 2Y6FA 5FZIA 4AW7A 4XEZA 1MZFA 3VBRC 2CGOA 4GALA 4NIGA 1SBFA 2FCTA 3DYOA 2PHLA 3M3OA 2WRAA 2WZR2 2A75A 2XB6C 1W05A 5FYIA 4EN9B 1ULOA 3IDBB 4PVAA 2DFBA 1RITA 5F5AA 4QB1A 5L7OA 1QXJA 1WZXA 3FWEA 2Y26A 2VAUA 5E6HA 2DUOA 2XVLA 5FZ6A 1ENQA 2TUNA 1LHWA 4PI0A 2YC0A 3RMXA 4IV3B 3WF1A 1VBD2 3W5NA 1AR71 2A6ZA 5LRRA 1G9DA 3RI9A 1OOPA 2VZ1A 4LK6A 4Z2WA 3T4VA 1DQ1A 2NP0A 2WNVA 4AE2A 3K3NA 1R1A3 3B00A 5AVAA 3VBFA 2ZGOA 2F4PA 4HFSA 1SFYA 4BMEA 2GMMA 1NCRC 5C2MA 1W8TA 4IV1A 3I2HA 3J7LA 1VBE3 5I0RA 4XF1A 3RMYA 4FFFA 2Q8OA 4Y4YA 3ZFFB 2DWRA 1CAXA 2WO1A 1X9TA 3FJSA 4N53B 4OHXA 3C3VA 4CDQC 3D60A 2XMLA 1D0HA 1AR82 1FMD3 5A3OA 1LAJA 4QWNA 4META 1DYPA 4GB31 3ZYHA 4X6RB 1US3A 1V00A 4ET7A 1C5HA 3AJZA 1SHWB 3KCCA 1RUD2 2ZGLA 2JECA 2Q4SA 3LKJA 4URTA 4ASMB 1RUH2 2VZSA 3FL7A 1R64A 1B35A 2R16A 4LEJA 1BEV1 4WV8A 5D21A 3ZO0B 4IW3A 1OQDA 5I0SA 5AYDA 4NPLA 3VBHB 1OYGA 2R1BA 4K40A 3QBQA 1UZ0A 4Q4X2 5JUVA 1TZOA 3EYPA 3WX5A 1PM7A 2WQZC 5FQ0B 3F95A 3SCGA 2JDYA 1Q8OA 1S4CA 4ISQA 4PQQA 3O1UA 2CSGA 5IVEA 1JZ4A 4IE6A 2QJVA 3SKJE 2D97A 5FMOS 4B7KA 4HKOA 2WWJA 3CU9A 1V9U2 2E33A 2WR9A 4NHLA 4UF0B 4CUAA 2YUEA 5ABJC 4PCRA 2A3YA 4AFDA 4AF9A 3MIBA 4LUMA 2DVBA 2FDHA 1U0AA 4XJ9A 1WMXA 4A7KA 2TBVA 2XOMA 2VW2A 5FJKA 4MUVA 4YW3A 5T50A 2VY0A 4N9HA 5E1RA 4OQ9A 4FPEA 2RM23 1BQPA 4QPGB 1BK1A 3RI8A 1PX3A 4KMQA 4J25A 4TN7A 1W90A 1VBE2 4CPBA 5I91A 4KWLA 2CV6A 4QDQA 4LXLA 1W6PA 3KVAA 1L7RA 2WINB 4Q4W3 1H8TA 1H9PA 4QX7A 3THTA 3UKTA 3O1SA 3WPUA 4RN5A 5FMDA 3VT1A 4ZPIA 4DQAA 4R8HA 3A23A 2Z42A 1AR61 3IAQA 4GIQA 2XQXA 2FZ1A 3WG3A 4YG0A 1JZ2A 3FZ3A 4YYOA 2RS33 3NNMA 3VHRA 4HLTA 1B35B 1AYM3 1ZZ9A 4HBNA 4IEQA 2WT2A 1EP0A 2R0HA 4IV3C 5EP9A 3USUA 5F3CA 4E8DA 1UYYA 4EYUA 2VMEA 4I09A 4LHSA 1FV2A 1A8MA 4HKLA 3NO8A 1Z0HA 5B4NA 5G04L 4W4ZA 2H0BA 2HWB1 5FV3A 5GLQA 2VCBA 1CZTA 3TN91 1US2A 4IDZA 1IGOA 3C7OA 3RRDA 2PHRA 2B9VA 3ATGA 2R7EB 4Y33A 1POV3 3R05A 2B8MA 3K46A 1O5UA 4NROA 3AXEA 4MYEA 2DCZA 5C3RA 1WL7A 3LGRA 2VG9A 4ZY9A 2WO7A 1WUVA 4M3CB 3KV6A 4OULA 5F3EA 2HWC1 4L92A 5EPAA 3WNXA 5IW0A 1GICA 1ND3B 1RUC3 2W47A 3NJYA 3E6BA 1UY1A 1HKDA 2X8KA 1XYPA 3I2KA 1LOEA 1O8SA 1JYCA 4XF3A 1AL23 1YLLA 1W6PB 2X5IA 4Z82A 1F15A 4LA3A 5DDJ3 4BQWA 2WNVB 5K9YA 2AEYA 4YZ4A 5KR7A 1AR81 1YQ2A 4YARA 1AR93 1LECA 1GQGA 3ZXDA 2YBSA 5C8WA 1VRH3 2A6WA 5JXHA 1RUOA 4HN0A 5J48A 4UWDA 2WWUA 4KQ7A 4LE4A 4COTA 2BPA2 4CU7A 3ZDSA 3L2YA 3JQWA 2ZMLA 4Q29A 4PHZA 4RR3A 1J3PA 3WDWA 1BLZA 3M3CA 4PJYA 3H8OA 4XUTA 1UY0A 2ARCA 2SBAA 2JB8A 2IC1A 1FT9A 3NQHA 5C5UA 3JBG1 4N2RA 2O1QA 1WW6A 2WLQA 5IWFA 5FPLA 3POYA 3VBSB 5FKCA 2WNUA 2WNEA 1N3OA 2HYXA 3FUQA 4M4PA 4HVQA 2W2IA 1SZBA 1NLSA 2X8SA 3UGFA 3UT0A 1UX6A 1EUUA 4DEVA 4FPFA 1A34A 5C70A 1HQLA 5FPUA 1JOBA 2JDPA 2J1TA 3E5UA 1LCLA 3WHTA 2J1SA 2ZX4A 1MEC3 4L8QA 1XNBA 4P9LA 4UI9L 3RZZA 3KMHA 2RR12 2PLV2 4M4RA 2X5IC 2JICA 3R67A 1OA2A 3POSA 2PHXA 2ZEWA 3T30A 2DU0A 4JCKA 3L2HA 5F7UA 4FCAA 1CVNA 1VJ2A 4OUEA 3K4DA 4IGOA 2QQUA 3I54A 3AZZA 1JU4A 3RFRA 2IXIA 1HXS2 1OXCA 1X8MA 3OCPA 4CU6A 3VSRA 1OPMA 3B3QE 2W46A 4B4RA 1S2BA 2JDMA 2UY8A 3ZYFA 1SG3A 2RMU2 1H0BA 3MFCA 4XACA 3WPVA 1A8DA 1GNZA 2QCSB 2MEV1 3LCPA 2UWAA 3N9LA 4CCKA 1UZVA 2IXJA 2GZWA 3J26N 4YM0A 3AMNA 4CXXA 3LV4A 1NLRA 2DUPA 4AVTA 1CD3G 2PAMA 4FXKB 4RL7A 2HWD3 1ULCA 5C7GA 1JZ3A 4FP2A 1VBD1 2QVSB 4XE9A 4AQ2A 1SLIA 4CEWC 1G9BA 2RM22 4Q4X3 5FZBA 1AL0G 4RYDA 1OD5A 4QXKA 3S7EA 4WVMB 1SCSA 3ZXLA 5FR3A 3FBMA 5E16A 1W9YA 1XXNA 1HB3A 3CJIC 4XIKA 1YI7A 3ZMOA 1CONA 3N36A 1QDOA 1GYDB 1JMUB 2A6VA 2YC2A 4YGEA 2DURA 5FUIA 2YGLA 3FN9A 4IXLA 4D6RA 1V9U3 3R6SA 3T0AA 1JYVA 1CAWB 1CPMA 3NNGA 5FBZA 5LATA 1IKQA 4AG4A 4QKNA 3GJAA 4EZHA 2VOKA 2XVGA 5HCHA 1PK6B 1V6NA 3I2GA 2FDGA 1H2KA 4TYSA 4AHYA 1XE8A 5FY1A 1WLCA 2UY9A 4LULA 4U6BA 2D44A 3UNPA 1AR83 1FMD2 4F83A 2IXKA 3LPFA 1QQP3 3PJQA 2D43A 4XDPA 1JOPA 4I3GA 3IZOA 1SPPB 2JG8A 4FOWA 3IIIA 4GWNA 3RNSA 4EN7B 4V2VA 2O0OA 5IAXA 5D8AC 1REDA 3KZ4C 4OI4A 3U1XA 3WHUA 3WATA 1DGWX 4O7XA 2C4XA 5JDBA 3KM5A 1ZRFA 1W8WA 2VJXA 1KS5A 1HXS3 5F2SA 2IFWA 3A4UA 3DL3A 2H6CA 4CU8A 3BYLA 3M4FA 1O3RA 1TG7A 1AXKA 4BPZA 2VVEA 1ULDA 1YYNA 1Q56A 3VBSA 2RS32 1HRV2 4HN1A 4XBQA 2WS91 2ZHNA 1IS4A 1RUG1 1YQ5A 1GP6A 2FQPA 1AZDA 1O4ZA 1SQ4A 2J1AA 3MHZA 1KDKA 4H2AA 4N4BA 3OM6A 1DLLA 4IE5A 3ZN5A 1WCQA 4DRRA 5A70A 4DIQA 2OQ7A 1TVGA 5FP8A 1QF3A 4P08A 4BXFA 3PUAA 2AC1A 2VZTA 2ZHLA 1GR3A 3I3QA 4YPJA 5APAA 1V0AA 1V6JA 4H7MA 4ZU4A 1OOPC 1HXS1 1NQDA 2LRPA 3GZTB 2VMDA 5FK8A 3RYKA 4P9GA 5GZGA 2P6CA 2VBDA 2CWMA 4A6SA 5IVBA 1QJY2 3KWVA 3J4UH 4LO4B 1MVQA 5LBEA 4DXZA 1HJFA 4BXSV 4XETA 1XC6A 4Q0SA 5LA2A 3BYJA 3QEFA 1D2QA 4B29A 1VAVA 2GU9A 2RS13 1AYN1 4KH9A 3TN92 1J1TA 1N3PA 4AEDC 5J1XA 2DCYA 3AP9A 1EAH2 5L19A 1QGLA 5JWPA 2JG9A 3WDYA 2ES3A 2ZX2A 3PTRB 3E97A 1J3QA 1LOFC 2BUKA 1N1YA 3AXDA 4D0QA 3LE0A 3LIGA 5A32A 4FQZA 5DUVA 5J96B 5FLIA 1C57A 3THDA 5IVVA 4FOYA 4FSJA 2YYOA 1PO21 3T2PA 1EY2A 1RUD3 2C5DA 2B5HA 1RC6A 4V2WA 1PO23 1EPWA 4EROA 1ULEA 4QX0A 4XABA 1XNTA 2ZGRA 1VBA2 2B9UA 4XDOA 5ACA2 3DPRB 3KQ4B 4Q26A 3J7HA 2JKXA 4QQOA 3VB9A 4A6OA 3TEWA 2G4IA 1F35A 3OY8B 3BUCA 4CEYA 4K1ZA 1XU1A 2RDNA 2WT0A 3ETQA 4IESA 1U5XA 4RQPB 1HRI1 5JZGC 2ZX1A 1MS4A 3SQOA 1RJ7A 4Q2FA 2A3WA 4B7EA 4ZU5A 2PFWA 1CX1A 4ES8A 2ZABA 1RL3A 3TYJA 1CZVA 4Y5TA 2BRTA 1QU0A 1FPN3 5GLUA 3JCIA 5ABJB 3UGHA 1YI9A 3KLSA 3IPVA 2P6HA 1NYWA 1KITA 2OVUA 2AENA 2VU9A 2D98A 4JQTA 4JHTA 2NMNA 4BU2A 3HMYA 4FAHA 4JKLA 3WF3A 5HPOA 3WOGA 1YWKA 4AQ6A 5HCBA 4LO7A 2GNMA 3EXUA 4JRLA 5FTTC 3POFA 1DF0A 2R32A 3IKWA 2YU2A 3W20A 3O1OA 3NV3A 2QDRA 5BYNA 3MLJA 2Z4FA 5EIYB 1GWMA 4AVBA 1PHMA 1FXZA 3FHAA 2ARXA 1Q5OA 5M0TA 2FMDA 5EFUA 2JB4A 2OW4A 2ZMNA 2QQWA 3KHBA 4GZ9A 5C9AA 5BNNC 3BIWE 1J58A 2DDUA 3N9OA 2QQPA 4IEUA 3H7JA 4CCCA 3ON7A 4YZ5A 4P00B 2ZX3A 3OSDA 2OYZA 5A6QA 2PQSA 4LBQD 4AAPA 4UYBA 4CZSA 5C3QA 1F8VA 3IDEA 1NY72 4QKFA 3AZXA 3VDDC 2VH9A 1ZZBA 5L9RA 4CRQA 1ULPA 1XNKA 4JAAA 3RWNA 5BNNB 2JE9A 5CFCB 1C5IA 2NN8A 5E8AA 1YFWA 3TNQA 2WS93 1POV0 4AEJA 5FXZA 4AI8A 2P37A 2PTMA 4HVOA 4KI5M 1H2MA 2VOVA 4OYUA 4HK9A 2XH6A 4QX3A 3WF4A 4NVPA 5DN2A 1HQWA 3MIDA 3BCWA 3AL6A 3NMBA 4JGYB 4YM2A 1H6YA 3ZKYA 1UQXA 5L7OB 1W2AX 3ENRA 2WYFA 3TBDA 1QOTA 5L9BA 1OA4A 1QOOA 2PYTA 4IV3A 5IT6A 2BVVA 4RGAA 5FZEA 3V65A 3DGTA 4CDXA 3B01A 2DBIA 4QM9A 4ZZ5A 5JXGA 1AYM1 1FYUA 2LROA 2VZ3A 3B02A 3KF3A 1UMIA 3SLIA 1AYN2 4XBLA 1UD1A 2MEV2 2Q8DA 1YO8A 2HWD2 1LU2A 3AZVA 2DFCA 4OVEA 5FOBB 3VD4A 2Y6LA 1WA6X 1HV0A 2LTNA 1O8PA 3CHXA 5D1IA 4XJ8A 2DU1A 1CIYA 2GNTA 1A78A 5C4WA 5GZFA 5J98B 1EPZA 1D4M1 3OGSA 2XJUA 3WMZA 3KV5A 1VB2A 1JW6A 2P3KA 4QHBA 4ZONA 5FP9A 3ACIA 3I59B 2VQUA 4E2GA 4AVCA 5FWJA 1LJ7A 2XBO3 1H2NA 2Y0OA 1IS5A 3POWA 2CL2A 4QGMA 1JYWA 3AP6A 3AKQA 4LBMA 1YIPA 2W94A 1REFA 1V9U1 1VBD3 1I3HA 2ZGTA 1NZCA 1W0OA 3H7YA 4HL0A 4BIOA 5CFCA 3LSDA 1DQ5A 3I3BA 5JVVA 1MZEA 2WNUC 3ZM8A 3I8TA 1E5IA 2D6MA 3M70A 2XJTA 2XUMA 2AUYA 4PBOA 2PA7A 5FYHA 5H9PA 2A5ZA 4AXOA 2W1WA 3C2UA 4Q0UA 4ZU7A 1O91A 3HAGA 3VZOA 2PHFA 1BBT3 3I97A 1AYN3 4JGYC 3AP5A 5AFEA 4N1IA 2VMIA 4LO6B 4MXVA 2KD7A 4NPMA 3ZFEB 3I2IA 2DVFA 4YNIA 3WSOA 2QFEA 3L9JT 3LEGA 1XSRA 1PGL1 4GKYA 2ORXA 3ITQA 3O7OA 4EWAA 1J83A 4HPKA 2W92A 4NRQA 5CZKA 2RDQA 4GKXA 3B9IA 3P6BA 4OLLA 2R071 2B42B 1VBC1 1HLCA 2ZJCA 1JYNA 3VDBA 2P17A 1RJ8A 3PMSA 1IHMA 1VRBA 1RUF3 1LHUA 3ZLIA 3WINE 3ZN4A 5FOJB 4NWVA 5F5QA 5FMBA 5LEKA 5FZGA 1CGPA 2IXLA 2WAAA 1QH6A 1QY4A 3GGLA 3N7JA 4L97A 3VHPA 3KCXA 1S0EA 2ZAHA 4CDWA 4EN8B 1JUIA 5FRAA 1F4HA 1XQNA 5JI9A 4S2FA 1F5JA 4JGZC 4BE3A 4LT5A 1RUF2 1NY71 3HR9A 3QACA 1D4M2 1G9FA 2HBUA 1W99A 4BWOA 2BNNA 2Q8CA 1S0GA 4QPGC 4U6DA 3BGAA 4YZ2A 4Y20A 4E4HA 3GCXA 3C7HA 1MQTB 5T5LA 2PHUA 3OTFA 2VNGA 4QDSA 2VMFA 2RJLA 5FAXA 3WAUA 4KL1A 5I0UA 1OQEA 2V4AA 2BBAA 4BB3A 4ZHNA 1QJY1 1UXZA 4UBHA 3MLKA 2D6KA 5LA9A 4L0PA 5FLWA 1CQ9A 4YG3A 4AR2A 2WLPA 4YSFA 4GXLA 4PF1A 4OI0A 1C3HA 1XPWA 1PVC2 1LTEA 1K42A 4OCTA 4XJWA 5A8DA 5A33A 3GDBA 2XQRA 1RUNA 3DCQA 3KSCA 5JIUA 4S2HA 4AVSA 1J3RA 1T6BX 2UWCA 2WJSA 5F3GA 3NKTA 5AC92 5KWRA 5LA0A 1SLCA 4LBOA 2E51A 4I0WB 2YDEA 4XTMA 5LCWL 5EXOA 1S2KA 3LQCA 4YW1A 3T0DA 1BMV2 2Z2SB 3WDTA 1DQ6A 3Q8FA 4J1XA 5A7WA 4Y24A 2R49A 1JZ8A 1YJLA 3EJKA 1GWLA 4DY5A 5CFDA 3WW2A 4N43A 3THCA 1MS8A 1I9RA 5GLZA 3M7AA 4INDA 5FYCA 5DAQA 4B4QA 3VBFC 3MIGA 4M01A 3O0VA 3H8RA 1EV12 1YQCA 4G3YC 3D6EA 2VNOA 5H9RA 1MEC1 2FDKA 2WFF1 4JQRA 5I8SA 4QDRA 4FP3A 2VUJA 4FPHA 4Y20B 3SKVA 1K5MC 2YROA 3ZFGB 2Y8KA 2ZEZA 3D82A 5ACA3 1DG6A 3BTXA 2EXJA 4UW4A 2PAEA 2EXKA 2ZTNA 4AVVA 4EWEA 2P3JA 2D40A 5B2GB 1NLQA 3WASA 2GMPA 2FCVA 2VXRA 1DQ2A 2GP3A 4FPCA 4G9SB 5E88A 3JBG3 1WLTA 2B39A 4YM1A 5F6LB 3CNAA 5FPZA 2VCAA 1Q8QA 5LEJA 2BYVE 3MF9A 4A42A 1DQ4A 4ORFA 1NZIA 2XJRA 1UKGA 1VB4A 1F31A 1EUTA 4WZFA 1KGYA 4HMZA 4O8PA 1UYXA 1KQRA 2ERFA 3GNEA 2VZOA 4BHPA 3HQXA 5FYTA 3NL1A 4I01A 4JTNA 1YQ6A 1LHNA 2RMU1 4GH4A 1UU5A 4RGGA 3VBUA 2KXLA 4XPVA 2YB7A 4BCUA 2RS51 4JDMA 5HBAA 4IGQA 4XFCA 1H1AA 1JZ6A 4XCAA 3V64A 2VGDA 2WO2A 3WP4A 5T52A 5K0UC 1LOCA 4CXYA 3B69A 5FZKA 4UDKA 3VL8A 1RUI2 1PT2A 1UL9A 5C5TA 3IIAA 4CCDA 3O0WA 2RM21 2WZPP 3VDAA 1YFYA 5GM0A 3SCFA 1KJRA 3I7DA 4D7SA 1X8EA 1F5FA 3O1PA 1NG0A 1OLME 3C8XA 5ANNA 5FY4A 1JYXA 3FFZA 4CCNA 3FLRA 1RUI3 1SFPA 2MNGA 3K1UA 4PQ9A 2X05A 5EWSA 2VUAA 2ZHKA 3AVRA 3SH3A 3EO6A 1ZBA2 1CESA 3BU7A 1CAUA 2XPJA 4A45A 5IVCA 5FFOC 2ENRA 3FC0A 3WNMA 1N1TA 3H9AA 2Y60A 2HWD1 2VM9A 3LWCA 1LB2A 2YMZA 1OH3A 3EMRA 4HG6B 4DEQA 2HWE3 2QE3A 2CU5A 2Z79A 4LUKA 5IAVA 1ZBE1 1ODNA 2JG9C 2ZEYA 2CGPA 2W08A 4LMFA 2QQOA 2Q5TA 5A1LA 1AR63 3ACFA 5DQ0A 3SXWA 3PMEA 5C3SA 4O9EA 5HCAA 1HW5A 5L36A 5KHIA 1YEWA 3J8F1 4R52A 3OUHA 2VQTA 1W2UA 3HNMA 4QU1A 5DAWA 1K45A 3H50A 2IZWA 4CEWB 3A0KA 4GB33 5ERLA 1UYPA 4AGVA 4DNYA 3M3QA 1OBNA 1R1ZA 3LEKA 1TMF1 1UV4A 5EV7A 2HWC3 2RHPA 4S2DA 3ZXEA 3CMGA 4XFFA 1HQNA 4ATFA 4TTGA 1OLRA 1LENA 2GMEA 3VKFC 2RS53 4MHUA 3BYNA 5I0TA 4UFKA 5FZ0A 5A32B 4CP9A 3I3MA 1YUDA 5DDJ2 4Y1ZA 1DBNA 3NAPC 2I45A 1HRV1 3HNYM 5CFDC 5IJRA 3SHRA 5D8AA 1ZBE3 1F2NA 1LEDA 4A2UA 5IYYA 5CG8A 4KCAA 2GNBA 1C8M1 1ND2A 3WP6A 1DDLA 4XYXA 1ULFA 4AGGA 4ISRA 4RD7A 2XDVA 4AI3A 1GKBA 3Q8AA 2W95A 5FXXA 4KU7A 4DPNA 1NA1A 2R041 3QEEA 1XYNA 4MSVA 1Q8SA 3IMNA 5F1RA 5A7VB 2PHTA 2ZKLA 4MLOA 5CVRA 3WNLA 2HWF3 1PVXA 4M3CE 5A7SA 4K7JA 1ASJ1 2YBKA 1V6IA 1ULGA 2YHJA 2XHNA 4R4XA 5FZLA 2MPFA 5KBFA 3JD72 1VE0A 4C8DA 5LK7B 1UOJA 2O14A 1C4RA 5FIXA 5FZ7A 5AC93 4UFLA 3UESA 4PI2A 3POEA 4NHKA 4Q4V2 1S0CA 4CCMA 5FYVA 4CDWC 1Y9QA 3RWKX 1E5SA 1YIFA 5DABA 2OZJA 2ARBA 2WFF3 1PO13 3KGZA 1H8TC 3P3PA 5GLPA 5FO9B 1TEIA 1PGW1 1WMDA 2X5IB 4JHZA 4KBBA 1SBEA 1WCSA 5C6CA 1UX7A 4P9IA 3QLQA 2VE1A 3K4ZA 1AL21 3VKNA 4BA6A 5AYEA 5F37A 1NCRB 1LRHA 4Q4W2 4P5HA 5JOWA 4BH9A 2Y6GA 1BK0A 3H1MA 5DG1A 1CJDA 2D93A 2WA3A 4DXTA 4FAGA 3WW3A 1V70A 5DG2A 4JX0A 4ONUA 3N7MA 1I5ZA 1JS9A 2ET7A 4QT6A 2ZA9A 3UGGA 4KCBA
chains in the Genus database with same CATH topology
4XURA 3VD5A 2VZQA 1GQPA 4CU8A 4ZXEA 1VKDA 3BYLA 3MV11 4DXRA 4FFIA 1PMHX 1D7PM 1TG7A 1W8NA 2RJ2A 5JXJA 2VOTA 3OGRA 4BDVB 4UDIA 2QQJA 2Y64A 3D5ZA 3MUY1 2J1AA 1GYEB 1UWWA 4E8CA 4N4BA 3OM6A 3MUZ1 4XZUG 2HLEA 1WCQA 2WZEA 3I3EA 2BGOA 2V72A 3AKIA 1TVGA 2Y6HA 2BGPA 4P08A 1UY2A 4YPJA 2AC1A 2VZTA 5JOYA 3LPGA 3UETA 5FK8A 2VMDA 4N2ZA 4DUWA 4FFGA 5IFTA 3HOBA 4BXSV 5IFPA 2J22A 1XC6A 1GUIA 5LA2A 3BYJA 3QEFA 3T2OA 2B4KA 3OBAA 3WF2A 3IB3A 3E1F1 4BK4A 5I0DA 4BJ0A 3A21A 2EIEA 5J1XA 5JOXA 3WN0A 1W9WA 3F2ZA 1GOHA 4UOJA 3R4YA 3CQOA 4D0QA 3LE0A 3LIGA 1DP0A 4JKKA 1P8JA 3WQBA 2W1QA 3K75B 1ST8A 3THDA 3HJRA 4FI9A 1W2TA 3T2PA 2OXBA 3QZ4A 3CZJA 2QBXA 3LEIA 4MADA 4QX0A 1XNTA 3J7HA 1J84A 1IQDC 2JKXA 4A6OA 5A7VA 5HXMA 5C0PA 2VO5A 4QX1A 1JHJA 1GMMA 4A41A 3SEPA 4FFHA 1Y4WA 3NJXA 1CX1A 3LF7A 3P2NA 1YRZA 1GU3A 1CZVA 2YFTA 1GNYA 3WF0A 3UGHA 4UDKE 2JE8A 2X8FA 2QQKA 5HPOA 4JKLA 3WF3A 5A1AA 3WNPA 4QX2A 4JKMA 4QB6A 4CVUA 4QB2A 1L7QA 3BN6A 2WUHA 2YC4A 4GWIA 3WPZA 3WNNA 3MV01 5FK7A 4DUXA 4XUOA 3DYMA 1K3IA 2EIDA 2Z4FA 5EIYB 5DMYA 5LA1A 3FHAA 1K12A 2E26A 2CDPA 1MPXA 3VD3A 3W5MA 2QQWA 4GZ9A 3TAWA 1UYZA 2DDUA 4MO3M 4P5YA 3U75A 1I5PA 1WKYA 4P00B 2EXHA 3BYKA 3K4AA 3VD7A 5GLKA 2PQSA 4KWUA 3D3AA 3KF5A 2B4WA 1ULPA 4W8JA 2WQ8A 3MO4A 2RVAA 3AKFA 3LEMA 4Z2AA 1HN1A 4OYUA 2W3JA 4KI5M 3VSFA 3I3DA 4QX3A 3WF4A 5DN2A 2WO3A 4W50A 1OF3A 2VR4A 3JXSA 1H6YA 3HNBM 4CUBA 3D5YA 1T2XA 2VZRA 1JI6A 2YFZA 4CU9A 1W9SA 4ZZ5A 3IAPA 5JXGA 3R4ZA 3T09A 2QQVA 2YFRA 3WMYA 2VZ3A 1NKGA 3KF3A 2W1SA 1UMIA 4DXSA 3VD9A 3I2FA 3OGVA 3VD4A 2VC9A 1JZ5A 1OF4A 2Y6LA 4NOVA 1O8PA 2LW8A 3PUHA 3VSZA 4QAWA 4QQSA 1CIYA 1UXXX 3ECQA 3A22A 3OGSA 3WMZA 1NX9A 3OEBA 3ACIA 2VQUA 3A7QA 3VT0A 2CDOA 2ADDA 1F4AA 4XUNA 2VZUA 1JYWA 2RV9A 1RYYA 1W9TA 2W94A 2QQNA 3AKGA 2J1UA 4KMIA 3T0BA 3DYOA 3I3BA 3ZM8A 1JU3A 1UMHA 4PVAA 1ULOA 4D8MA 4QB1A 3EB7A 1XNAA 2W1WA 4EQVA 3WF1A 3ACGA 4QPWA 5EJ1B 3C2UA 2J7MA 3W5NA 4XUPA 3I97A 2VZ1A 4N1IA 3OG2A 2KD7A 3I2IA 4GWJA 5GLRA 3WSOA 2Y6KA 3LEGA 5A8CA 2ORXA 1J83A 3ABZA 2W92A 4MLGA 5CZKA 4AK7A 3P6BA 3I2HA 3VDBA 4FFFA 1JYNA 1O59A 4MGSA 2LS6A 2WO1A 5JXIA 3D60A 5FMBA 2WAAA 3GGLA 3IDAA 5FMCA 5B4XA 1W18A 2XONA 3QC2A 3GM8A 1US3A 4ET7A 1SHWB 1F4HA 2WAOA 3CDZB 4D47A 2VZSA 3FL7A 4KCBA 2V5DA 1R64A 2EICA 1GOFA 5AYDA 3WN2A 1W99A 1OYGA 1UZ0A 1KEXA 5JUVA 3EYPA 4U6DA 2W1UA 2YFUA 3BGAA 4MOAA 4PQQA 3VSSA 4LKSA 3C7HA 1JZ4A 4XVHA 4QDSA 3SKJE 2VMFA 2C9KA 3LDRA 2X09A 3WAUA 4ARXA 2WN2A 3CU9A 2E33A 4CUAA 5JR2A 1GOGA 4O8NA 2BBAA 1UXZA 5CYYA 5JMOA 4L0PA 2XOMA 5FLWA 4PF1A 5A8DA 2WABA 1XPWA 2VL4A 3ZXJA 3GXUA 3GDBA 2XQRA 2QQIA 2E32A 1PX3A 3ACHA 4KMQA 5LA0A 5GLOA 3NJVA 4QDQA 5LCWL 5DPNA 1L7RA 3LQCA 4A3ZA 3T0DA 3WPUA 5GLNA 4RN5A 5FMDA 3VT1A 1JZ8A 3A23A 3IAQA 4LPLA 2XQXA 3CIHA 3ZXKA 1JZ2A 3THCA 3LIHA 4PT6A 4P02B 2YFSA 3PIJA 2QQMA 2WBKA 3U14A 4E8DA 1UYYA 2VMEA 3K77A 4LHSA 4ONZA 5B4NA 2V4VA 4QDRA 5G04L 2J1VA 4W4ZA 5FKBA 5GLQA 2VCBA 3SKVA 2Y8KA 2ZEZA 1CZTA 1BHGA 1US2A 1OD3A 2WN3A 3C7OA 3LDKA 2W87A 2EXJA 3NRUA 2B9VA 2EXKA 2DCKA 2ID4A 2R7EB 3VDCA 2WDBA 3KSTA 3K46A 2BERA 4BK5A 3C7FA 3WASA 1WL7A 4UAPA 4KC8A 4AAXA 4ZY9A 2J1RA 1JZ7A 2DCJA 2QQLA 2VCAA 3HPNA 5GLLA 2AEZA 4A42A 3WNOA 1UY4A 4XUQA 2W47A 4A44A 3OM4A 1EUTA 1UY1A 1KGYA 4KC7A 3I2KA 4O8PA 1UYXA 1O8SA 2VZOA 3T08A 2AEYA 2ZEXA 5AY9A 3C7GA 1YQ2A 1OT5A 1W8OA 2YB7A 5JXHA 3DYPA 1CZSA 3VT2A 3WEZA 2E31A 1JZ6A 4COTA 1LNSA 3WNKA 2BZDA 2YG0A 2WO2A 4CU7A 1NUKA 2JD9A 4UDKA 1SDDB 2WYSA 1PT2A 3HN3A 4XUTA 4ZZ8A 1UY0A 3T2QA 2OKXA 3U37A 3NQHA 3VDAA 4N2RA 5C71A 4UDGA 3AKHA 4ARYA 2JDAA 3OEAA 5FKCA 4DUVA 4OMCA 3C8XA 2HYXA 4M4PA 5ANNA 1JYXA 2X8SA 3UGFA 4A4AA 3K1UA 1EUUA 2X10A 3P1IA 2X05A 3OB8A 4DEVA 2C26A 4A45A 5C70A 3OM2A 2J1TA 2J1SA 3CKHA 3WNMA 3QEDA 5B6SA 4OZOA 1UY3A 2VMCA 2VM9A 4UI9L 4HG6B 3FHQA 4M4RA 4DEQA 4AK6A 2ZEYA 3R67A 2QQOA 2ZEWA 1Y7BA 3ACFA 5DQ0A 5F7UA 2WZ8A 1DLCA 2X8TA 4OUEA 2VQTA 2L9LA 3C7EA 3HNMA 3K4DA 2QQUA 5AYCA 1K45A 5EJZB 1JU4A 4OMDA 2ADEA 2VCCA 4CU6A 1UYPA 4IUGA 4TXWA 3HEIA 3VSRA 1NAEA 2W46A 3LEKA 1UV4A 5B6TA 4CUCA 4TTGA 3CMGA 2VDTA 1PX4A 1SG3A 3BYNA 4PVIA 3WN1A 1H6XA 3ETPA 3WPVA 3HNYM 5IJRA 3LV4A 5IYYA 2J1EA 4KCAA 2W5FA 2VTFA 5C7GA 1JZ3A 2W95A 3QEEA 2VZVA 5A7VB 1OH4A 3PIGA 3WPYA 4RYDA 3WNLA 3ZXLA 2ZXQA 1YI7A 3OM7A 3DECA 1GYDB 3D61A 2XHNA 2YC2A 5FUIA 3SEEA 5GLMA 2ORZA 3FN9A 2W91A 1W0NA 5FIXA 3T0AA 1JYVA 4MGQA 3UESA 2VZPA 2Y6JA 3NNGA 4AG4A 5IHRA 3RWKX 1YIFA 4O8OA 3I2GA 5GLPA 2EIBA 4JHZA 4U6BA 5JOZA 3SC7X 3UNPA 1Y9MA 3PUIA 3LPFA 3LFIA 1UX7A 3K4ZA 5AYEA 1DYOA 1GYHA 3IIIA 4AK5A 5JOWA 2W9XA 1PMJX 2Y6GA 5G05L 1K42A 2EXIA 3WATA 1Y9GA 4DXTA 3I2JA 2C4XA 4JX0A 4LQRA 3AC0A 4UDJA 3OM5A 3CZUA 3UGGA 3MBWA 2VJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUR A;  3VD5 A;  2VZQ A;  1GQP A;  4CU8 A;  4ZXE A;  1VKD A;  3BYL A;  3MV1 1;  4DXR A;  4FFI A;  1PMH X;  1D7P M;  1TG7 A;  1W8N A;  2RJ2 A;  5JXJ A;  2VOT A;  3OGR A;  4BDV B;  4UDI A;  2QQJ A;  2Y64 A;  3D5Z A;  3MUY 1;  2J1A A;  1GYE B;  1UWW A;  4E8C A;  4N4B A;  3OM6 A;  3MUZ 1;  4XZU G;  2HLE A;  1WCQ A;  2WZE A;  3I3E A;  2BGO A;  2V72 A;  3AKI A;  1TVG A;  2Y6H A;  2BGP A;  4P08 A;  1UY2 A;  4YPJ A;  2AC1 A;  2VZT A;  5JOY A;  3LPG A;  3UET A;  5FK8 A;  2VMD A;  4N2Z A;  4DUW A;  4FFG A;  5IFT A;  3HOB A;  4BXS V;  5IFP A;  2J22 A;  1XC6 A;  1GUI A;  5LA2 A;  3BYJ A;  3QEF A;  3T2O A;  2B4K A;  3OBA A;  3WF2 A;  3IB3 A;  3E1F 1;  4BK4 A;  5I0D A;  4BJ0 A;  3A21 A;  2EIE A;  5J1X A;  5JOX A;  3WN0 A;  1W9W A;  3F2Z A;  1GOH A;  4UOJ A;  3R4Y A;  3CQO A;  4D0Q A;  3LE0 A;  3LIG A;  1DP0 A;  4JKK A;  1P8J A;  3WQB A;  2W1Q A;  3K75 B;  1ST8 A;  3THD A;  3HJR A;  4FI9 A;  1W2T A;  3T2P A;  2OXB A;  3QZ4 A;  3CZJ A;  2QBX A;  3LEI A;  4MAD A;  4QX0 A;  1XNT A;  3J7H A;  1J84 A;  1IQD C;  2JKX A;  4A6O A;  5A7V A;  5HXM A;  5C0P A;  2VO5 A;  4QX1 A;  1JHJ A;  1GMM A;  4A41 A;  3SEP A;  4FFH A;  1Y4W A;  3NJX A;  1CX1 A;  3LF7 A;  3P2N A;  1YRZ A;  1GU3 A;  1CZV A;  2YFT A;  1GNY A;  3WF0 A;  3UGH A;  4UDK E;  2JE8 A;  2X8F A;  2QQK A;  5HPO A;  4JKL A;  3WF3 A;  5A1A A;  3WNP A;  4QX2 A;  4JKM A;  4QB6 A;  4CVU A;  4QB2 A;  1L7Q A;  3BN6 A;  2WUH A;  2YC4 A;  4GWI A;  3WPZ A;  3WNN A;  3MV0 1;  5FK7 A;  4DUX A;  4XUO A;  3DYM A;  1K3I A;  2EID A;  2Z4F A;  5EIY B;  5DMY A;  5LA1 A;  3FHA A;  1K12 A;  2E26 A;  2CDP A;  1MPX A;  3VD3 A;  3W5M A;  2QQW A;  4GZ9 A;  3TAW A;  1UYZ A;  2DDU A;  4MO3 M;  4P5Y A;  3U75 A;  1I5P A;  1WKY A;  4P00 B;  2EXH A;  3BYK A;  3K4A A;  3VD7 A;  5GLK A;  2PQS A;  4KWU A;  3D3A A;  3KF5 A;  2B4W A;  1ULP A;  4W8J A;  2WQ8 A;  3MO4 A;  2RVA A;  3AKF A;  3LEM A;  4Z2A A;  1HN1 A;  4OYU A;  2W3J A;  4KI5 M;  3VSF A;  3I3D A;  4QX3 A;  3WF4 A;  5DN2 A;  2WO3 A;  4W50 A;  1OF3 A;  2VR4 A;  3JXS A;  1H6Y A;  3HNB M;  4CUB A;  3D5Y A;  1T2X A;  2VZR A;  1JI6 A;  2YFZ A;  4CU9 A;  1W9S A;  4ZZ5 A;  3IAP A;  5JXG A;  3R4Z A;  3T09 A;  2QQV A;  2YFR A;  3WMY A;  2VZ3 A;  1NKG A;  3KF3 A;  2W1S A;  1UMI A;  4DXS A;  3VD9 A;  3I2F A;  3OGV A;  3VD4 A;  2VC9 A;  1JZ5 A;  1OF4 A;  2Y6L A;  4NOV A;  1O8P A;  2LW8 A;  3PUH A;  3VSZ A;  4QAW A;  4QQS A;  1CIY A;  1UXX X;  3ECQ A;  3A22 A;  3OGS A;  3WMZ A;  1NX9 A;  3OEB A;  3ACI A;  2VQU A;  3A7Q A;  3VT0 A;  2CDO A;  2ADD A;  1F4A A;  4XUN A;  2VZU A;  1JYW A;  2RV9 A;  1RYY A;  1W9T A;  2W94 A;  2QQN A;  3AKG A;  2J1U A;  4KMI A;  3T0B A;  3DYO A;  3I3B A;  3ZM8 A;  1JU3 A;  1UMH A;  4PVA A;  1ULO A;  4D8M A;  4QB1 A;  3EB7 A;  1XNA A;  2W1W A;  4EQV A;  3WF1 A;  3ACG A;  4QPW A;  5EJ1 B;  3C2U A;  2J7M A;  3W5N A;  4XUP A;  3I97 A;  2VZ1 A;  4N1I A;  3OG2 A;  2KD7 A;  3I2I A;  4GWJ A;  5GLR A;  3WSO A;  2Y6K A;  3LEG A;  5A8C A;  2ORX A;  1J83 A;  3ABZ A;  2W92 A;  4MLG A;  5CZK A;  4AK7 A;  3P6B A;  3I2H A;  3VDB A;  4FFF A;  1JYN A;  1O59 A;  4MGS A;  2LS6 A;  2WO1 A;  5JXI A;  3D60 A;  5FMB A;  2WAA A;  3GGL A;  3IDA A;  5FMC A;  5B4X A;  1W18 A;  2XON A;  3QC2 A;  3GM8 A;  1US3 A;  4ET7 A;  1SHW B;  1F4H A;  2WAO A;  3CDZ B;  4D47 A;  2VZS A;  3FL7 A;  4KCB A;  2V5D A;  1R64 A;  2EIC A;  1GOF A;  5AYD A;  3WN2 A;  1W99 A;  1OYG A;  1UZ0 A;  1KEX A;  5JUV A;  3EYP A;  4U6D A;  2W1U A;  2YFU A;  3BGA A;  4MOA A;  4PQQ A;  3VSS A;  4LKS A;  3C7H A;  1JZ4 A;  4XVH A;  4QDS A;  3SKJ E;  2VMF A;  2C9K A;  3LDR A;  2X09 A;  3WAU A;  4ARX A;  2WN2 A;  3CU9 A;  2E33 A;  4CUA A;  5JR2 A;  1GOG A;  4O8N A;  2BBA A;  1UXZ A;  5CYY A;  5JMO A;  4L0P A;  2XOM A;  5FLW A;  4PF1 A;  5A8D A;  2WAB A;  1XPW A;  2VL4 A;  3ZXJ A;  3GXU A;  3GDB A;  2XQR A;  2QQI A;  2E32 A;  1PX3 A;  3ACH A;  4KMQ A;  5LA0 A;  5GLO A;  3NJV A;  4QDQ A;  5LCW L;  5DPN A;  1L7R A;  3LQC A;  4A3Z A;  3T0D A;  3WPU A;  5GLN A;  4RN5 A;  5FMD A;  3VT1 A;  1JZ8 A;  3A23 A;  3IAQ A;  4LPL A;  2XQX A;  3CIH A;  3ZXK A;  1JZ2 A;  3THC A;  3LIH A;  4PT6 A;  4P02 B;  2YFS A;  3PIJ A;  2QQM A;  2WBK A;  3U14 A;  4E8D A;  1UYY A;  2VME A;  3K77 A;  4LHS A;  4ONZ A;  5B4N A;  2V4V A;  4QDR A;  5G04 L;  2J1V A;  4W4Z A;  5FKB A;  5GLQ A;  2VCB A;  3SKV A;  2Y8K A;  2ZEZ A;  1CZT A;  1BHG A;  1US2 A;  1OD3 A;  2WN3 A;  3C7O A;  3LDK A;  2W87 A;  2EXJ A;  3NRU A;  2B9V A;  2EXK A;  2DCK A;  2ID4 A;  2R7E B;  3VDC A;  2WDB A;  3KST A;  3K46 A;  2BER A;  4BK5 A;  3C7F A;  3WAS A;  1WL7 A;  4UAP A;  4KC8 A;  4AAX A;  4ZY9 A;  2J1R A;  1JZ7 A;  2DCJ A;  2QQL A;  2VCA A;  3HPN A;  5GLL A;  2AEZ A;  4A42 A;  3WNO A;  1UY4 A;  4XUQ A;  2W47 A;  4A44 A;  3OM4 A;  1EUT A;  1UY1 A;  1KGY A;  4KC7 A;  3I2K A;  4O8P A;  1UYX A;  1O8S A;  2VZO A;  3T08 A;  2AEY A;  2ZEX A;  5AY9 A;  3C7G A;  1YQ2 A;  1OT5 A;  1W8O A;  2YB7 A;  5JXH A;  3DYP A;  1CZS A;  3VT2 A;  3WEZ A;  2E31 A;  1JZ6 A;  4COT A;  1LNS A;  3WNK A;  2BZD A;  2YG0 A;  2WO2 A;  4CU7 A;  1NUK A;  2JD9 A;  4UDK A;  1SDD B;  2WYS A;  1PT2 A;  3HN3 A;  4XUT A;  4ZZ8 A;  1UY0 A;  3T2Q A;  2OKX A;  3U37 A;  3NQH A;  3VDA A;  4N2R A;  5C71 A;  4UDG A;  3AKH A;  4ARY A;  2JDA A;  3OEA A;  5FKC A;  4DUV A;  4OMC A;  3C8X A;  2HYX A;  4M4P A;  5ANN A;  1JYX A;  2X8S A;  3UGF A;  4A4A A;  3K1U A;  1EUU A;  2X10 A;  3P1I A;  2X05 A;  3OB8 A;  4DEV A;  2C26 A;  4A45 A;  5C70 A;  3OM2 A;  2J1T A;  2J1S A;  3CKH A;  3WNM A;  3QED A;  5B6S A;  4OZO A;  1UY3 A;  2VMC A;  2VM9 A;  4UI9 L;  4HG6 B;  3FHQ A;  4M4R A;  4DEQ A;  4AK6 A;  2ZEY A;  3R67 A;  2QQO A;  2ZEW A;  1Y7B A;  3ACF A;  5DQ0 A;  5F7U A;  2WZ8 A;  1DLC A;  2X8T A;  4OUE A;  2VQT A;  2L9L A;  3C7E A;  3HNM A;  3K4D A;  2QQU A;  5AYC A;  1K45 A;  5EJZ B;  1JU4 A;  4OMD A;  2ADE A;  2VCC A;  4CU6 A;  1UYP A;  4IUG A;  4TXW A;  3HEI A;  3VSR A;  1NAE A;  2W46 A;  3LEK A;  1UV4 A;  5B6T A;  4CUC A;  4TTG A;  3CMG A;  2VDT A;  1PX4 A;  1SG3 A;  3BYN A;  4PVI A;  3WN1 A;  1H6X A;  3ETP A;  3WPV A;  3HNY M;  5IJR A;  3LV4 A;  5IYY A;  2J1E A;  4KCA A;  2W5F A;  2VTF A;  5C7G A;  1JZ3 A;  2W95 A;  3QEE A;  2VZV A;  5A7V B;  1OH4 A;  3PIG A;  3WPY A;  4RYD A;  3WNL A;  3ZXL A;  2ZXQ A;  1YI7 A;  3OM7 A;  3DEC A;  1GYD B;  3D61 A;  2XHN A;  2YC2 A;  5FUI A;  3SEE A;  5GLM A;  2ORZ A;  3FN9 A;  2W91 A;  1W0N A;  5FIX A;  3T0A A;  1JYV A;  4MGQ A;  3UES A;  2VZP A;  2Y6J A;  3NNG A;  4AG4 A;  5IHR A;  3RWK X;  1YIF A;  4O8O A;  3I2G A;  5GLP A;  2EIB A;  4JHZ A;  4U6B A;  5JOZ A;  3SC7 X;  3UNP A;  1Y9M A;  3PUI A;  3LPF A;  3LFI A;  1UX7 A;  3K4Z A;  5AYE A;  1DYO A;  1GYH A;  3III A;  4AK5 A;  5JOW A;  2W9X A;  1PMJ X;  2Y6G A;  5G05 L;  1K42 A;  2EXI A;  3WAT A;  1Y9G A;  4DXT A;  3I2J A;  2C4X A;  4JX0 A;  4LQR A;  3AC0 A;  4UDJ A;  3OM5 A;  3CZU A;  3UGG A;  3MBW A;  2VJX A; 
#chains in the Genus database with same CATH topology
 1VBA 1;  3RYR A;  4XUR A;  3V0B B;  4NOT A;  2ZHM A;  4XAA A;  4ZXE A;  3VGI A;  4MXW B;  3CJI B;  4DXR A;  1W8N A;  4Y5Z 0;  4XXA A;  4PIZ A;  3WCR A;  2E7A A;  2VOT A;  3NV4 A;  1LES A;  4BDV B;  4UDI A;  2QQJ A;  2RR1 1;  3D5Z A;  4F7Z A;  1WW7 A;  3NST A;  4G4F A;  5L73 A;  4B8E A;  1ZBE 2;  4E8C A;  1QJX 3;  3WW1 A;  3OGJ A;  2IXC A;  3MUZ 1;  4XDQ A;  4Q1R A;  4XZU G;  3IM0 A;  3WW4 A;  3RZG A;  2WZE A;  2PAK A;  3I3E A;  4R9A A;  1PIV 1;  3AKI A;  3OBR A;  2BU9 A;  2R0F A;  1CPN A;  3NWK A;  4XCB A;  3RS6 A;  3BOP A;  5JOY A;  4X6Q B;  4XQW A;  3UET A;  5F8P A;  2E6V A;  1C1L A;  1RUJ 1;  3JUU A;  4X8P A;  4AYU A;  2OQ6 A;  2ET1 A;  3OOX A;  4N2Z A;  4IEO A;  3VBH C;  1OHF A;  2HEV F;  2WII B;  4B1M A;  4YZ1 A;  1ENS A;  3RPQ A;  4FFG A;  2BEO A;  1R08 1;  1STM A;  3ZIX A;  5IFT A;  3ZR5 A;  3MZH A;  1QJZ A;  5IFP A;  5GZD A;  2J22 A;  1GUI A;  2FD8 A;  1RIN A;  2GAU A;  3T2O A;  4CA9 A;  3KD4 A;  3E1F 1;  3I49 A;  5KHH A;  1CAV A;  1WBF A;  5A7N A;  1H4G A;  3EQE A;  2NPI A;  3H1W A;  4BK4 A;  3HBZ A;  3S57 A;  3ZPO A;  3A21 A;  1ZZ6 A;  2D6O X;  2X29 A;  4QXB A;  5JOX A;  5LRS A;  1ASJ 3;  1BZW A;  3OD0 A;  4Z07 A;  1PIV 3;  3BKZ A;  2R6Q A;  3R0R A;  3USS A;  2ZGU A;  1BVP 1;  3CQO A;  4XQD A;  2P3Y A;  3BPS A;  4ZKT B;  3MLL A;  2XLG A;  4WZC A;  4JKK A;  2HYK A;  4CP2 A;  1LU1 A;  3WQB A;  3K75 B;  3GZA A;  2HWE 2;  1AJO A;  1FAY A;  4FI9 A;  3VL9 A;  4HT1 T;  5FUP A;  4NIA A;  4XOG A;  3PDQ A;  1ASJ 2;  5HXV A;  1SLT A;  3LEI A;  5F9T A;  1DZR A;  2ZAA A;  4MAD A;  3VZJ A;  3S0M A;  4XF9 A;  4N53 C;  4KG0 A;  3WQ1 A;  5J36 A;  1HJG A;  1V6K A;  1U5Z A;  3KQR A;  1J84 A;  1S0I A;  4LHN A;  4XHB A;  4LBN A;  3GZU C;  1WW4 A;  5HI0 A;  3CJX A;  1JHJ A;  2ZGS A;  5CAZ A;  3VLB B;  3SEP A;  1FNY A;  5FYU A;  3N9N A;  3FLP A;  1Y4W A;  2R06 1;  1YHF A;  3NJX A;  3W9A A;  1DGR A;  1PGW 2;  3ZKU A;  3H42 B;  5FXV A;  1GU3 A;  1QJE A;  4XZP A;  3WF0 A;  2YFT A;  1UIJ A;  1U5I A;  1VR3 A;  1OFS A;  3V0A B;  1CAW A;  1I1E A;  1CAX B;  2JE8 A;  3PUS A;  2N7G A;  1NXM A;  4N53 A;  3KHC A;  4EJR A;  2JG8 C;  5A3P A;  3WUC A;  4JDN A;  3OF1 A;  3WNP A;  1PK6 A;  1Q3E A;  4QB6 A;  5BNO A;  2WKK A;  3J9S A;  4FO9 A;  4YVW C;  4M3C F;  3JBG 2;  2XL9 A;  4Q5O A;  4CXW A;  5FZF A;  3H8U A;  2C0Z A;  5C8C A;  3UK9 A;  1ONA A;  4FTS A;  4CSW A;  3RQ0 A;  2WNV C;  1SLA A;  5FK7 A;  4C0B A;  2JEM A;  3AKR A;  5FWE A;  3DYM A;  3MI8 A;  5GKA C;  5DMY A;  4BQ1 A;  3BTA A;  4SLI A;  1NCR A;  1H1I A;  1POQ A;  2XJQ A;  2JIG A;  2E26 A;  1R1A 1;  3GZE A;  3W5M A;  1OVS A;  1VMF A;  5A3W A;  4MO3 M;  4P5Y A;  3U75 A;  3K51 A;  1RUE 3;  1WKY A;  1GP5 A;  3KVB A;  1MQT A;  1AR9 2;  1UAI A;  3UJO A;  2VUD A;  3HBK A;  3DPR A;  3K4A A;  5GLK A;  4NAM A;  4RS5 A;  4KWU A;  1IG0 A;  3D3A A;  2WSV A;  2IFR A;  3LOI A;  4UF0 A;  4O61 A;  2VPV A;  1XSQ A;  4JTO A;  2FZ2 A;  1MS9 A;  2WQ8 A;  4Y22 A;  4UFM A;  1C8M 3;  1AJK A;  2RVA A;  3WP3 A;  4LO5 B;  2F6B A;  3SIS A;  1ZRD A;  4Z2A A;  1H30 A;  3O14 A;  2W3J A;  4QPY A;  4OHY A;  1AXY A;  3VSF A;  2XL7 A;  4W50 A;  3HQU A;  1G8W A;  2HWB 3;  3U11 A;  3U78 A;  2QZ2 A;  3B9C A;  3PL0 A;  2JDZ A;  4LOR A;  1HRV 3;  1JI6 A;  5DUW A;  2XHK A;  2YFZ A;  1W9S A;  1LKN A;  2QQV A;  4O9G A;  3WMY A;  1TNF A;  4QQ2 A;  5DDJ 1;  4DXS A;  4UFJ A;  5EQU A;  3O1T A;  1C1F A;  2VC9 A;  3RZH A;  1OF4 A;  4ES9 A;  4XFA A;  3J8F 3;  1S1A A;  2GC0 A;  2O8Q A;  3DXU A;  5A7O A;  3PUH A;  1XE7 A;  4LKE A;  2BJS A;  3JB4 C;  5A3L A;  4QQS A;  2UYA A;  4RHV 2;  3U4S A;  4URA A;  1JOJ A;  2GP5 A;  2AYH A;  3AYE A;  2BOJ A;  1NX9 A;  4IE0 A;  1PO2 2;  3A7Q A;  3TNP B;  1G9A A;  2BP6 A;  4IL7 A;  1L3J A;  4XHX A;  1GNH A;  2JG9 B;  3JB8 A;  5JAX A;  2VZU A;  2GH2 A;  2RV9 A;  5SV8 A;  4QQL A;  4JVA A;  1AF9 A;  2QQN A;  3AKG A;  2W68 A;  5EJ3 A;  3T0B A;  3RG0 A;  1EAH 3;  4N43 C;  1C28 A;  1GQH A;  1JU3 A;  1ZNP A;  2BVB A;  2K0G A;  2K2S A;  3HWJ A;  4JV4 A;  1XU2 A;  2Q1M A;  4MGY E;  4YVW B;  5FZO B;  4AQS A;  4D8M A;  2JDK A;  4M3C A;  3EB7 A;  3VKO A;  1XNA A;  4Q8L A;  4EQV A;  1Z7S 2;  2V73 A;  3WQ0 A;  1JUH A;  2BBV A;  4XUP A;  5A6Z A;  2XVK A;  3BOW A;  3BTZ A;  3OG2 A;  5KHG A;  4CP0 A;  1AL2 2;  1ZYB A;  2Y6K A;  5A8C A;  2DVG A;  3KT1 A;  2ARE A;  5L9V A;  5CB7 A;  3MEP A;  4MG2 A;  3ABZ A;  2CTV A;  4AVA A;  4MLG A;  4FTB A;  3INA A;  4WVW A;  4UT5 A;  4AK7 A;  5F5I A;  1GAN A;  1KFX L;  2P4E A;  5GLW A;  1UO9 A;  5J37 A;  3KGL A;  3H3Z A;  2B7Y A;  2LS6 A;  4KU8 A;  4MGS A;  3V0A A;  4Q0P A;  3D4K A;  2CY6 A;  5JXI A;  2BV4 A;  1MZ6 A;  4IV1 C;  1RHI 3;  2C6S A;  1UMZ A;  3DEM A;  2XON A;  3ES1 A;  3GM8 A;  5EYX A;  1TL2 A;  1OVP A;  3QC2 A;  4PLO A;  5A3N A;  4UFI A;  4PLN A;  5FY7 A;  3CDZ B;  2WAO A;  4D47 A;  3G7D A;  3R4D B;  2D3P A;  2V5D A;  4IQP A;  1DIW A;  2EIC A;  4IE4 A;  1VAM A;  1WWY A;  5BUV A;  2GN3 A;  3PJY A;  3WN2 A;  1O7F A;  4LOT A;  1VAK A;  1KEX A;  4XJA A;  3IDC B;  3M3E A;  1IPS A;  2W1U A;  2YFU A;  4MGI E;  3X29 B;  4MOA A;  4YGD A;  1BKZ A;  4NJ4 A;  4LKS A;  1OKQ A;  5T55 A;  5F5C A;  4XFB A;  1ACC A;  3VUO A;  3LDR A;  1NA1 C;  2XJV A;  3ZFE C;  3TEX A;  4ARX A;  2WN2 A;  3AZY A;  1N3Q A;  3M8L A;  1K5J A;  3ES4 A;  5FY8 A;  4HXC A;  5JR2 A;  2IUW A;  1GOG A;  1X9P A;  5BXX A;  4BQ2 A;  2OPK A;  3WG4 A;  2EA7 A;  1WMF A;  1E57 A;  4QU2 A;  1AYM 2;  5BNP A;  2ZZQ A;  1B35 C;  2MEV 3;  5C3O A;  5JMO A;  2G9G A;  1CR7 A;  3HQR A;  5A7Q A;  3RDI A;  3VBO A;  2WAB A;  1G9C A;  3ZXJ A;  1D2S A;  2OZ6 A;  2WZR 1;  3GXU A;  4IV1 B;  4WM7 A;  4I0B A;  3VHN A;  1W9F A;  2W39 A;  3QCW A;  3WDU A;  5BNP C;  3ACH A;  1ND3 A;  3CLP A;  3POB A;  5IK4 A;  3NJV A;  5SV5 A;  4CDQ A;  4CDX B;  2JIJ A;  5DPN A;  5ANQ A;  1QNW A;  3ELN A;  4LK7 A;  3ST7 A;  4CP9 B;  4LPL A;  4QQP A;  1LOB A;  3CIH A;  2ZPX A;  3DN7 A;  1AR7 3;  3MIH A;  5FRE A;  3S7I A;  4P02 B;  3U14 A;  2DCT A;  4P9X A;  3LSE A;  2CWS A;  4XMA A;  5JSP A;  2V4V A;  3GHN A;  2J1V A;  1ZRI A;  1CN1 A;  1ZVF A;  3B7M A;  2XWJ B;  4K20 A;  3WUD A;  2D3R A;  1QJY 3;  1JN2 P;  3NAP A;  2A1X A;  2WN3 A;  3LDK A;  2P2K A;  5DAV A;  2QDN A;  5T5J A;  3M3I A;  3VDC A;  3KST A;  4R9C A;  1I6X A;  5A80 A;  1CIW A;  2GC3 A;  4GQ7 A;  3CEW A;  1RUH 1;  5T5P A;  3AYC A;  3VBR A;  1RUE 1;  1FX5 A;  4LBQ A;  4UAP A;  4KC8 A;  1RUH 3;  1MZ5 A;  2F4L A;  3DKW A;  3AP7 A;  1PGL 2;  2JDH A;  1OQ1 A;  2J1R A;  3P5B A;  2QQL A;  4NPR A;  3DKQ A;  3FHI B;  3HPN A;  4QPI B;  1IKP A;  1U5Y A;  1GZT A;  3WNO A;  1UY4 A;  3KT4 A;  4R4Z A;  4XUQ A;  2JKB A;  4A44 A;  3OM4 A;  1W3V A;  2DBN A;  3ZXG A;  2VBP A;  4CDQ B;  1V6O A;  2VTX J;  4XIO A;  2D6P A;  3S5Q A;  4NR1 A;  3VBF B;  3C7G A;  2PLV 3;  1IOA A;  2OS2 A;  2ZX0 A;  3ROU A;  3VV1 A;  1OT5 A;  1OLQ A;  4EN0 A;  4GMP 1;  1E5H A;  1W8O A;  4W6X A;  3CF6 E;  3WCS A;  2I07 B;  3VT2 A;  5A3M A;  2WSU A;  1QJF A;  2E31 A;  4L11 A;  3O1V A;  3MIC A;  3V56 A;  5AFB A;  4FQ4 A;  2BZD A;  2VW0 A;  1TE1 B;  2RDR A;  3HD8 B;  4LIU A;  2VQA A;  3U4X A;  1NUK A;  2E7T A;  2JD9 A;  1FNZ A;  3ZDV A;  2XXZ A;  1OPO A;  4KGG A;  2XKP A;  3HN3 A;  4RHV 3;  1WD4 A;  3T2Q A;  1K5M A;  2OKX A;  1VBB 3;  3A0N A;  1PVC 3;  2PHD A;  3B94 A;  3PTY A;  2WZR 3;  2YBP A;  1HB1 A;  4DUV A;  1SEF A;  5LB6 A;  2J42 A;  2HH9 A;  1AHS A;  2ZMK A;  2EAL A;  3AK0 A;  3VBR B;  3VBH A;  4E4Z A;  5DXD A;  1J1L A;  3P1I A;  5BNQ A;  1O3Q A;  3OB8 A;  1AXZ A;  3TN9 3;  1GLH A;  2C26 A;  4E2S A;  2HWF 2;  5DZF A;  1ND3 C;  2AH2 A;  2F17 A;  1POV 1;  1OKO A;  2HWB 2;  1PGS A;  5C9A C;  2A6X A;  3CKH A;  5B6S A;  1UN1 A;  1UY3 A;  2VMC A;  4K8R B;  4P9J A;  1W2O A;  3FX3 A;  4QKB A;  4NRM A;  3ASI A;  1ZZC A;  4AEM A;  4NIH A;  1FMD 1;  5AVP A;  3ILN A;  1RUE 2;  3KT7 A;  4AK6 A;  3BOD A;  3DXT A;  1N47 A;  3PU8 A;  5K7P A;  1Y7B A;  1BMV 1;  4K8F A;  2RJK A;  2WZ8 A;  1RGS A;  1H9W A;  3ZVX A;  2GC2 A;  2X8T A;  3OPW A;  2L9L A;  1TME 3;  1ZA7 A;  4YGB A;  5AYC A;  3MIE A;  2ADE A;  4OMD A;  2MHF A;  4JZR A;  4IUG A;  4CDU C;  5FZ9 A;  2HWC 2;  1NAE A;  4Q1P A;  4F8A A;  2YXS A;  1QOS A;  5B6T A;  3LD8 A;  4HK8 A;  4QD2 A;  4WVV A;  5LY1 A;  1RUJ 3;  3H1Y A;  3ZR6 A;  2VDT A;  1W04 A;  3QH7 A;  1WGP A;  4PVI A;  3WN1 A;  3ILR A;  3ETP A;  4Y26 A;  4JGZ A;  1OUS A;  2CNA A;  2YY1 A;  2D7F A;  5JI7 A;  4UFH A;  2JE7 A;  2JG8 B;  1H8V A;  5FYZ A;  3H8X A;  3NV1 A;  2WNU B;  3LZZ A;  1MR5 A;  4QGL A;  4LO8 A;  4Y5S A;  2J1E A;  2W5F A;  2KA3 A;  1S0F A;  2VTF A;  3TWI A;  2TNF A;  2KR2 A;  3WT3 A;  5CEH A;  4Y1U A;  2FHR A;  2VVF A;  4CDU A;  3ILF A;  5C3P A;  2WL1 A;  1OMI A;  3OUJ A;  4FOV A;  5FP3 A;  5JLV A;  3RZK A;  2JD4 A;  3NAP B;  3PIG A;  1OFN A;  3WPY A;  1RMU 1;  1RXG A;  1UPS A;  4RQP A;  1KXG A;  1AVB A;  2E63 A;  2P1B A;  4ATE A;  4SBV A;  2Q0A A;  2ZBJ A;  2ZXQ A;  5FY5 A;  3MW3 A;  2G9F A;  4AL9 A;  2BFU S;  3DEC A;  5E89 A;  5FY0 A;  2VXJ A;  3SEE A;  1VBC 2;  4N7U A;  4LBQ B;  2W91 A;  1H2L A;  1XB9 A;  2RG4 A;  2ATF A;  5IK5 A;  1DZQ A;  1RTV A;  2VZP A;  1X36 A;  3BAL A;  2E53 A;  4W65 A;  3AL5 A;  5GJ6 A;  5IHR A;  2NQY A;  1W8F A;  3VZM A;  5A3T A;  4D3W A;  2GND A;  1QDC A;  1KJL A;  1NT0 A;  3KV4 A;  1REE A;  1J59 A;  4QX8 A;  1QXR A;  2Z69 A;  2EIB A;  5JOZ A;  2PLV 1;  1AX0 A;  1Y9M A;  1JBC A;  3PUI A;  4NO4 A;  4UXA A;  1RUF 1;  3LFI A;  2D6L X;  2XJS A;  1ODM A;  1VIW B;  2GSY A;  5FCC A;  1UOF A;  4AFB A;  4GH4 B;  1QQP 2;  1DYO A;  3VBU B;  4B3N A;  3POJ A;  1GYH A;  3EHK A;  2PMW B;  3FFQ A;  2FDF A;  1GV9 A;  4NWW A;  4AK5 A;  2EVX A;  5D8A B;  3Q8B A;  4P14 A;  5G05 L;  1W6Q B;  3ZN6 B;  4QQH A;  5C9A B;  3O1M A;  3ZSE A;  1O3T A;  1Y9G A;  1QMJ A;  4XF0 A;  4XXP A;  1V6M A;  4LQR A;  1UW8 A;  3K2O A;  3CZU A;  4LJH A;  4RR3 B;  3GBF A;  4CPB D;  3NKG A;  1ALY A;  3VD5 A;  2VZQ A;  4Q4Y 1;  2HWF 1;  3MPB A;  5CIR A;  5GZC A;  3ORJ A;  5IUQ A;  2ZGK A;  4FFI A;  4CCE A;  4RQP C;  3U10 A;  4Y22 B;  3ACL A;  4I0A A;  3HVD A;  5I8Y A;  4U2A A;  2R06 2;  2HEW F;  3QD6 A;  3OPT A;  1PVC 1;  5CU1 A;  1RVF 1;  4MGZ E;  2FBE A;  2VNR A;  4QX5 A;  3MF6 A;  3MUY 1;  4IEV A;  1GYE B;  5FZ4 A;  2CHH A;  4OZX A;  5HV0 A;  3LA3 A;  3S5A A;  4AI2 A;  3CO2 A;  2HLE A;  2DVD A;  1E5R A;  2LUW A;  2XKO A;  2BGO A;  5LBC A;  1IPJ A;  2V72 A;  4GMP 0;  1RHI 1;  3B5L B;  2BGP A;  2ETE A;  2VBB A;  4NN0 A;  4CEY B;  5I93 A;  2ZOE B;  5IVF A;  4DB5 A;  1HX6 A;  3AVS A;  4AQT A;  2EAK A;  4OHV A;  1LOF A;  4H55 A;  2BWA A;  1HDK A;  3ZXA C;  4DY3 A;  3CU7 A;  4IGP A;  4E4S A;  4I02 A;  4DUW A;  2DVA A;  1DQ0 A;  5GZE A;  4HSJ A;  1LGB A;  1EV1 1;  2V5Y A;  2RDS A;  2IWG B;  3VKL A;  1MEC 2;  2NLR A;  1FI2 A;  4HSL A;  3AMH A;  1TME 1;  3HOB A;  1SPP A;  4IER A;  3WXP A;  2SLI A;  2VOW A;  3BB6 A;  2ZGQ A;  3OBA A;  1W6Q A;  3IB3 A;  4QGN A;  3WF2 A;  3ZN6 A;  1QIQ A;  2Q8E A;  5JMC A;  1D4V B;  3O12 A;  3DF0 A;  5J09 A;  1W03 A;  3IBM A;  1SFN A;  4BJ0 A;  1S0J A;  1SMV A;  2EIE A;  4BQX A;  4OI2 A;  4PBP A;  1AR9 1;  5FYS A;  3F2Z A;  1PO1 2;  1PM4 A;  1GOH A;  4UOJ A;  3SCH A;  1VPH A;  1W6M B;  2R04 2;  1A6C A;  4PIX A;  2Y34 A;  3CJI A;  3N9M A;  1DP0 A;  3OPZ A;  3QH6 A;  1QJX 1;  4AED A;  1ST8 A;  4DFS A;  3BIE A;  1RUC 1;  3HJR A;  4YFZ A;  4H7L A;  3WY6 A;  5IK8 A;  1KS4 A;  2OXB A;  3JU9 A;  2V09 A;  1UPI A;  3JZV A;  2QBX A;  1JTZ X;  1QXP A;  3QOP A;  1OC1 A;  1S0D A;  3TEY A;  3PLQ A;  4YVS A;  5CBL A;  2R30 A;  2A6Y A;  4QHZ A;  4CYD A;  4EWD A;  4EZ4 A;  4A7Y A;  1GYK A;  1FV3 A;  1IS3 A;  3UL2 A;  1IQD C;  1OOP B;  1PZ7 A;  2DTW A;  2JJ6 A;  2D5H A;  2EIG A;  2XWB B;  3GYD A;  3NW4 A;  4YVS C;  4AFC A;  5C0P A;  1MS1 A;  4WVM A;  1NE4 A;  5KHJ A;  4A41 A;  3UKV A;  5BNN A;  1W8H A;  1LOG A;  3LA2 A;  4FFH A;  2RS5 2;  4YW6 A;  3ZYP A;  2W52 A;  1LOD A;  3BPZ A;  3ME2 A;  5LAS A;  3P2N A;  2VVD A;  1GNY A;  2ZAC A;  5FZ3 A;  3ZSM A;  5FP7 A;  3P3N A;  2Q1F A;  2YZ4 A;  4UDK E;  1GZW A;  2X8F A;  5F2W A;  2QQK A;  2OUJ A;  3KV9 A;  1O4T A;  1O6U A;  5A1A A;  1YC6 1;  4BMB A;  4QX2 A;  4JKM A;  3UKN A;  4QB2 A;  1L7Q A;  5CKQ A;  1GZ9 A;  1FOD 1;  2XUE A;  4Y1X A;  3BN6 A;  1LOA A;  1JH5 A;  4M00 A;  4MX3 A;  5IAT A;  2OA2 A;  3WNN A;  2IXH A;  2BOI A;  2A70 A;  3H0O A;  1W6M A;  1MS3 A;  1K3I A;  4P9Y A;  5LA1 A;  5CIS A;  4Q4Y 2;  1ZX5 A;  3KCY A;  2CAV A;  5FPV A;  4QPI C;  1S0B A;  4J1W A;  4MV2 A;  4N8M A;  3T2T A;  3VD3 A;  3HT2 A;  1LGN A;  4MGK E;  3ZOI A;  5FQ0 A;  2BDR A;  1WD3 A;  1F9K A;  2Q1Z B;  3APB A;  4WBB A;  3WG1 A;  4YVS B;  4GB3 2;  1G7Y A;  1TNR A;  3RSJ A;  1VP6 A;  4FT8 A;  4AEK A;  3BYK A;  3N7L A;  2ILM A;  1BJQ A;  2UU8 A;  2VQ0 A;  1WA4 A;  1YNA A;  4YW7 A;  3U07 A;  1SAC A;  4PDW A;  4CP1 A;  4LHK A;  3KF5 A;  2B4W A;  3GBG A;  4HZF A;  3E5X A;  1SBD A;  5DZE A;  4LTA A;  4N90 A;  1NCQ B;  1QH7 A;  5T5O A;  1KD7 A;  4RS5 C;  1WBL A;  3AKF A;  4MH0 E;  5GLT A;  3VHO A;  1HN1 A;  5FMO L;  4FPY A;  2R07 2;  3AFG A;  4HET A;  2WO3 A;  4CDX C;  3PVB B;  1OF3 A;  3JXS A;  4JC1 A;  4BQ3 A;  1XNC A;  4IEP A;  5A33 B;  3AMM A;  3HNB M;  1ZA4 A;  4N9I A;  3G6J B;  1T2X A;  2TEP A;  1TMF 2;  2VZR A;  5ABJ A;  2XLA A;  3IPV B;  1N1V A;  2XBO 2;  4M0N A;  4AHZ A;  3AKS A;  1WLD A;  3AYD A;  3GCW A;  4O65 A;  4HOO A;  3T09 A;  2YFR A;  5KXE A;  1QKQ A;  3BU0 A;  1PK6 C;  2W1S A;  2PEL A;  3T1M A;  4BZ4 A;  2ZGN A;  5JPN B;  1QHD A;  1ZZ8 A;  4LKD A;  3VD9 A;  3I2F A;  3OGV A;  1JZ5 A;  3ZIW A;  4IEX A;  4LLO A;  1O4Y A;  3ZYG A;  4BM8 A;  2XG3 A;  4NOV A;  4NE9 A;  4ITC A;  5DZG A;  4QAW A;  1C8M 2;  5FYY A;  5CNA A;  3ZYJ B;  1UXX X;  1PZ9 A;  2IVJ A;  3ZFF A;  2GC1 A;  3ZYR A;  1T6G C;  2YV8 A;  2HWE 1;  3AMP A;  5A6X A;  4H14 A;  3T4H B;  2C9A A;  3Q8C A;  3ZFG A;  4COW A;  4COZ A;  4WM8 B;  1RMU 2;  4PF5 A;  3VT0 A;  4A3X A;  5F32 A;  1WCU A;  2XLF A;  1F4A A;  1FPN 1;  1MS0 A;  2P34 A;  4XUN A;  1ENR A;  1ZM1 A;  4GD4 A;  1QJU 1;  1RYY A;  3N35 A;  1W9T A;  3HN1 A;  1WLW A;  3VKM A;  4NHX A;  4XJU A;  5FP4 A;  3JD7 1;  1CWP A;  2I74 A;  4R9D A;  3ZXF A;  2J1U A;  1XE0 A;  3RYP A;  4CUG A;  4KMI A;  1G86 A;  2VMG A;  2PXJ A;  3MW2 A;  3E6D A;  1RUG 3;  3UJQ A;  1UMH A;  4BYY A;  1UZW A;  4BQ5 A;  2WFP A;  4OI1 A;  1OUR A;  3NNL A;  5FYB A;  4N7I A;  3URF A;  5KXC A;  4L9B A;  3ACG A;  4QPW A;  4XAE A;  5EJ1 B;  3N9P A;  2J7M A;  2JX9 A;  4L99 A;  3VZK A;  1Z7S 3;  3OYW A;  4TLF A;  3SMH A;  5DUU A;  5DUX A;  2WC2 A;  3TOJ A;  4I3P A;  3Q9O A;  3EBR A;  5EYY A;  2JWP A;  2AAC A;  2GAL A;  4GWJ A;  1ZZ7 A;  5GLR A;  3BYW A;  4DO0 A;  3ZYI B;  3OJB A;  4XFI A;  4YGC A;  3H3U A;  1AUY A;  4Q4W 1;  4AGR A;  5JZG A;  3VBO B;  5EHD A;  1EV1 3;  1UOG A;  4K6B A;  4LA2 A;  5HCF A;  4XJZ A;  4COV A;  3KS7 A;  4QPG A;  1O59 A;  2R07 3;  2WFF 2;  5CAD A;  1HB2 A;  3GF6 A;  1PNF A;  3R4S A;  1GZW B;  4ZXK A;  4C91 A;  4OFG A;  2RS1 1;  3DPR C;  5FJH A;  5JR7 B;  3ZSL A;  1R1A 2;  2LAL A;  1VMH A;  2BWC A;  2HBT A;  1TMF 3;  5F3I A;  4FBF A;  5F6K A;  1H8T B;  3IDA A;  4WM8 A;  5FMC A;  5B4X A;  3WP5 A;  1W18 A;  4AK3 A;  4P9W A;  4E2Q A;  4D7Y A;  1ZRR A;  3PUR A;  3JQX A;  5CG9 A;  2DF7 A;  2W0X A;  3M2M A;  5FBJ A;  3E6C C;  1GOF A;  4YWA A;  2ZKN A;  2VMH A;  2IVI B;  2VNV A;  1LHV A;  5K0U B;  1MVE A;  5LBB A;  4YVW A;  3WD5 A;  4CE8 A;  3VSS A;  3OD4 A;  4Q27 A;  1NXD 1;  4Q4Y 3;  4DZG A;  3N4M A;  4XVH A;  5A3U A;  1LR5 A;  2BW8 A;  4CCL A;  2C9K A;  4RS5 B;  4XF4 A;  4BQY A;  1W28 A;  4LNV A;  4PDW B;  2X09 A;  3MYX A;  2AR6 A;  3OYW B;  1BYH A;  4Y4R A;  4JRA A;  1UCX A;  3IMM A;  5LY2 A;  1B09 A;  1W6N A;  4TSV A;  4XBN A;  1XBF A;  4OHZ A;  1A3K A;  3ALQ A;  4O8N A;  5FZD A;  1R08 2;  5CYY A;  1W8Z A;  3MGU A;  5JZG B;  4BLJ A;  4IE7 A;  1OLM A;  2VL4 A;  2DV9 A;  2RS3 1;  5FPB A;  4XFG A;  4JGY A;  4CCJ A;  1YCI A;  1RUG 2;  3WR0 A;  2CYF A;  4BOW A;  2OPW A;  2E32 A;  2QQI A;  2WWS A;  1KDM A;  3I4I A;  4YW4 A;  1W39 A;  4V1P A;  4TLG A;  4YLZ A;  3BTY A;  2PQQ A;  1X82 A;  2VTX A;  4RHV 1;  4Z8B A;  4TZD A;  2BQP A;  4DOU A;  5GLO A;  1PO1 1;  1R08 3;  2Z5W A;  3CBN A;  4Y3O A;  4A3Z A;  2XGX A;  5GLN A;  1UF2 C;  1QJX 2;  3AM2 A;  1ENX A;  2G9Z A;  4HKW A;  2B46 X;  1X33 A;  3ZXK A;  2ZZJ A;  1DGL A;  2HKX A;  2OT7 A;  4LBJ A;  4LE3 A;  4QMA A;  2KM2 A;  3LIH A;  3WDX A;  4GMP 3;  1QJU 2;  4I30 A;  4PT6 A;  4C1W A;  2YFS A;  3PIJ A;  2QQM A;  1YXW A;  2WBK A;  2A73 B;  5K0U A;  3K77 A;  1ZBA 1;  5H9Q A;  3OBZ A;  4RR3 C;  1W0P A;  4ONZ A;  5FKB A;  4K21 A;  4KBZ A;  4W6Y A;  2R04 3;  1K5M B;  1LGC A;  3ZFG C;  5HV4 A;  5FLH A;  4CCO A;  2FMY A;  1BHG A;  4U36 A;  1OD3 A;  1RUD 1;  2W87 A;  1YFX A;  3NRU A;  5A6Y A;  2DCK A;  2ID4 A;  2WDB A;  1Q8V A;  1UZY A;  4IEW A;  1O3S A;  2BER A;  1W6N B;  4BK5 A;  3C7F A;  4IET A;  4KWK A;  2FDJ A;  2VUL A;  3RZJ A;  5BNP B;  4PIY A;  4AAX A;  1W3X A;  4UW6 A;  3W59 A;  1HN0 A;  1BEV 3;  4HVR A;  3J8F 2;  1L7L A;  1CAU B;  4Q4X 1;  4LBK A;  1V6L A;  1JZ7 A;  2DCJ A;  3GJB A;  3GHM A;  2K46 A;  4WM7 B;  5GLL A;  1UU6 A;  2AEZ A;  2BFU L;  4A7Z A;  5T3N A;  4LLF A;  4COY A;  4F3J A;  5ACA 1;  1WCD J;  5F39 A;  3M1H A;  4E9K A;  5A1F A;  4IEZ A;  4KC7 A;  2AGS A;  3IWZ A;  1M06 G;  3UV9 A;  3NJZ A;  3RZM A;  3Q8E A;  3T08 A;  3ZX7 A;  3FLT A;  4FVV A;  5FZ8 A;  2ZEX A;  5AY9 A;  1UZZ A;  1QWR A;  4C0H A;  3VN4 A;  4LKF A;  1AX2 A;  5BPX A;  4HPK B;  4GUL A;  3VZL A;  4C1X A;  3DYP A;  1CZS A;  4N43 B;  2QTW B;  3WEZ A;  1BXH A;  3TB0 A;  1O5L A;  3LA7 A;  5EZW A;  4KG8 A;  2A3X A;  4QXH A;  3USU B;  1LNS A;  2H0V A;  2YG0 A;  3WNK A;  5FLJ A;  3ZYB A;  1VBE 1;  5FZ1 A;  4K3U A;  4Q8K A;  1VMJ A;  1XOY A;  2R06 3;  5AC9 1;  2VOX A;  5CKN A;  1SDD B;  2WYS A;  5LZ6 A;  2JDU A;  1BBT 1;  1OSG A;  2HEY F;  4ZZ8 A;  3V0B A;  4XMI A;  1W6O B;  3S6P A;  3NV2 A;  4MXW A;  1VLN A;  1IPK A;  4ZS2 A;  3U37 A;  4FPK A;  1COV 3;  3MPP G;  4TWT A;  4AHW A;  5C71 A;  2NZ9 A;  1MS5 A;  1DCS A;  2WNO A;  4FPL A;  3AKH A;  4UDG A;  5BNO C;  2QZ3 A;  4ARY A;  2JDA A;  3OEA A;  1RMU 3;  4OMC A;  4E27 A;  1KRI A;  4E4D X;  4XW3 A;  3BI3 A;  1ND2 B;  4A4A A;  4KWJ A;  2X10 A;  1PZ8 A;  5L7O C;  1YQ8 A;  4OUS A;  4Q4V 1;  1Q8P A;  1VBB 1;  3D0J A;  3OGG A;  4CDU B;  4D6Q A;  5IVJ A;  3LOB A;  1COV 2;  1UOB A;  2E7Q A;  3OM2 A;  4YZ3 A;  1LUL A;  3VBO C;  2PHW A;  3FBY A;  4X8N A;  2ZGM A;  5I8T A;  1SDW A;  4B4P A;  1OUX A;  3QED A;  4OZO A;  2UYB A;  3WDV A;  3RZL A;  4B1L A;  1RIR A;  2WS9 2;  1ND2 C;  4DS0 A;  3FHQ A;  5D2A A;  2VEC A;  1C8N A;  2YU1 A;  4GAZ A;  3S30 A;  3T3Y A;  5LWB A;  1FOD 3;  3B93 A;  4K9S A;  2R1D A;  2ARA A;  3OUI A;  3RGB A;  2PN5 A;  3ZSK A;  3VBS C;  1DLC A;  2NM1 A;  4OHW A;  5ISL A;  3C7E A;  4FPG A;  1S2E A;  4GA9 A;  4MHR A;  5EJZ B;  1URX A;  1CAV B;  3NNF A;  3O1R A;  5H9S A;  2VCC A;  3PVN A;  4TXW A;  1HIX A;  4YFW A;  3AP4 A;  1FPN 2;  3HEI A;  1HV1 A;  4GH4 C;  2WQ4 A;  1BCX A;  1NQJ A;  1YJK A;  3VBU C;  2OUH A;  3CL1 A;  3SNM A;  4C90 A;  4LBL A;  4CUC A;  4YG6 A;  1UKR A;  5GAL A;  1PX4 A;  1VRH 1;  2NYY A;  1H6X A;  1AX1 A;  3LB9 A;  3DV8 A;  1VBC 3;  2BTV C;  1NOV A;  4RFR B;  5CFD B;  2HJI A;  5CA6 A;  2XJP A;  3AKT A;  3LFM A;  1W8U A;  2UUR A;  1SLB A;  1UIK A;  1EAH 1;  2JDN A;  3VZN A;  2WT1 A;  5JIA A;  3JD7 3;  4AI1 A;  2Y33 A;  1PIV 2;  1GSL A;  2VZV A;  1RUI 1;  3GBW A;  1QJU 3;  4LIV A;  1OH4 A;  3T1L A;  2Y0I A;  2EAA A;  4ASL A;  4Z92 B;  4Q4V 3;  3PVE A;  4YW2 A;  3LAG A;  1RUJ 2;  2CAU A;  5BY5 A;  2DUQ A;  3OM7 A;  4JDO A;  4BIS A;  4AZZ A;  1N1S A;  4QXC A;  3D61 A;  1GZC A;  5GLM A;  2ORZ A;  1VAL A;  1W0N A;  1TME 2;  4J6G A;  4AI0 A;  1COV 1;  5JSO A;  4MGQ A;  1DU3 D;  2RS1 2;  2FCU A;  5C33 A;  2Y6J A;  1APN A;  3BVC A;  4QPI A;  4AWD A;  1BVV A;  4O8O A;  5CKM A;  3SH5 A;  4DRV A;  4MVT A;  1UU4 A;  1D0G A;  2A71 A;  3GAL A;  1LHO A;  3UYJ A;  2Y38 A;  2C1F A;  5C8C B;  3N7K A;  1AR7 2;  3VDD B;  3ZMN A;  2D6N A;  4AI9 A;  4MZU A;  3SC7 X;  4L2N A;  4FTE A;  3RJR A;  4K1Y A;  4DIN B;  5FY9 A;  4NII A;  4JGZ B;  1RUC 2;  4BLI A;  3AMQ A;  1OI6 A;  4IEY A;  2X53 S;  1DGW A;  2W9X A;  4OUM A;  3LDB A;  1PMJ X;  5FPA A;  5KHK A;  3FMG A;  2EXI A;  1H1M A;  2WA4 A;  3DUI A;  4XTP A;  5JSR A;  3AYA A;  3I2J A;  1WME A;  4NAO A;  4HAN A;  1FAT A;  1HRI 3;  3AC0 A;  2UWB A;  4UDJ A;  4D6S A;  4GJY A;  3OM5 A;  1DFQ A;  1RVF 3;  1MAC A;  1LEM A;  3AB0 A;  3MBW A;  2GH8 A;  1NA1 B;  2GN7 A;  4XFH A;  3AJY A;  5FUN A;  1VBB 2;  1GQP A;  3J7M A;  1W6O A;  3NVC A;  5KXB A;  5TSW A;  1VKD A;  3MV1 1;  2BNO A;  1PMH X;  1D7P M;  1U12 A;  4FOQ A;  2RJ2 A;  4UBG A;  4AED B;  1Q43 A;  5JXJ A;  4ZS3 A;  1X50 A;  4EN6 B;  3OGR A;  4QKD A;  2BGC A;  1G6N A;  1JOD A;  2O8O A;  2QNK A;  2Y64 A;  4W6W A;  5LBF A;  4FPJ A;  4LIT A;  1UWW A;  4QHO A;  3PNA A;  5T54 A;  3FE5 A;  4OQ8 A;  3J7N A;  4D94 A;  2D5F A;  1MQT C;  2OII A;  3RJ2 X;  3WZ1 A;  5JCT A;  1PNG A;  2YGM A;  2Y6H A;  1UY2 A;  1WW5 A;  5A7P A;  4NID A;  1ZBA 3;  2Q30 A;  3LPG A;  4XC9 A;  5J3U A;  3AZW A;  3VDD A;  1FOD 2;  1QNY A;  4COU A;  2AZ5 A;  3IN9 A;  2A7A A;  3PVO A;  3W21 A;  2H6B A;  2P5B A;  4RA0 A;  5FDB A;  5KXD A;  3K48 A;  4RGK A;  3OBT A;  5C4W B;  3TEZ A;  5IK7 A;  4MGT A;  2B4K A;  5CFC C;  1GP4 A;  1Z78 A;  5FO7 B;  4CEW A;  3O0X A;  2K9Z A;  3I59 A;  2G1M A;  5I0D A;  3U0Z A;  1DHK B;  2VD7 A;  4Y1V A;  3WG2 A;  3WVJ A;  1ZRC A;  3H3L A;  3WN0 A;  1W9W A;  5BV6 A;  5J7M A;  1YFU A;  3HIF A;  4D69 A;  3R4Y A;  3W58 A;  3ZFF C;  4NHM A;  2CGN A;  1P8J A;  1R09 3;  3POG A;  4FXG B;  1W06 A;  2W1Q A;  3O5S A;  4Q0Q A;  3ZSJ A;  2ZCW A;  4BIF A;  2ZS6 B;  1W2T A;  1GWK A;  4QM8 A;  1DZT A;  1Y43 B;  3CZJ A;  2JEN A;  5FZO A;  5LK5 A;  4ASK A;  3QZ4 A;  2VW1 A;  3D0S A;  4UW5 A;  3N9Q A;  5GLV A;  4PDW C;  2XBO 1;  4NMI A;  3D5O A;  4RSU A;  1TQ5 A;  1IS6 A;  1R09 2;  2YPD A;  2DYC A;  2LM3 A;  5A7V A;  4DMI A;  4NRP A;  5HXM A;  4AHX A;  5KC5 A;  2ZGP A;  1EYB A;  4AOC A;  4AFM A;  1NCQ A;  2E9Q A;  2VO5 A;  4QX1 A;  3AX4 A;  1GMM A;  3TRS B;  3E5Q A;  2QKD A;  1CX4 A;  4I2O A;  3LF7 A;  3IT8 A;  1YRZ A;  1HB4 A;  2XR4 A;  4WVZ A;  4Z1V A;  5FZC A;  3FUO A;  1QQP 1;  2FDI A;  1XND A;  1IG3 A;  2QUO A;  4GJZ A;  1BBT 2;  4KGQ A;  4NUB A;  2RMU 3;  1JHN A;  2B45 X;  1SLL A;  3THP A;  1Y3T A;  4GWM A;  1IZ3 A;  1H4H A;  4CVU A;  1WCK A;  4LHL A;  2WUH A;  2NMO A;  2YC4 A;  4GWI A;  5FXW A;  3WPZ A;  1KFU L;  5FO8 B;  3ZPY A;  3MV0 1;  5JPM B;  4DUX A;  5FZH A;  4XUO A;  5C8C C;  5DAX A;  2C24 A;  2EF6 A;  2EID A;  3D8C A;  1X7N A;  2I2S A;  1GBG A;  1S55 A;  3PUQ A;  4BQ4 A;  1K12 A;  2CDP A;  1W2N A;  1MPX A;  4KNC A;  5LW9 A;  1IQA A;  3TAW A;  3K3O A;  4Y1Y A;  5DAP A;  2VCM A;  1UYZ A;  4M0H A;  5IVY A;  4S2G A;  1I5P A;  1RVF 2;  1Z7S 1;  2EXH A;  4PLM A;  4YRD A;  3VD7 A;  4XQ4 A;  5K8S A;  1XRU A;  4LOS A;  1UNB A;  3AKP A;  1BEV 2;  3MW4 A;  3OY8 A;  2RE9 A;  3PHM A;  1DYK A;  1RHI 2;  2BNM A;  2D3S A;  3MO4 A;  4W8J A;  3WQ7 A;  1OA3 A;  2G19 A;  5FPX A;  4UW3 A;  3LEM A;  2RR1 3;  3I3D A;  4WM7 C;  2DTY A;  2P3I A;  3MDP A;  2VR4 A;  1XYO A;  3SH4 A;  5FYM A;  4LR4 A;  1R09 1;  4CUB A;  3D5Y A;  1DGR N;  1D4M 3;  4CTE A;  4EV0 A;  3SIT A;  3I2D A;  4NHY A;  1VBA 3;  3POI A;  4CU9 A;  1HRI 2;  2JXA A;  3IAP A;  1VRH 2;  3R4Z A;  3AFK A;  5BNO B;  3ZFE A;  1NKG A;  1QEX A;  4HON A;  1JXN A;  5A7W B;  4EE2 A;  4H3W A;  2VUC A;  3HT1 A;  1PMI A;  5C4W C;  4Q0V A;  3MIF A;  3WV6 A;  3I2O A;  4YM3 A;  3NNJ A;  1CJP A;  1XJA A;  1GFF 2;  2LW8 A;  3MFA A;  3VSZ A;  4D7T A;  4FPO B;  3TAY A;  3ECQ A;  3RVH A;  1RB8 G;  4RFT 0;  3WLU A;  3A22 A;  5K4L A;  1JYI A;  1ZRE A;  3R4U A;  2GDF A;  1SCR A;  1M4W A;  2OX0 A;  3KB5 A;  4R9B A;  4AFA A;  1NE6 A;  3OEB A;  4WM8 C;  3PU3 A;  1JYT A;  4YW5 A;  1AR6 2;  5KC6 A;  4XIL A;  4CEY C;  2CDO A;  2ADD A;  4CDW B;  1RXF A;  3N3H A;  5FZM A;  1NCQ C;  2YPJ A;  5FZA A;  2Y6F A;  5FZI A;  4AW7 A;  4XEZ A;  1MZF A;  3VBR C;  2CGO A;  4GAL A;  4NIG A;  1SBF A;  2FCT A;  3DYO A;  2PHL A;  3M3O A;  2WRA A;  2WZR 2;  2A75 A;  2XB6 C;  1W05 A;  5FYI A;  4EN9 B;  1ULO A;  3IDB B;  4PVA A;  2DFB A;  1RIT A;  5F5A A;  4QB1 A;  5L7O A;  1QXJ A;  1WZX A;  3FWE A;  2Y26 A;  2VAU A;  5E6H A;  2DUO A;  2XVL A;  5FZ6 A;  1ENQ A;  2TUN A;  1LHW A;  4PI0 A;  2YC0 A;  3RMX A;  4IV3 B;  3WF1 A;  1VBD 2;  3W5N A;  1AR7 1;  2A6Z A;  5LRR A;  1G9D A;  3RI9 A;  1OOP A;  2VZ1 A;  4LK6 A;  4Z2W A;  3T4V A;  1DQ1 A;  2NP0 A;  2WNV A;  4AE2 A;  3K3N A;  1R1A 3;  3B00 A;  5AVA A;  3VBF A;  2ZGO A;  2F4P A;  4HFS A;  1SFY A;  4BME A;  2GMM A;  1NCR C;  5C2M A;  1W8T A;  4IV1 A;  3I2H A;  3J7L A;  1VBE 3;  5I0R A;  4XF1 A;  3RMY A;  4FFF A;  2Q8O A;  4Y4Y A;  3ZFF B;  2DWR A;  1CAX A;  2WO1 A;  1X9T A;  3FJS A;  4N53 B;  4OHX A;  3C3V A;  4CDQ C;  3D60 A;  2XML A;  1D0H A;  1AR8 2;  1FMD 3;  5A3O A;  1LAJ A;  4QWN A;  4MET A;  1DYP A;  4GB3 1;  3ZYH A;  4X6R B;  1US3 A;  1V00 A;  4ET7 A;  1C5H A;  3AJZ A;  1SHW B;  3KCC A;  1RUD 2;  2ZGL A;  2JEC A;  2Q4S A;  3LKJ A;  4URT A;  4ASM B;  1RUH 2;  2VZS A;  3FL7 A;  1R64 A;  1B35 A;  2R16 A;  4LEJ A;  1BEV 1;  4WV8 A;  5D21 A;  3ZO0 B;  4IW3 A;  1OQD A;  5I0S A;  5AYD A;  4NPL A;  3VBH B;  1OYG A;  2R1B A;  4K40 A;  3QBQ A;  1UZ0 A;  4Q4X 2;  5JUV A;  1TZO A;  3EYP A;  3WX5 A;  1PM7 A;  2WQZ C;  5FQ0 B;  3F95 A;  3SCG A;  2JDY A;  1Q8O A;  1S4C A;  4ISQ A;  4PQQ A;  3O1U A;  2CSG A;  5IVE A;  1JZ4 A;  4IE6 A;  2QJV A;  3SKJ E;  2D97 A;  5FMO S;  4B7K A;  4HKO A;  2WWJ A;  3CU9 A;  1V9U 2;  2E33 A;  2WR9 A;  4NHL A;  4UF0 B;  4CUA A;  2YUE A;  5ABJ C;  4PCR A;  2A3Y A;  4AFD A;  4AF9 A;  3MIB A;  4LUM A;  2DVB A;  2FDH A;  1U0A A;  4XJ9 A;  1WMX A;  4A7K A;  2TBV A;  2XOM A;  2VW2 A;  5FJK A;  4MUV A;  4YW3 A;  5T50 A;  2VY0 A;  4N9H A;  5E1R A;  4OQ9 A;  4FPE A;  2RM2 3;  1BQP A;  4QPG B;  1BK1 A;  3RI8 A;  1PX3 A;  4KMQ A;  4J25 A;  4TN7 A;  1W90 A;  1VBE 2;  4CPB A;  5I91 A;  4KWL A;  2CV6 A;  4QDQ A;  4LXL A;  1W6P A;  3KVA A;  1L7R A;  2WIN B;  4Q4W 3;  1H8T A;  1H9P A;  4QX7 A;  3THT A;  3UKT A;  3O1S A;  3WPU A;  4RN5 A;  5FMD A;  3VT1 A;  4ZPI A;  4DQA A;  4R8H A;  3A23 A;  2Z42 A;  1AR6 1;  3IAQ A;  4GIQ A;  2XQX A;  2FZ1 A;  3WG3 A;  4YG0 A;  1JZ2 A;  3FZ3 A;  4YYO A;  2RS3 3;  3NNM A;  3VHR A;  4HLT A;  1B35 B;  1AYM 3;  1ZZ9 A;  4HBN A;  4IEQ A;  2WT2 A;  1EP0 A;  2R0H A;  4IV3 C;  5EP9 A;  3USU A;  5F3C A;  4E8D A;  1UYY A;  4EYU A;  2VME A;  4I09 A;  4LHS A;  1FV2 A;  1A8M A;  4HKL A;  3NO8 A;  1Z0H A;  5B4N A;  5G04 L;  4W4Z A;  2H0B A;  2HWB 1;  5FV3 A;  5GLQ A;  2VCB A;  1CZT A;  3TN9 1;  1US2 A;  4IDZ A;  1IGO A;  3C7O A;  3RRD A;  2PHR A;  2B9V A;  3ATG A;  2R7E B;  4Y33 A;  1POV 3;  3R05 A;  2B8M A;  3K46 A;  1O5U A;  4NRO A;  3AXE A;  4MYE A;  2DCZ A;  5C3R A;  1WL7 A;  3LGR A;  2VG9 A;  4ZY9 A;  2WO7 A;  1WUV A;  4M3C B;  3KV6 A;  4OUL A;  5F3E A;  2HWC 1;  4L92 A;  5EPA A;  3WNX A;  5IW0 A;  1GIC A;  1ND3 B;  1RUC 3;  2W47 A;  3NJY A;  3E6B A;  1UY1 A;  1HKD A;  2X8K A;  1XYP A;  3I2K A;  1LOE A;  1O8S A;  1JYC A;  4XF3 A;  1AL2 3;  1YLL A;  1W6P B;  2X5I A;  4Z82 A;  1F15 A;  4LA3 A;  5DDJ 3;  4BQW A;  2WNV B;  5K9Y A;  2AEY A;  4YZ4 A;  5KR7 A;  1AR8 1;  1YQ2 A;  4YAR A;  1AR9 3;  1LEC A;  1GQG A;  3ZXD A;  2YBS A;  5C8W A;  1VRH 3;  2A6W A;  5JXH A;  1RUO A;  4HN0 A;  5J48 A;  4UWD A;  2WWU A;  4KQ7 A;  4LE4 A;  4COT A;  2BPA 2;  4CU7 A;  3ZDS A;  3L2Y A;  3JQW A;  2ZML A;  4Q29 A;  4PHZ A;  4RR3 A;  1J3P A;  3WDW A;  1BLZ A;  3M3C A;  4PJY A;  3H8O A;  4XUT A;  1UY0 A;  2ARC A;  2SBA A;  2JB8 A;  2IC1 A;  1FT9 A;  3NQH A;  5C5U A;  3JBG 1;  4N2R A;  2O1Q A;  1WW6 A;  2WLQ A;  5IWF A;  5FPL A;  3POY A;  3VBS B;  5FKC A;  2WNU A;  2WNE A;  1N3O A;  2HYX A;  3FUQ A;  4M4P A;  4HVQ A;  2W2I A;  1SZB A;  1NLS A;  2X8S A;  3UGF A;  3UT0 A;  1UX6 A;  1EUU A;  4DEV A;  4FPF A;  1A34 A;  5C70 A;  1HQL A;  5FPU A;  1JOB A;  2JDP A;  2J1T A;  3E5U A;  1LCL A;  3WHT A;  2J1S A;  2ZX4 A;  1MEC 3;  4L8Q A;  1XNB A;  4P9L A;  4UI9 L;  3RZZ A;  3KMH A;  2RR1 2;  2PLV 2;  4M4R A;  2X5I C;  2JIC A;  3R67 A;  1OA2 A;  3POS A;  2PHX A;  2ZEW A;  3T30 A;  2DU0 A;  4JCK A;  3L2H A;  5F7U A;  4FCA A;  1CVN A;  1VJ2 A;  4OUE A;  3K4D A;  4IGO A;  2QQU A;  3I54 A;  3AZZ A;  1JU4 A;  3RFR A;  2IXI A;  1HXS 2;  1OXC A;  1X8M A;  3OCP A;  4CU6 A;  3VSR A;  1OPM A;  3B3Q E;  2W46 A;  4B4R A;  1S2B A;  2JDM A;  2UY8 A;  3ZYF A;  1SG3 A;  2RMU 2;  1H0B A;  3MFC A;  4XAC A;  3WPV A;  1A8D A;  1GNZ A;  2QCS B;  2MEV 1;  3LCP A;  2UWA A;  3N9L A;  4CCK A;  1UZV A;  2IXJ A;  2GZW A;  3J26 N;  4YM0 A;  3AMN A;  4CXX A;  3LV4 A;  1NLR A;  2DUP A;  4AVT A;  1CD3 G;  2PAM A;  4FXK B;  4RL7 A;  2HWD 3;  1ULC A;  5C7G A;  1JZ3 A;  4FP2 A;  1VBD 1;  2QVS B;  4XE9 A;  4AQ2 A;  1SLI A;  4CEW C;  1G9B A;  2RM2 2;  4Q4X 3;  5FZB A;  1AL0 G;  4RYD A;  1OD5 A;  4QXK A;  3S7E A;  4WVM B;  1SCS A;  3ZXL A;  5FR3 A;  3FBM A;  5E16 A;  1W9Y A;  1XXN A;  1HB3 A;  3CJI C;  4XIK A;  1YI7 A;  3ZMO A;  1CON A;  3N36 A;  1QDO A;  1GYD B;  1JMU B;  2A6V A;  2YC2 A;  4YGE A;  2DUR A;  5FUI A;  2YGL A;  3FN9 A;  4IXL A;  4D6R A;  1V9U 3;  3R6S A;  3T0A A;  1JYV A;  1CAW B;  1CPM A;  3NNG A;  5FBZ A;  5LAT A;  1IKQ A;  4AG4 A;  4QKN A;  3GJA A;  4EZH A;  2VOK A;  2XVG A;  5HCH A;  1PK6 B;  1V6N A;  3I2G A;  2FDG A;  1H2K A;  4TYS A;  4AHY A;  1XE8 A;  5FY1 A;  1WLC A;  2UY9 A;  4LUL A;  4U6B A;  2D44 A;  3UNP A;  1AR8 3;  1FMD 2;  4F83 A;  2IXK A;  3LPF A;  1QQP 3;  3PJQ A;  2D43 A;  4XDP A;  1JOP A;  4I3G A;  3IZO A;  1SPP B;  2JG8 A;  4FOW A;  3III A;  4GWN A;  3RNS A;  4EN7 B;  4V2V A;  2O0O A;  5IAX A;  5D8A C;  1RED A;  3KZ4 C;  4OI4 A;  3U1X A;  3WHU A;  3WAT A;  1DGW X;  4O7X A;  2C4X A;  5JDB A;  3KM5 A;  1ZRF A;  1W8W A;  2VJX A;  1KS5 A;  1HXS 3;  5F2S A;  2IFW A;  3A4U A;  3DL3 A;  2H6C A;  4CU8 A;  3BYL A;  3M4F A;  1O3R A;  1TG7 A;  1AXK A;  4BPZ A;  2VVE A;  1ULD A;  1YYN A;  1Q56 A;  3VBS A;  2RS3 2;  1HRV 2;  4HN1 A;  4XBQ A;  2WS9 1;  2ZHN A;  1IS4 A;  1RUG 1;  1YQ5 A;  1GP6 A;  2FQP A;  1AZD A;  1O4Z A;  1SQ4 A;  2J1A A;  3MHZ A;  1KDK A;  4H2A A;  4N4B A;  3OM6 A;  1DLL A;  4IE5 A;  3ZN5 A;  1WCQ A;  4DRR A;  5A70 A;  4DIQ A;  2OQ7 A;  1TVG A;  5FP8 A;  1QF3 A;  4P08 A;  4BXF A;  3PUA A;  2AC1 A;  2VZT A;  2ZHL A;  1GR3 A;  3I3Q A;  4YPJ A;  5APA A;  1V0A A;  1V6J A;  4H7M A;  4ZU4 A;  1OOP C;  1HXS 1;  1NQD A;  2LRP A;  3GZT B;  2VMD A;  5FK8 A;  3RYK A;  4P9G A;  5GZG A;  2P6C A;  2VBD A;  2CWM A;  4A6S A;  5IVB A;  1QJY 2;  3KWV A;  3J4U H;  4LO4 B;  1MVQ A;  5LBE A;  4DXZ A;  1HJF A;  4BXS V;  4XET A;  1XC6 A;  4Q0S A;  5LA2 A;  3BYJ A;  3QEF A;  1D2Q A;  4B29 A;  1VAV A;  2GU9 A;  2RS1 3;  1AYN 1;  4KH9 A;  3TN9 2;  1J1T A;  1N3P A;  4AED C;  5J1X A;  2DCY A;  3AP9 A;  1EAH 2;  5L19 A;  1QGL A;  5JWP A;  2JG9 A;  3WDY A;  2ES3 A;  2ZX2 A;  3PTR B;  3E97 A;  1J3Q A;  1LOF C;  2BUK A;  1N1Y A;  3AXD A;  4D0Q A;  3LE0 A;  3LIG A;  5A32 A;  4FQZ A;  5DUV A;  5J96 B;  5FLI A;  1C57 A;  3THD A;  5IVV A;  4FOY A;  4FSJ A;  2YYO A;  1PO2 1;  3T2P A;  1EY2 A;  1RUD 3;  2C5D A;  2B5H A;  1RC6 A;  4V2W A;  1PO2 3;  1EPW A;  4ERO A;  1ULE A;  4QX0 A;  4XAB A;  1XNT A;  2ZGR A;  1VBA 2;  2B9U A;  4XDO A;  5ACA 2;  3DPR B;  3KQ4 B;  4Q26 A;  3J7H A;  2JKX A;  4QQO A;  3VB9 A;  4A6O A;  3TEW A;  2G4I A;  1F35 A;  3OY8 B;  3BUC A;  4CEY A;  4K1Z A;  1XU1 A;  2RDN A;  2WT0 A;  3ETQ A;  4IES A;  1U5X A;  4RQP B;  1HRI 1;  5JZG C;  2ZX1 A;  1MS4 A;  3SQO A;  1RJ7 A;  4Q2F A;  2A3W A;  4B7E A;  4ZU5 A;  2PFW A;  1CX1 A;  4ES8 A;  2ZAB A;  1RL3 A;  3TYJ A;  1CZV A;  4Y5T A;  2BRT A;  1QU0 A;  1FPN 3;  5GLU A;  3JCI A;  5ABJ B;  3UGH A;  1YI9 A;  3KLS A;  3IPV A;  2P6H A;  1NYW A;  1KIT A;  2OVU A;  2AEN A;  2VU9 A;  2D98 A;  4JQT A;  4JHT A;  2NMN A;  4BU2 A;  3HMY A;  4FAH A;  4JKL A;  3WF3 A;  5HPO A;  3WOG A;  1YWK A;  4AQ6 A;  5HCB A;  4LO7 A;  2GNM A;  3EXU A;  4JRL A;  5FTT C;  3POF A;  1DF0 A;  2R32 A;  3IKW A;  2YU2 A;  3W20 A;  3O1O A;  3NV3 A;  2QDR A;  5BYN A;  3MLJ A;  2Z4F A;  5EIY B;  1GWM A;  4AVB A;  1PHM A;  1FXZ A;  3FHA A;  2ARX A;  1Q5O A;  5M0T A;  2FMD A;  5EFU A;  2JB4 A;  2OW4 A;  2ZMN A;  2QQW A;  3KHB A;  4GZ9 A;  5C9A A;  5BNN C;  3BIW E;  1J58 A;  2DDU A;  3N9O A;  2QQP A;  4IEU A;  3H7J A;  4CCC A;  3ON7 A;  4YZ5 A;  4P00 B;  2ZX3 A;  3OSD A;  2OYZ A;  5A6Q A;  2PQS A;  4LBQ D;  4AAP A;  4UYB A;  4CZS A;  5C3Q A;  1F8V A;  3IDE A;  1NY7 2;  4QKF A;  3AZX A;  3VDD C;  2VH9 A;  1ZZB A;  5L9R A;  4CRQ A;  1ULP A;  1XNK A;  4JAA A;  3RWN A;  5BNN B;  2JE9 A;  5CFC B;  1C5I A;  2NN8 A;  5E8A A;  1YFW A;  3TNQ A;  2WS9 3;  1POV 0;  4AEJ A;  5FXZ A;  4AI8 A;  2P37 A;  2PTM A;  4HVO A;  4KI5 M;  1H2M A;  2VOV A;  4OYU A;  4HK9 A;  2XH6 A;  4QX3 A;  3WF4 A;  4NVP A;  5DN2 A;  1HQW A;  3MID A;  3BCW A;  3AL6 A;  3NMB A;  4JGY B;  4YM2 A;  1H6Y A;  3ZKY A;  1UQX A;  5L7O B;  1W2A X;  3ENR A;  2WYF A;  3TBD A;  1QOT A;  5L9B A;  1OA4 A;  1QOO A;  2PYT A;  4IV3 A;  5IT6 A;  2BVV A;  4RGA A;  5FZE A;  3V65 A;  3DGT A;  4CDX A;  3B01 A;  2DBI A;  4QM9 A;  4ZZ5 A;  5JXG A;  1AYM 1;  1FYU A;  2LRO A;  2VZ3 A;  3B02 A;  3KF3 A;  1UMI A;  3SLI A;  1AYN 2;  4XBL A;  1UD1 A;  2MEV 2;  2Q8D A;  1YO8 A;  2HWD 2;  1LU2 A;  3AZV A;  2DFC A;  4OVE A;  5FOB B;  3VD4 A;  2Y6L A;  1WA6 X;  1HV0 A;  2LTN A;  1O8P A;  3CHX A;  5D1I A;  4XJ8 A;  2DU1 A;  1CIY A;  2GNT A;  1A78 A;  5C4W A;  5GZF A;  5J98 B;  1EPZ A;  1D4M 1;  3OGS A;  2XJU A;  3WMZ A;  3KV5 A;  1VB2 A;  1JW6 A;  2P3K A;  4QHB A;  4ZON A;  5FP9 A;  3ACI A;  3I59 B;  2VQU A;  4E2G A;  4AVC A;  5FWJ A;  1LJ7 A;  2XBO 3;  1H2N A;  2Y0O A;  1IS5 A;  3POW A;  2CL2 A;  4QGM A;  1JYW A;  3AP6 A;  3AKQ A;  4LBM A;  1YIP A;  2W94 A;  1REF A;  1V9U 1;  1VBD 3;  1I3H A;  2ZGT A;  1NZC A;  1W0O A;  3H7Y A;  4HL0 A;  4BIO A;  5CFC A;  3LSD A;  1DQ5 A;  3I3B A;  5JVV A;  1MZE A;  2WNU C;  3ZM8 A;  3I8T A;  1E5I A;  2D6M A;  3M70 A;  2XJT A;  2XUM A;  2AUY A;  4PBO A;  2PA7 A;  5FYH A;  5H9P A;  2A5Z A;  4AXO A;  2W1W A;  3C2U A;  4Q0U A;  4ZU7 A;  1O91 A;  3HAG A;  3VZO A;  2PHF A;  1BBT 3;  3I97 A;  1AYN 3;  4JGY C;  3AP5 A;  5AFE A;  4N1I A;  2VMI A;  4LO6 B;  4MXV A;  2KD7 A;  4NPM A;  3ZFE B;  3I2I A;  2DVF A;  4YNI A;  3WSO A;  2QFE A;  3L9J T;  3LEG A;  1XSR A;  1PGL 1;  4GKY A;  2ORX A;  3ITQ A;  3O7O A;  4EWA A;  1J83 A;  4HPK A;  2W92 A;  4NRQ A;  5CZK A;  2RDQ A;  4GKX A;  3B9I A;  3P6B A;  4OLL A;  2R07 1;  2B42 B;  1VBC 1;  1HLC A;  2ZJC A;  1JYN A;  3VDB A;  2P17 A;  1RJ8 A;  3PMS A;  1IHM A;  1VRB A;  1RUF 3;  1LHU A;  3ZLI A;  3WIN E;  3ZN4 A;  5FOJ B;  4NWV A;  5F5Q A;  5FMB A;  5LEK A;  5FZG A;  1CGP A;  2IXL A;  2WAA A;  1QH6 A;  1QY4 A;  3GGL A;  3N7J A;  4L97 A;  3VHP A;  3KCX A;  1S0E A;  2ZAH A;  4CDW A;  4EN8 B;  1JUI A;  5FRA A;  1F4H A;  1XQN A;  5JI9 A;  4S2F A;  1F5J A;  4JGZ C;  4BE3 A;  4LT5 A;  1RUF 2;  1NY7 1;  3HR9 A;  3QAC A;  1D4M 2;  1G9F A;  2HBU A;  1W99 A;  4BWO A;  2BNN A;  2Q8C A;  1S0G A;  4QPG C;  4U6D A;  3BGA A;  4YZ2 A;  4Y20 A;  4E4H A;  3GCX A;  3C7H A;  1MQT B;  5T5L A;  2PHU A;  3OTF A;  2VNG A;  4QDS A;  2VMF A;  2RJL A;  5FAX A;  3WAU A;  4KL1 A;  5I0U A;  1OQE A;  2V4A A;  2BBA A;  4BB3 A;  4ZHN A;  1QJY 1;  1UXZ A;  4UBH A;  3MLK A;  2D6K A;  5LA9 A;  4L0P A;  5FLW A;  1CQ9 A;  4YG3 A;  4AR2 A;  2WLP A;  4YSF A;  4GXL A;  4PF1 A;  4OI0 A;  1C3H A;  1XPW A;  1PVC 2;  1LTE A;  1K42 A;  4OCT A;  4XJW A;  5A8D A;  5A33 A;  3GDB A;  2XQR A;  1RUN A;  3DCQ A;  3KSC A;  5JIU A;  4S2H A;  4AVS A;  1J3R A;  1T6B X;  2UWC A;  2WJS A;  5F3G A;  3NKT A;  5AC9 2;  5KWR A;  5LA0 A;  1SLC A;  4LBO A;  2E51 A;  4I0W B;  2YDE A;  4XTM A;  5LCW L;  5EXO A;  1S2K A;  3LQC A;  4YW1 A;  3T0D A;  1BMV 2;  2Z2S B;  3WDT A;  1DQ6 A;  3Q8F A;  4J1X A;  5A7W A;  4Y24 A;  2R49 A;  1JZ8 A;  1YJL A;  3EJK A;  1GWL A;  4DY5 A;  5CFD A;  3WW2 A;  4N43 A;  3THC A;  1MS8 A;  1I9R A;  5GLZ A;  3M7A A;  4IND A;  5FYC A;  5DAQ A;  4B4Q A;  3VBF C;  3MIG A;  4M01 A;  3O0V A;  3H8R A;  1EV1 2;  1YQC A;  4G3Y C;  3D6E A;  2VNO A;  5H9R A;  1MEC 1;  2FDK A;  2WFF 1;  4JQR A;  5I8S A;  4QDR A;  4FP3 A;  2VUJ A;  4FPH A;  4Y20 B;  3SKV A;  1K5M C;  2YRO A;  3ZFG B;  2Y8K A;  2ZEZ A;  3D82 A;  5ACA 3;  1DG6 A;  3BTX A;  2EXJ A;  4UW4 A;  2PAE A;  2EXK A;  2ZTN A;  4AVV A;  4EWE A;  2P3J A;  2D40 A;  5B2G B;  1NLQ A;  3WAS A;  2GMP A;  2FCV A;  2VXR A;  1DQ2 A;  2GP3 A;  4FPC A;  4G9S B;  5E88 A;  3JBG 3;  1WLT A;  2B39 A;  4YM1 A;  5F6L B;  3CNA A;  5FPZ A;  2VCA A;  1Q8Q A;  5LEJ A;  2BYV E;  3MF9 A;  4A42 A;  1DQ4 A;  4ORF A;  1NZI A;  2XJR A;  1UKG A;  1VB4 A;  1F31 A;  1EUT A;  4WZF A;  1KGY A;  4HMZ A;  4O8P A;  1UYX A;  1KQR A;  2ERF A;  3GNE A;  2VZO A;  4BHP A;  3HQX A;  5FYT A;  3NL1 A;  4I01 A;  4JTN A;  1YQ6 A;  1LHN A;  2RMU 1;  4GH4 A;  1UU5 A;  4RGG A;  3VBU A;  2KXL A;  4XPV A;  2YB7 A;  4BCU A;  2RS5 1;  4JDM A;  5HBA A;  4IGQ A;  4XFC A;  1H1A A;  1JZ6 A;  4XCA A;  3V64 A;  2VGD A;  2WO2 A;  3WP4 A;  5T52 A;  5K0U C;  1LOC A;  4CXY A;  3B69 A;  5FZK A;  4UDK A;  3VL8 A;  1RUI 2;  1PT2 A;  1UL9 A;  5C5T A;  3IIA A;  4CCD A;  3O0W A;  2RM2 1;  2WZP P;  3VDA A;  1YFY A;  5GM0 A;  3SCF A;  1KJR A;  3I7D A;  4D7S A;  1X8E A;  1F5F A;  3O1P A;  1NG0 A;  1OLM E;  3C8X A;  5ANN A;  5FY4 A;  1JYX A;  3FFZ A;  4CCN A;  3FLR A;  1RUI 3;  1SFP A;  2MNG A;  3K1U A;  4PQ9 A;  2X05 A;  5EWS A;  2VUA A;  2ZHK A;  3AVR A;  3SH3 A;  3EO6 A;  1ZBA 2;  1CES A;  3BU7 A;  1CAU A;  2XPJ A;  4A45 A;  5IVC A;  5FFO C;  2ENR A;  3FC0 A;  3WNM A;  1N1T A;  3H9A A;  2Y60 A;  2HWD 1;  2VM9 A;  3LWC A;  1LB2 A;  2YMZ A;  1OH3 A;  3EMR A;  4HG6 B;  4DEQ A;  2HWE 3;  2QE3 A;  2CU5 A;  2Z79 A;  4LUK A;  5IAV A;  1ZBE 1;  1ODN A;  2JG9 C;  2ZEY A;  2CGP A;  2W08 A;  4LMF A;  2QQO A;  2Q5T A;  5A1L A;  1AR6 3;  3ACF A;  5DQ0 A;  3SXW A;  3PME A;  5C3S A;  4O9E A;  5HCA A;  1HW5 A;  5L36 A;  5KHI A;  1YEW A;  3J8F 1;  4R52 A;  3OUH A;  2VQT A;  1W2U A;  3HNM A;  4QU1 A;  5DAW A;  1K45 A;  3H50 A;  2IZW A;  4CEW B;  3A0K A;  4GB3 3;  5ERL A;  1UYP A;  4AGV A;  4DNY A;  3M3Q A;  1OBN A;  1R1Z A;  3LEK A;  1TMF 1;  1UV4 A;  5EV7 A;  2HWC 3;  2RHP A;  4S2D A;  3ZXE A;  3CMG A;  4XFF A;  1HQN A;  4ATF A;  4TTG A;  1OLR A;  1LEN A;  2GME A;  3VKF C;  2RS5 3;  4MHU A;  3BYN A;  5I0T A;  4UFK A;  5FZ0 A;  5A32 B;  4CP9 A;  3I3M A;  1YUD A;  5DDJ 2;  4Y1Z A;  1DBN A;  3NAP C;  2I45 A;  1HRV 1;  3HNY M;  5CFD C;  5IJR A;  3SHR A;  5D8A A;  1ZBE 3;  1F2N A;  1LED A;  4A2U A;  5IYY A;  5CG8 A;  4KCA A;  2GNB A;  1C8M 1;  1ND2 A;  3WP6 A;  1DDL A;  4XYX A;  1ULF A;  4AGG A;  4ISR A;  4RD7 A;  2XDV A;  4AI3 A;  1GKB A;  3Q8A A;  2W95 A;  5FXX A;  4KU7 A;  4DPN A;  1NA1 A;  2R04 1;  3QEE A;  1XYN A;  4MSV A;  1Q8S A;  3IMN A;  5F1R A;  5A7V B;  2PHT A;  2ZKL A;  4MLO A;  5CVR A;  3WNL A;  2HWF 3;  1PVX A;  4M3C E;  5A7S A;  4K7J A;  1ASJ 1;  2YBK A;  1V6I A;  1ULG A;  2YHJ A;  2XHN A;  4R4X A;  5FZL A;  2MPF A;  5KBF A;  3JD7 2;  1VE0 A;  4C8D A;  5LK7 B;  1UOJ A;  2O14 A;  1C4R A;  5FIX A;  5FZ7 A;  5AC9 3;  4UFL A;  3UES A;  4PI2 A;  3POE A;  4NHK A;  4Q4V 2;  1S0C A;  4CCM A;  5FYV A;  4CDW C;  1Y9Q A;  3RWK X;  1E5S A;  1YIF A;  5DAB A;  2OZJ A;  2ARB A;  2WFF 3;  1PO1 3;  3KGZ A;  1H8T C;  3P3P A;  5GLP A;  5FO9 B;  1TEI A;  1PGW 1;  1WMD A;  2X5I B;  4JHZ A;  4KBB A;  1SBE A;  1WCS A;  5C6C A;  1UX7 A;  4P9I A;  3QLQ A;  2VE1 A;  3K4Z A;  1AL2 1;  3VKN A;  4BA6 A;  5AYE A;  5F37 A;  1NCR B;  1LRH A;  4Q4W 2;  4P5H A;  5JOW A;  4BH9 A;  2Y6G A;  1BK0 A;  3H1M A;  5DG1 A;  1CJD A;  2D93 A;  2WA3 A;  4DXT A;  4FAG A;  3WW3 A;  1V70 A;  5DG2 A;  4JX0 A;  4ONU A;  3N7M A;  1I5Z A;  1JS9 A;  2ET7 A;  4QT6 A;  2ZA9 A;  3UGG A;  4KCB A; 
#chains in the Genus database with same CATH homology
 4XUR A;  3VD5 A;  2VZQ A;  1GQP A;  4CU8 A;  4ZXE A;  1VKD A;  3BYL A;  3MV1 1;  4DXR A;  4FFI A;  1PMH X;  1D7P M;  1TG7 A;  1W8N A;  2RJ2 A;  5JXJ A;  2VOT A;  3OGR A;  4BDV B;  4UDI A;  2QQJ A;  2Y64 A;  3D5Z A;  3MUY 1;  2J1A A;  1GYE B;  1UWW A;  4E8C A;  4N4B A;  3OM6 A;  3MUZ 1;  4XZU G;  2HLE A;  1WCQ A;  2WZE A;  3I3E A;  2BGO A;  2V72 A;  3AKI A;  1TVG A;  2Y6H A;  2BGP A;  4P08 A;  1UY2 A;  4YPJ A;  2AC1 A;  2VZT A;  5JOY A;  3LPG A;  3UET A;  5FK8 A;  2VMD A;  4N2Z A;  4DUW A;  4FFG A;  5IFT A;  3HOB A;  4BXS V;  5IFP A;  2J22 A;  1XC6 A;  1GUI A;  5LA2 A;  3BYJ A;  3QEF A;  3T2O A;  2B4K A;  3OBA A;  3WF2 A;  3IB3 A;  3E1F 1;  4BK4 A;  5I0D A;  4BJ0 A;  3A21 A;  2EIE A;  5J1X A;  5JOX A;  3WN0 A;  1W9W A;  3F2Z A;  1GOH A;  4UOJ A;  3R4Y A;  3CQO A;  4D0Q A;  3LE0 A;  3LIG A;  1DP0 A;  4JKK A;  1P8J A;  3WQB A;  2W1Q A;  3K75 B;  1ST8 A;  3THD A;  3HJR A;  4FI9 A;  1W2T A;  3T2P A;  2OXB A;  3QZ4 A;  3CZJ A;  2QBX A;  3LEI A;  4MAD A;  4QX0 A;  1XNT A;  3J7H A;  1J84 A;  1IQD C;  2JKX A;  4A6O A;  5A7V A;  5HXM A;  5C0P A;  2VO5 A;  4QX1 A;  1JHJ A;  1GMM A;  4A41 A;  3SEP A;  4FFH A;  1Y4W A;  3NJX A;  1CX1 A;  3LF7 A;  3P2N A;  1YRZ A;  1GU3 A;  1CZV A;  2YFT A;  1GNY A;  3WF0 A;  3UGH A;  4UDK E;  2JE8 A;  2X8F A;  2QQK A;  5HPO A;  4JKL A;  3WF3 A;  5A1A A;  3WNP A;  4QX2 A;  4JKM A;  4QB6 A;  4CVU A;  4QB2 A;  1L7Q A;  3BN6 A;  2WUH A;  2YC4 A;  4GWI A;  3WPZ A;  3WNN A;  3MV0 1;  5FK7 A;  4DUX A;  4XUO A;  3DYM A;  1K3I A;  2EID A;  2Z4F A;  5EIY B;  5DMY A;  5LA1 A;  3FHA A;  1K12 A;  2E26 A;  2CDP A;  1MPX A;  3VD3 A;  3W5M A;  2QQW A;  4GZ9 A;  3TAW A;  1UYZ A;  2DDU A;  4MO3 M;  4P5Y A;  3U75 A;  1I5P A;  1WKY A;  4P00 B;  2EXH A;  3BYK A;  3K4A A;  3VD7 A;  5GLK A;  2PQS A;  4KWU A;  3D3A A;  3KF5 A;  2B4W A;  1ULP A;  4W8J A;  2WQ8 A;  3MO4 A;  2RVA A;  3AKF A;  3LEM A;  4Z2A A;  1HN1 A;  4OYU A;  2W3J A;  4KI5 M;  3VSF A;  3I3D A;  4QX3 A;  3WF4 A;  5DN2 A;  2WO3 A;  4W50 A;  1OF3 A;  2VR4 A;  3JXS A;  1H6Y A;  3HNB M;  4CUB A;  3D5Y A;  1T2X A;  2VZR A;  1JI6 A;  2YFZ A;  4CU9 A;  1W9S A;  4ZZ5 A;  3IAP A;  5JXG A;  3R4Z A;  3T09 A;  2QQV A;  2YFR A;  3WMY A;  2VZ3 A;  1NKG A;  3KF3 A;  2W1S A;  1UMI A;  4DXS A;  3VD9 A;  3I2F A;  3OGV A;  3VD4 A;  2VC9 A;  1JZ5 A;  1OF4 A;  2Y6L A;  4NOV A;  1O8P A;  2LW8 A;  3PUH A;  3VSZ A;  4QAW A;  4QQS A;  1CIY A;  1UXX X;  3ECQ A;  3A22 A;  3OGS A;  3WMZ A;  1NX9 A;  3OEB A;  3ACI A;  2VQU A;  3A7Q A;  3VT0 A;  2CDO A;  2ADD A;  1F4A A;  4XUN A;  2VZU A;  1JYW A;  2RV9 A;  1RYY A;  1W9T A;  2W94 A;  2QQN A;  3AKG A;  2J1U A;  4KMI A;  3T0B A;  3DYO A;  3I3B A;  3ZM8 A;  1JU3 A;  1UMH A;  4PVA A;  1ULO A;  4D8M A;  4QB1 A;  3EB7 A;  1XNA A;  2W1W A;  4EQV A;  3WF1 A;  3ACG A;  4QPW A;  5EJ1 B;  3C2U A;  2J7M A;  3W5N A;  4XUP A;  3I97 A;  2VZ1 A;  4N1I A;  3OG2 A;  2KD7 A;  3I2I A;  4GWJ A;  5GLR A;  3WSO A;  2Y6K A;  3LEG A;  5A8C A;  2ORX A;  1J83 A;  3ABZ A;  2W92 A;  4MLG A;  5CZK A;  4AK7 A;  3P6B A;  3I2H A;  3VDB A;  4FFF A;  1JYN A;  1O59 A;  4MGS A;  2LS6 A;  2WO1 A;  5JXI A;  3D60 A;  5FMB A;  2WAA A;  3GGL A;  3IDA A;  5FMC A;  5B4X A;  1W18 A;  2XON A;  3QC2 A;  3GM8 A;  1US3 A;  4ET7 A;  1SHW B;  1F4H A;  2WAO A;  3CDZ B;  4D47 A;  2VZS A;  3FL7 A;  4KCB A;  2V5D A;  1R64 A;  2EIC A;  1GOF A;  5AYD A;  3WN2 A;  1W99 A;  1OYG A;  1UZ0 A;  1KEX A;  5JUV A;  3EYP A;  4U6D A;  2W1U A;  2YFU A;  3BGA A;  4MOA A;  4PQQ A;  3VSS A;  4LKS A;  3C7H A;  1JZ4 A;  4XVH A;  4QDS A;  3SKJ E;  2VMF A;  2C9K A;  3LDR A;  2X09 A;  3WAU A;  4ARX A;  2WN2 A;  3CU9 A;  2E33 A;  4CUA A;  5JR2 A;  1GOG A;  4O8N A;  2BBA A;  1UXZ A;  5CYY A;  5JMO A;  4L0P A;  2XOM A;  5FLW A;  4PF1 A;  5A8D A;  2WAB A;  1XPW A;  2VL4 A;  3ZXJ A;  3GXU A;  3GDB A;  2XQR A;  2QQI A;  2E32 A;  1PX3 A;  3ACH A;  4KMQ A;  5LA0 A;  5GLO A;  3NJV A;  4QDQ A;  5LCW L;  5DPN A;  1L7R A;  3LQC A;  4A3Z A;  3T0D A;  3WPU A;  5GLN A;  4RN5 A;  5FMD A;  3VT1 A;  1JZ8 A;  3A23 A;  3IAQ A;  4LPL A;  2XQX A;  3CIH A;  3ZXK A;  1JZ2 A;  3THC A;  3LIH A;  4PT6 A;  4P02 B;  2YFS A;  3PIJ A;  2QQM A;  2WBK A;  3U14 A;  4E8D A;  1UYY A;  2VME A;  3K77 A;  4LHS A;  4ONZ A;  5B4N A;  2V4V A;  4QDR A;  5G04 L;  2J1V A;  4W4Z A;  5FKB A;  5GLQ A;  2VCB A;  3SKV A;  2Y8K A;  2ZEZ A;  1CZT A;  1BHG A;  1US2 A;  1OD3 A;  2WN3 A;  3C7O A;  3LDK A;  2W87 A;  2EXJ A;  3NRU A;  2B9V A;  2EXK A;  2DCK A;  2ID4 A;  2R7E B;  3VDC A;  2WDB A;  3KST A;  3K46 A;  2BER A;  4BK5 A;  3C7F A;  3WAS A;  1WL7 A;  4UAP A;  4KC8 A;  4AAX A;  4ZY9 A;  2J1R A;  1JZ7 A;  2DCJ A;  2QQL A;  2VCA A;  3HPN A;  5GLL A;  2AEZ A;  4A42 A;  3WNO A;  1UY4 A;  4XUQ A;  2W47 A;  4A44 A;  3OM4 A;  1EUT A;  1UY1 A;  1KGY A;  4KC7 A;  3I2K A;  4O8P A;  1UYX A;  1O8S A;  2VZO A;  3T08 A;  2AEY A;  2ZEX A;  5AY9 A;  3C7G A;  1YQ2 A;  1OT5 A;  1W8O A;  2YB7 A;  5JXH A;  3DYP A;  1CZS A;  3VT2 A;  3WEZ A;  2E31 A;  1JZ6 A;  4COT A;  1LNS A;  3WNK A;  2BZD A;  2YG0 A;  2WO2 A;  4CU7 A;  1NUK A;  2JD9 A;  4UDK A;  1SDD B;  2WYS A;  1PT2 A;  3HN3 A;  4XUT A;  4ZZ8 A;  1UY0 A;  3T2Q A;  2OKX A;  3U37 A;  3NQH A;  3VDA A;  4N2R A;  5C71 A;  4UDG A;  3AKH A;  4ARY A;  2JDA A;  3OEA A;  5FKC A;  4DUV A;  4OMC A;  3C8X A;  2HYX A;  4M4P A;  5ANN A;  1JYX A;  2X8S A;  3UGF A;  4A4A A;  3K1U A;  1EUU A;  2X10 A;  3P1I A;  2X05 A;  3OB8 A;  4DEV A;  2C26 A;  4A45 A;  5C70 A;  3OM2 A;  2J1T A;  2J1S A;  3CKH A;  3WNM A;  3QED A;  5B6S A;  4OZO A;  1UY3 A;  2VMC A;  2VM9 A;  4UI9 L;  4HG6 B;  3FHQ A;  4M4R A;  4DEQ A;  4AK6 A;  2ZEY A;  3R67 A;  2QQO A;  2ZEW A;  1Y7B A;  3ACF A;  5DQ0 A;  5F7U A;  2WZ8 A;  1DLC A;  2X8T A;  4OUE A;  2VQT A;  2L9L A;  3C7E A;  3HNM A;  3K4D A;  2QQU A;  5AYC A;  1K45 A;  5EJZ B;  1JU4 A;  4OMD A;  2ADE A;  2VCC A;  4CU6 A;  1UYP A;  4IUG A;  4TXW A;  3HEI A;  3VSR A;  1NAE A;  2W46 A;  3LEK A;  1UV4 A;  5B6T A;  4CUC A;  4TTG A;  3CMG A;  2VDT A;  1PX4 A;  1SG3 A;  3BYN A;  4PVI A;  3WN1 A;  1H6X A;  3ETP A;  3WPV A;  3HNY M;  5IJR A;  3LV4 A;  5IYY A;  2J1E A;  4KCA A;  2W5F A;  2VTF A;  5C7G A;  1JZ3 A;  2W95 A;  3QEE A;  2VZV A;  5A7V B;  1OH4 A;  3PIG A;  3WPY A;  4RYD A;  3WNL A;  3ZXL A;  2ZXQ A;  1YI7 A;  3OM7 A;  3DEC A;  1GYD B;  3D61 A;  2XHN A;  2YC2 A;  5FUI A;  3SEE A;  5GLM A;  2ORZ A;  3FN9 A;  2W91 A;  1W0N A;  5FIX A;  3T0A A;  1JYV A;  4MGQ A;  3UES A;  2VZP A;  2Y6J A;  3NNG A;  4AG4 A;  5IHR A;  3RWK X;  1YIF A;  4O8O A;  3I2G A;  5GLP A;  2EIB A;  4JHZ A;  4U6B A;  5JOZ A;  3SC7 X;  3UNP A;  1Y9M A;  3PUI A;  3LPF A;  3LFI A;  1UX7 A;  3K4Z A;  5AYE A;  1DYO A;  1GYH A;  3III A;  4AK5 A;  5JOW A;  2W9X A;  1PMJ X;  2Y6G A;  5G05 L;  1K42 A;  2EXI A;  3WAT A;  1Y9G A;  4DXT A;  3I2J A;  2C4X A;  4JX0 A;  4LQR A;  3AC0 A;  4UDJ A;  3OM5 A;  3CZU A;  3UGG A;  3MBW A;  2VJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...