3C7FA

Crystal structure of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis in complex with xylotriose.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
487
structure length
487
Chain Sequence
ATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endo-1,4-beta-xylanase
publication title Structural analysis of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase in complex with xylotetraose reveals a different binding mechanism compared with other members of the same family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 135
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c7fA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3c7fA02
4N4BA 2VZSA 2J1VA 1TVGA 3OM2A 3P2NA 3OBAA 3HNYM 3WN2A 2QQIA 1DP0A 4KI5M 2WO2A 3WPVA 3VD7A 1EUTA 1LNSA 3LIGA 5LA0A 2YFRA 4A42A 3UESA 3GM8A 1Y9MA 4KMIA 3UGGA 3LIHA 4DEQA 1JU3A 1Y9GA 5FLWA 1UY3A 2QQOA 2WN2A 3OEAA 1JZ2A 2YFUA 3WF2A 4JKKA 3SKJE 3LFIA 5FMCA 3NRUA 4ONZA 3R4ZA 4AK5A 5AYDA 4AG4A 5HPOA 2WDBA 4QDQA 1ULPA 1JHJA 3LPFA 1JZ8A 2Z4FA 4UAPA 4AAXA 4PVIA 4DUVA 2QQUA 4KCBA 3FN9A 2W94A 1OF4A 2ORZA 2Y6HA 3KSTA 3TAWA 4UDIA 1GUIA 5A8DA 3ABZA 2LW8A 3VSSA 3HNBM 4P00B 2ID4A 1W8OA 1PMHX 3OM7A 3D3AA 1GOGA 1UX7A 4EQVA 2LS6A 3BGAA 3MUZ1 5JXJA 2X8SA 3OGRA 3UGHA 4ZZ5A 4M4PA 3SEPA 3ACIA 2VMDA 4OMCA 1PT2A 3R4YA 4CVUA 1JYVA 1VKDA 2VZ1A 3T0AA 3EYPA 1XNAA 3IAPA 1O8SA 1K3IA 5FK8A 4JX0A 1H6XA 2YG0A 4U6DA 3ACFA 2VZPA 3IB3A 4O8PA 3ZM8A 5GLPA 1K42A 2AC1A 3AKHA 4FFGA 3LEKA 4MO3M 2VC9A 5FIXA 4LPLA 3VT0A 2ZEYA 5GLRA 4PQQA 2QQKA 5F7UA 4XUOA 5GLLA 5GLNA 1WCQA 4KC8A 4AK6A 4XUTA 5A8CA 4E8DA 1UY2A 3C7FA 3WPUA 2WUHA 3NJVA 4QPWA 5B4NA 2Y6JA 3SKVA 5CZKA 2OKXA 3WPZA 3T09A 1SDDB 3LV4A 3I2JA 3ECQA 3FL7A 3MBWA 1XNTA 3WNKA 1UMIA 3HEIA 2AEZA 1CZTA 4RYDA 4CU9A 1IQDC 2EXIA 4UDKA 2QQJA 4FFIA 3WF0A 3FHAA 1UY1A 3WF1A 4A41A 3SC7X 2W1WA 2V4VA 1KGYA 3WATA 4IUGA 5A7VB 4RN5A 1F4HA 5EIYB 2OXBA 2JKXA 1EUUA 2C4XA 3OG2A 5JOXA 3VDCA 5JOZA 5LCWL 4OYUA 3K75B 4QDRA 2R7EB 2VQUA 2ZEXA 3JXSA 4DUWA 5GLOA 2XONA 2VZTA 4ARYA 3WF3A 3DYPA 3U14A 3ZXLA 5ANNA 5GLMA 2WO3A 4QX2A 5C71A 1YIFA 4OMDA 2YC2A 5JXGA 2VZRA 4E8CA 3VD5A 2QQNA 2X8FA 2VMCA 2QQLA 4W50A 2B4KA 5JMOA 3WAUA 1JZ7A 2E31A 1YQ2A 3W5NA 4AK7A 1UXXX 2W5FA 3BN6A 4N1IA 3T2OA 3SEEA 4BK4A 2RJ2A 2Y8KA 3I2HA 4COTA 4JHZA 2B9VA 1O59A 4ZY9A 2C26A 4O8NA 1XC6A 3D61A 2EICA 1CZVA 4UDGA 5EJZB 3CU9A 2VZ3A 1GOFA 3WN0A 1PX4A 4PVAA 5FUIA 5JUVA 3BYNA 2J22A 2XQRA 3HNMA 4QX1A 5G04L 1W18A 2X8TA 5AYCA 2ADEA 1NKGA 3VT2A 1L7RA 2YFSA 3PUIA 2BBAA 3MV01 2BZDA 2ORXA 1CX1A 5FK7A 3P1IA 2XOMA 2W91A 4HG6B 2X05A 2VR4A 3T0BA 3BYJA 4U6BA 1YRZA 1WKYA 3J7HA 4DXTA 1PMJX 4QQSA 3ACGA 1W8NA 3PIJA 4DUXA 1UZ0A 3LDRA 4TXWA 3MUY1 4CUBA 1UYZA 5IFTA 5C0PA 2YB7A 4KCAA 1OH4A 2J1UA 4QAWA 2JD9A 3GGLA 3K4AA 4XVHA 5JOWA 2W1UA 2X10A 4FI9A 2W46A 2W47A 5GLKA 3FHQA 2J1AA 1Y7BA 3KF3A 1UYPA 3LQCA 1HN1A 2EIDA 4JKMA 3CZUA 4QB1A 5EJ1B 2DCKA 5JXHA 4PF1A 2C9KA 5B6TA 4ARXA 4BK5A 2XQXA 4LHSA 2WBKA 3I3DA 1JZ6A 2VZVA 4KC7A 5DN2A 5IFPA 5IHRA 3K77A 3OM5A 3OGSA 3QZ4A 4DXRA 3MV11 2E32A 4MADA 3F2ZA 1JU4A 4N2RA 2EIEA 3P6BA 3A21A 1D7PM 3I2KA 1W9WA 2Y6GA 2VZOA 3THDA 3LDKA 4NOVA 3ACHA 3I97A 2Y6LA 3BYLA 1W99A 3I3BA 3OB8A 3LE0A 5J1XA 4DEVA 2VMFA 1RYYA 1UYYA 4A3ZA 4BDVB 5HXMA 3QC2A 3LEMA 3K4DA 3THCA 3NJXA 3WMZA 4UOJA 5IYYA 2DCJA 1GOHA 3QEEA 1T2XA 2QQVA 4OZOA 5AYEA 2BGOA 2L9LA 5FKCA 4DXSA 3C8XA 2VTFA 4QB6A 4M4RA 4P5YA 2J1RA 3C7EA 5IJRA 3T0DA 3E1F1 2EXHA 4XUPA 5C70A 4N2ZA 3GDBA 2W87A 1YI7A 5FKBA 5C7GA 3OM4A 1UMHA 3CQOA 1K45A 1GNYA 4GZ9A 1UV4A 1GYDB 2V5DA 3WQBA 2RV9A 3CMGA 5A7VA 2DDUA 1J83A 4FFFA 3KF5A 3WN1A 3LF7A 3OEBA 4UI9L 2CDPA 1K12A 3W5MA 2J1SA 3DYOA 3PUHA 5DQ0A 2JDAA 4QX0A 4FFHA 4LKSA 1W9TA 3WNLA 4A44A 4L0PA 4A45A 3WNPA 2VL4A 3C7OA 3BYKA 3K4ZA 2VZUA 2W9XA 3NNGA 5AY9A 5GLQA 5FMDA 3UETA 4P02B 3HJRA 5LA1A 3AKIA 1I5PA 1NX9A 3AC0A 4O8OA 1DLCA 1DYOA 1SHWB 4KMQA 1L7QA 4TTGA 1ULOA 2KD7A 2W1QA 1Y4WA 1JI6A 3IIIA 4CU6A 3IAQA 3VSFA 1OD3A 2EIBA 1WL7A 1KEXA 3DECA 1US2A 4W4ZA 4XUNA 3U37A 5I0DA 3D5ZA 3ETPA 3U75A 4PT6A 2VCBA 4ZXEA 1MPXA 3VDAA 2B4WA 1J84A 1JYNA 1W2TA 3T08A 3LPGA 3QEDA 2E33A 2WO1A 2WZEA 2W92A 1UYXA 4LQRA 3VD3A 4ZZ8A 2JE8A 4MLGA 2W1SA 1JZ5A 4UDJA 3MO4A 2WABA 3WASA 4MOAA 5LA2A 2ZEZA 1UY0A 1GU3A 3DYMA 3HPNA 2BERA 4MGQA 4GWJA 2J7MA 2VMEA 2ADDA 3OGVA 5CYYA 1OT5A 2PQSA 3CDZB 4XURA 2WAOA 3EB7A 5DPNA 1JZ3A 1OYGA 1SG3A 2ZEWA 4MGSA 5JXIA 2VQTA 3AKFA 4CU7A 5JOYA 5B4XA 3VDBA 3GXUA 2J1EA 4GWIA 2QQWA 4A4AA 2YFTA 3VSRA 4JKLA 2WQ8A 2E26A 2VO5A 2WYSA 3CKHA 2QQMA 2VDTA 2J1TA 3WMYA 3ZXJA 3VSZA 2WN3A 3HN3A 2VM9A 1JYWA 1UWWA 2W3JA 3T2PA 2ZXQA 4UDKE 2WAAA 2AEYA 3LEIA 2RVAA 1F4AA 4QX3A 1NAEA 3A23A 1UXZA 1JZ4A 1GYEB 4OUEA 1OF3A 2HYXA 4XUQA 3PIGA 3C7HA 1GQPA 3D5YA 3WSOA 3LEGA 2VJXA 5JR2A 2YFZA 1P8JA 3AKGA 2W95A 2Y64A 3CIHA 3VT1A 3UNPA 1ST8A 3HOBA 3D60A 3WNMA 3T2QA 2V72A 4QB2A 1W0NA 5G05L 1NUKA 2Y6KA 3A7QA 2EXJA 4BJ0A 2VOTA 5B6SA 3OM6A 3WEZA 2YC4A 2HLEA 2X09A 1XPWA 5FMBA 3I3EA 3UGFA 1H6YA 4YPJA 1PX3A 4BXSV 1UY4A 2VCAA 3I2GA 3A22A 5DMYA 3VD4A 3C7GA 2VCCA 3WNNA 4CUAA 2WZ8A 3K46A 4CUCA 3C2UA 1JYXA 3WNOA 4W8JA 3R67A 4QDSA 4A6OA 3WF4A 2EXKA 3WPYA 2BGPA 3ZXKA 3NQHA 1GYHA 4Z2AA 2CDOA 1GMMA 5A1AA 4KWUA 4D8MA 4ET7A 3RWKX 1TG7A 3K1UA 1BHGA 2VZQA 1CZSA 1R64A 3QEFA 1W9SA 4P08A 2QBXA 3VD9A 4D47A 1US3A 3I2IA 3I2FA 3IDAA 4D0QA 2XHNA 1O8PA 4XZUG 4CU8A 1CIYA 3CZJA
chains in the Genus database with same CATH superfamily
1ZBE1 3PJYA 3INAA 1ALYA 1W2UA 3O0WA 1MVEA 3P2NA 3OBAA 1COV3 1NA1A 5FZ0A 3VBUC 2GP5A 2QQIA 1X7NA 4NROA 5FP4A 3VBHB 5KC5A 3M2MA 2JG8C 2BEOA 4RR3A 5FBZA 3BB6A 1X36A 2GZWA 3VHPA 1ND2C 4BQ1A 2P6HA 3GNEA 1VRH1 1HXS3 1QIQA 5LA0A 3GM8A 1KITA 1ZA7A 2D3SA 1Y9GA 1JU3A 4P9XA 4GH4A 3ZSKA 2YFUA 5BNPA 1V6NA 4JV4A 4NUBA 4F8AA 5FMCA 5A3TA 3FLPA 1AL0G 3I3MA 4COWA 2QKDA 1V70A 2JDHA 2JG9B 1R1ZA 4Y22A 3ZDVA 3U78A 5FY4A 3VBFA 3HR9A 3JD71 1W8WA 1D4VB 4N43B 3N9PA 1DYKA 5CEHA 2PHTA 4IGQA 3M8LA 1WMDA 4IV3C 5FPVA 2A70A 1H9WA 4EN9B 4KCBA 2OS2A 5FYYA 2Q8OA 3W21A 2YY1A 1JW6A 3TAWA 4BISA 4EYUA 3E5QA 3KVBA 3J7MA 3TEXA 5A8DA 3MLKA 1NE4A 2CGOA 2XUMA 3NV4A 4KG0A 2WQZC 5FZFA 5K9YA 1B09A 5FQ0A 2F17A 1Q8VA 1PMHX 1FX5A 4QT6A 2BDRA 1RUJ2 1GOGA 1UX7A 3D3AA 1PVC1 5C3PA 2YGLA 4QGNA 1MEC3 4M4PA 1TMF2 2BNOA 2E51A 3DL3A 2K9ZA 1AR72 3GZEA 4FQ4A 3KT4A 4L97A 3S7EA 1JYVA 4BQYA 1QOTA 3EYPA 1FOD1 1XNAA 1AR92 3MW4A 4B4QA 2E63A 3RYRA 1K3IA 4N53B 1PGL1 4ASKA 2MEV1 2JDZA 1V9U1 3IB3A 4K6BA 1UZYA 2P34A 1OFNA 3AKHA 1ZZ9A 4ONUA 4Q0SA 3VN4A 1FXZA 4FO9A 1XYNA 2JECA 3V56A 5I0TA 3N9OA 4LPLA 5FIXA 3RGBA 3S5QA 4LOSA 1ZZBA 4UFJA 3RQ0A 4JRAA 4O65A 1BK0A 1PGW1 1UD1A 2QQKA 5F7UA 1GQGA 4CCDA 3PTYA 3FUOA 3KGLA 4QPYA 1YC61 1K5MC 1PO23 3NKGA 4XUTA 1POV0 5DG2A 4E8DA 3C7FA 3MGUA 3WPUA 1QDOA 4QPIB 1NZIA 5A7PA 2ZZQA 3AP9A 3NJVA 2C24A 3PUSA 4JDMA 4QPWA 4R9BA 2GNTA 3POBA 2WRAA 5CZKA 2XJVA 2OKXA 4LJHA 5EJ3A 1HQNA 1QJU1 3IT8A 5L7OC 3ECQA 3MBWA 1CX4A 4YGDA 5F1RA 1XNTA 1UMIA 3HEIA 4NAOA 3WX5A 1CZTA 2A6ZA 4RYDA 5L9RA 4Y1VA 4YGEA 5FPXA 2TUNA 2XHKA 4GMP0 3RZKA 1RHI2 2I07B 5D8AB 2MEV3 4FTBA 4FPLA 3WF0A 1AJOA 4AZZA 4YARA 2GNBA 4A41A 2KA3A 2Y0IA 2W1WA 2VW0A 4L9BA 2V4VA 3V0AB 4JC1A 2K46A 2OXBA 2OT7A 2JKXA 4DZGA 1V6IA 3SXWA 3O14A 4Q4W1 4DMIA 4XTMA 3CJIA 4XHBA 4YG6A 4NRMA 4UBGA 4EROA 5JOZA 5K0UB 3B5LB 4BCUA 3K75B 3J7LA 2R7EB 1BXHA 4XMAA 5GLOA 1KDMA 2RS13 4LK7A 4XOGA 4ZS2A 3WF3A 2HYKA 3U14A 3JQWA 1RJ7A 1UZZA 3TBDA 4NHYA 1UIKA 5D2AA 2DUOA 5JXGA 3NO8A 1DCSA 2YBPA 1VB4A 4PIZA 4XCBA 3ZPYA 5JSRA 1DG6A 2ZGMA 2ZMLA 1DQ2A 1YWKA 5A1FA 2X8FA 2Y33A 3THTA 3SLIA 1JS9A 1HRI1 1VMJA 1W39A 2ZAAA 1BQPA 4W50A 4IXLA 3M3OA 3AP5A 4HN1A 5KHIA 4LKFA 4MH0E 3NNLA 4WVMA 5F3IA 3KCCA 2RJ2A 2RJLA 3SEEA 5I0RA 1EAH1 3BKZA 4XHXA 3APBA 4O8NA 3ZN6B 2EICA 4CDUA 1Q8PA 2O8OA 5APAA 2XH6A 5EJZB 2BQPA 5C8WA 4GULA 3CL1A 3FBMA 3WN0A 2WNVC 2ZS6B 3QCWA 5CKQA 4X6QB 5JUVA 4XQDA 1L3JA 3VBUA 2X8TA 1VBD2 2JDPA 1AR61 1O6UA 2WT1A 3T4HB 5LEJA 1LOCA 2VBBA 2FDGA 4KWKA 2ADEA 2JG8A 5M0TA 3VT2A 4PHZA 1OURA 2YFSA 1AZDA 1SFYA 1MZ5A 1W9FA 1AL23 3S7IA 4WVVA 1DZRA 3DEMA 3IZOA 5GZGA 5FJKA 3MV01 4HSJA 2UY8A 4ARXA 2BZDA 4C91A 1W28A 1CX1A 5LEKA 1ASJ2 2ET7A 2ZGPA 4BLJA 3B93A 1PK6C 1HRI3 3SCGA 4U6BA 5FYIA 4ZU5A 2PXJA 1YRZA 4CZSA 2HBUA 3CO2A 2BV4A 3J7HA 1CGPA 2XJSA 2ETEA 3BOPA 3QH6A 2AGSA 5FLIA 1QNWA 5GZFA 2HWF1 3SH5A 5BPXA 5FZ1A 1UZ0A 2CU5A 2HWC2 2UYBA 1DGRN 4Q0PA 4ASLA 4NVPA 2E7TA 4AFAA 1UYZA 4A3XA 2QZ2A 4IESA 5E6HA 1S0BA 1YJLA 1OH4A 2KM2A 3ZKUA 1G9BA 4IV3A 5GZEA 2JD4A 5FOBB 4HONA 1G9AA 5FMOL 2W46A 1AR63 1DZQA 4ITCA 4MXWA 3USSA 4YZ5A 4AVBA 1J3RA 1LR5A 1Y7BA 3OOXA 3LQCA 1HN1A 4Q27A 3R05A 3TOJA 4OQ9A 5JXHA 5B6TA 3UKNA 1BMV2 2HJIA 2OPWA 1QGLA 3PUAA 2B8MA 4QQLA 4KC7A 4EWDA 1ULDA 3D0JA 1GP4A 3HQXA 3ZIXA 3QZ4A 2XJRA 4DXRA 1W6NB 2E32A 3MV11 4FXGB 4RD7A 3BALA 1AYN2 3F2ZA 2R0FA 1RUD1 2WS92 5I8SA 2EIEA 1KS4A 3P6BA 3KT1A 3A21A 1D7PM 1IQAA 1W9WA 4URTA 3FC0A 4K3UA 1LESA 3H1WA 3I97A 2B39A 5DUXA 2ZBJA 3BYLA 5BNQA 4KU7A 1CAVB 5EHDA 1DGWX 4L11A 5FJHA 4A3ZA 4BDVB 5HI0A 4AVCA 5HXMA 5C3RA 2VVFA 1JOJA 3GZUC 4Z1VA 3UKTA 4N90A 1GBGA 5KWRA 4BZ4A 3THCA 3NJXA 3FFQA 4YW6A 1UL9A 4FPGA 4E2QA 2DYCA 2WKKA 1C8M2 4XF0A 4O61A 5GLTA 1SCSA 3QBQA 1PO11 2PA7A 1TE1B 1T2XA 2QQVA 4OZOA 1W05A 5FZHA 5IT6A 3JU9A 3C8XA 2WNOA 5I91A 3ZYJB 3T0DA 4CEWB 1ZRRA 2EXHA 4NWWA 3LKJA 1QJX2 4N2ZA 4R9DA 5DAXA 1RINA 5L19A 5L7OA 4LBQB 2W87A 1HJGA 4NE9A 4XAEA 5F3EA 5FKBA 1HQLA 4CPBA 1GANA 4OVEA 1GNYA 2WNUB 4JHTA 2V5DA 3CMGA 2ZHMA 4EZHA 1DDLA 3NVCA 3N4MA 2DDUA 3N3HA 4FFFA 4I3PA 3T1MA 3O1PA 4CCNA 4EZ4A 3WN1A 4P9IA 2DU0A 2V09A 3LF7A 5A33B 2Q8DA 1GSLA 1DBNA 3ZOIA 5H9QA 5I8TA 3LFMA 1V6KA 3KCYA 3KLSA 4Q4X3 1S0CA 3FWEA 4FFHA 4DNYA 1WCDJ 3QACA 2Q5TA 4TZDA 3ZIWA 2P37A 1YEWA 4AHZA 4N7UA 5A3LA 3ORJA 1URXA 3VBSC 2GMEA 2RS33 2VZUA 3ZYBA 2W9XA 5FXXA 4COZA 5AY9A 1QQP3 5FY7A 3JUUA 5FZAA 3SCFA 3E5UA 4P02B 2OQ7A 1GWLA 4GALA 3UETA 2QJVA 5LA1A 3MIHA 1I5PA 4RQPC 4AK3A 2HEVF 2B9UA 2V73A 1WZXA 2A7AA 3O0XA 4XTPA 2FHRA 2BTVC 2OQ6A 2JDKA 5BNNA 3TEYA 4MVTA 1DYOA 2ZX4A 4F83A 4L2NA 2HWD1 1F5JA 1L7QA 3WDXA 4DY5A 5A3UA 5ABJC 4DINB 1MQTB 4TTGA 1RUG2 4GKXA 2MNGA 1GZTA 3FBYA 1SPPB 2PLV3 5FTTC 5FY0A 3WCSA 5T54A 5ISLA 5FLJA 1JTZX 4E2GA 3POGA 4S2GA 3MIEA 1KEXA 4W4ZA 2ZAHA 3S6PA 4XUNA 1QF3A 3U37A 4Q0UA 5I0DA 2YV8A 1OOPB 3MF9A 3D5ZA 3BOWA 5DAWA 3PNAA 4NIIA 3K51A 3AJYA 1SZBA 5C5UA 1IKPA 2UWAA 5FZLA 2WO1A 2ATFA 3ROUA 1PGSA 4AI9A 1W6QB 1CN1A 1G8WA 1B35C 2Q1ZB 2F4LA 2CWMA 2OUHA 3H1MA 1ZBA2 4Q4V3 3SHRA 3MO4A 4H7LA 2FQPA 4J1XA 1N1VA 1NYWA 3VBOB 4AEMA 4DFSA 2WNVA 5C4WB 2FZ2A 3ZVXA 4UW3A 1KRIA 4MOAA 1O3SA 1AUYA 1WCUA 4PJYA 5FZGA 1MS8A 4M3CA 3DPRC 4MGQA 4HETA 2J7MA 2HH9A 3M1HA 1XSRA 4I2OA 2R16A 5CYYA 1UU6A 4IEWA 2FMDA 4FPHA 3CDZB 1CAUB 3EB7A 1HX6A 1QOOA 2BFUS 4Y33A 5J96B 1SG3A 3FFZA 1EV11 1PK6A 3IDBB 1VMHA 5LRRA 1RVF2 5F5AA 1RUJ1 1PIV3 1QJZA 1ZVFA 3ZN5A 1PVC2 1CAWA 3DKQA 4XFIA 3V65A 1IS4A 2JENA 1LODA 1TMF1 2QQWA 2XJPA 3AJZA 3M7AA 4Y1YA 3RWNA 4B8EA 2YPJA 4ZXKA 4JKLA 3V0BA 3B3QE 3NV1A 2WYSA 3ZXJA 3HWJA 1CD3G 1AR91 1FOD2 2J1TA 5T5JA 1VBE2 4JQRA 1PGL2 5EYYA 2R043 5K7PA 1JYWA 1UWWA 3I3QA 3T2PA 4UDKE 5D1IA 1XNBA 1C1LA 3WP5A 3WDWA 1SFPA 3LEIA 4UW6A 5FXZA 4AI8A 1D4M2 2RVAA 1MS0A 4XF9A 2QQPA 1F4AA 3MYXA 4FOYA 3A23A 1BBT2 1MS4A 1JZ4A 1GYEB 4CYDA 1PGW2 5JSOA 3ZN4A 4XUQA 2XJTA 3C7HA 4JVAA 4LHNA 1GQPA 1X8MA 3VBRC 5DG1A 2VJXA 3I59B 5FYCA 3SH3A 2EA7A 2ZGUA 4I0WB 2VCMA 4XBLA 1P8JA 1IOAA 1DHKB 1REDA 1VRBA 3THPA 3AKGA 4C0HA 3VT1A 1GV9A 3NKTA 1ST8A 1AR73 3D60A 3WNMA 3I2OA 4JGYB 3T2QA 1XYOA 2C9AA 2V72A 4W6YA 1LECA 2A6XA 1KFUL 4QB2A 2DTYA 3X29B 3POFA 4Y5Z0 1OXCA 2EXJA 4IEXA 2VOTA 3TNPB 3VKFC 3WDYA 4BJ0A 1RHI1 5B6SA 2Y60A 2YC4A 1QJFA 3EQEA 3FLRA 1BEV1 1GICA 4Q0QA 5BY5A 3VKLA 3BCWA 2JDUA 3I3EA 1GQHA 5T55A 4YM3A 1BVP1 1V6JA 3HQUA 4Y26A 1SACA 3ZYIB 4XIOA 3RYKA 4YPJA 5CG9A 1PX3A 4XJAA 1UY4A 3A22A 4H7MA 1PVXA 3C7GA 4MV2A 2VMGA 2WFF2 2WA4A 2ZGLA 1VAVA 1E57A 2IXHA 3PMSA 4XBQA 1JYXA 3J4UH 4W8JA 1OSGA 2FMYA 4QDSA 4LO5B 3WVJA 1ZRIA 1SFNA 4WM7B 1MR5A 2WQ4A 3WF4A 1QXJA 1A34A 2FDJA 2E53A 3Q8CA 2NMNA 4COYA 1IS3A 5EFUA 4YW2A 5A70A 3ZXKA 3NAPA 4Y4YA 1G86A 4ZKTB 4FTSA 5A1AA 4BU2A 1DQ1A 5CFDB 1R083 2ARXA 2G4IA 4I02A 5F39A 2Y26A 4IE6A 4RS5C 5HV0A 1BHGA 2D98A 1W6OB 5KHGA 1DGWA 4KGGA 4P9GA 4Y20B 4DRRA 1VBC1 2VOKA 3A0KA 4XXPA 4FQZA 4FPJA 4CDXB 5JIUA 3I2FA 3ELNA 1RUF2 4D0QA 2XHNA 1ODNA 2DBNA 2VAUA 1U5XA 4QHOA 1XXNA 4AI1A 1UIJA 1R091 4YVWC 4AEKA 2G19A 4AI0A 2VZSA 2PHWA 4QQPA 5IK4A 1TVGA 3VBSA 3HNYM 3WN2A 4BQWA 1DP0A 1MS5A 5E89A 3O0VA 3B9IA 1SLBA 2N7GA 3WPVA 2VOVA 1F5FA 2VULA 4PQ9A 4RQPA 4XFHA 2XDVA 3SISA 2IVJA 2HWE2 2B45X 4YGCA 1UKRA 5K4LA 3UGGA 2YHJA 2ZHKA 4A42A 2BPA2 3AXDA 4NPRA 5FLWA 1JOBA 1GZWB 2JG9C 2VMHA 3RJ2X 1RJ8A 2X8KA 5ABJA 4DY3A 4JKKA 2WJSA 4XILA 4E4HA 1ULGA 3DN7A 1W6MB 2WNEA 3KQRA 1ASJ1 4YG0A 3ZFGC 1LENA 3KGZA 3U4XA 4NAMA 4AK5A 1S2BA 4CRQA 5AYDA 1J3QA 3H9AA 1ZZ7A 4NHMA 3OY8A 4LIVA 2VXJA 3LPFA 2W39A 4FOVA 3LOIA 2HWF2 1X9TA 1F31A 3TWIA 5GZCA 2JE7A 1B35A 3FN9A 4HFSA 2Y6HA 4KBZA 2BNNA 1GWKA 1H2KA 2XGXA 3J9SA 4G3YC 4UDIA 1RUE2 4HKLA 1KJRA 3UT0A 3ABZA 2ZGOA 1QH7A 3FMGA 4K40A 3O1TA 3DPRA 3ZMNA 4BQ2A 4P00B 4IE5A 3MPPG 3WG2A 1VBD3 3UV9A 4PDWB 4A7YA 3OM7A 3KVAA 2YROA 3D6EA 3BGAA 2D93A 2X8SA 3MFCA 1V0AA 2DV9A 1FV2A 4YVSB 3UGHA 4AF9A 4ZZ5A 1O3QA 4FP2A 4XF3A 3LA2A 3TN92 2E7QA 1V6MA 3R4YA 3AVSA 5BNOC 1BMV1 3DKWA 4HK8A 4M3CF 2UYAA 3JCIA 4IEVA 1QEXA 1MS9A 1O8SA 1OPMA 3ST7A 2ZGTA 5FK8A 4JX0A 3F95A 2YG0A 4A7KA 5GLPA 5IVFA 2XWBB 4Q4Y1 1K42A 3LSEA 1DFQA 1CWPA 4D6RA 3OD0A 2WS91 1RUD2 5DDJ2 4XJ9A 2EAAA 4LA3A 2HWC3 3AL6A 3HT1A 1A6CA 2VC9A 2EF6A 1FNYA 2ZOEB 3TEWA 1W90A 2ZEYA 1I5ZA 4PQQA 5EYXA 5FZ9A 1TEIA 2C1FA 5GLVA 3P3NA 3W20A 2JB4A 2JE9A 4IEUA 5GLLA 5GLNA 3ZPOA 4KC8A 3ZFEC 5A8CA 2W08A 2VG9A 3H3LA 2IXIA 3N9MA 1NCRB 2WUHA 1QU0A 3GHMA 5B4NA 1C8M1 2R30A 5KHKA 4XW3A 3T09A 2JJ6A 4B3NA 3I2JA 1HW5A 2KR2A 5FP9A 3WV6A 4RA0A 5DZEA 4FPFA 4OZXA 3VBRA 5J09A 5CU1A 2NP0A 1S0FA 4CU9A 5BV6A 1A78A 4URAA 1IQDC 4XF4A 3ENRA 4BH9A 3L2HA 4ZHNA 4PBPA 1QJX1 3OJBA 2QQJA 2A6VA 2Q4SA 3U0ZA 5C9AA 1RXGA 4PIYA 3K3NA 3WF1A 2JIJA 3URFA 1AYN3 2PMWB 2ZZJA 1KGYA 1ULEA 4IUGA 5T3NA 1W3XA 3ZYRA 4FPKA 2A6YA 5JDBA 3I49A 4ZU4A 5FZEA 4H55A 1FPN2 4COUA 1U5ZA 1Z7S2 3OG2A 4EN7B 4C8DA 1N3OA 2X29A 4QGMA 3V64A 1QOSA 1O7FA 4G9SB 4D3WA 4CEYC 5GLWA 1S4CA 2VQUA 2G9ZA 2ZEXA 4C1XA 1WGPA 3ZSJA 1RUNA 3ZXLA 2O8QA 5LWBA 3KT7A 2P3KA 4K21A 4EN8B 1C8M3 1YIFA 5C71A 3FJSA 1DLLA 2Q30A 4BQXA 1OLQA 1WWYA 4Q29A 4K8FA 4XJ8A 4BHPA 1YFXA 3ES1A 4E8CA 2TEPA 3VD5A 4Q8LA 1VB2A 3RS6A 3QLQA 2AENA 4XXAA 2JKBA 3NNMA 2B4KA 1QJX3 2G9FA 5JMOA 4AHXA 3WLUA 4AGRA 2JDMA 1ODMA 1YQ2A 1LGNA 2VBDA 4N7IA 4AK7A 4C0BA 4QHBA 2HWD2 4RS5A 2Y8KA 1RUG1 2WWJA 2BBVA 1ZRFA 4ZY9A 2C26A 3MIGA 4IW3A 1XC6A 3D61A 2DU1A 4K8RB 4KBBA 3ILNA 3KQ4B 1H8VA 2CNAA 3B69A 4RR3B 2NN8A 5LASA 1W8TA 1DQ4A 2BJSA 3CU9A 4BA6A 1RUC2 1RUH2 1XNKA 1ZZ6A 4YVWA 3WW1A 4PVAA 3BYNA 2OA2A 2VVDA 3HNMA 4QX1A 5G04L 5LA9A 4LBLA 3VHNA 5FR3A 1FMD2 5HCHA 1EPWA 5AYCA 2FCTA 3N7MA 4CDQB 3RZGA 1ZBA1 1L7RA 2D5HA 4TWTA 2P5BA 4AI2A 4AFBA 4YG3A 3NJYA 4Y3OA 5EQUA 2R1BA 1WBLA 3R4SA 1TME1 5EV7A 1ZBE3 5L9VA 3UL2A 2VR4A 4Y22B 3T0BA 2JG9A 3DF0A 1JYTA 4GQ7A 4Q2FA 4ZS3A 4QU1A 3C3VA 1GYKA 1PMJX 4QQSA 2JB8A 3ACGA 4N43A 1W8NA 3ZFGA 3AZWA 1NXD1 1EV12 1VRH3 2ZPXA 1HB3A 3LDRA 4JTNA 4DOUA 1RVF1 2GN3A 2P1BA 3BPSA 2UURA 3MUY1 4YFZA 3RG0A 3MW2A 5CVRA 4D6SA 4MSVA 4KGQA 3TAYA 2J1UA 1VBA2 1PZ7A 2JD9A 4QAWA 5DZGA 3GGLA 5FWEA 2GC3A 3EMRA 3POSA 2X10A 1HV0A 2JDNA 1VBE1 5GLKA 3Q8AA 3PHMA 4YW3A 1UYPA 3JD73 4QM8A 2EIDA 4JKMA 4X8PA 4QB1A 1HRV2 1PMIA 1YQCA 5EJ1B 3T4VA 2PAMA 2YUEA 4PF1A 2XQXA 1D4M1 1JUIA 4LHSA 2WBKA 4MGIE 1UO9A 3KCXA 5KXBA 1JZ6A 5DN2A 1XB9A 1BBT1 4MYEA 3K77A 2OPKA 1G9CA 3OM5A 3JB4C 1QJY2 1HB2A 3AMQA 5HCAA 4MADA 4JZRA 4UFHA 4ZPIA 2ZX3A 5BNOA 1ENRA 4UXAA 2YMZA 2GN7A 4YW5A 2GNDA 2Y6GA 2VZOA 2WT0A 2HWB1 4NOVA 3ACHA 4QPGC 1G9DA 3WUCA 2FDHA 1O91A 1PVC3 3GBWA 4CCMA 1DYPA 1FNZA 3RZHA 1RYYA 1UYYA 2VNOA 1W04A 4AQSA 1AX0A 4CP9A 1APNA 4ES8A 1Q8QA 3FX3A 5JIAA 4QPIA 3N7LA 1FOD3 2RMU1 5FZ4A 3MIFA 4XIKA 2DCJA 4CEWC 4FP3A 4MLOA 1BEV2 1S0GA 1I6XA 1V9U3 2CL2A 4P14A 3UK9A 3WY6A 4LO8A 3I8TA 5FKCA 3ZFEA 5JAXA 5F37A 2JEMA 4HSLA 2VTFA 2LTNA 1CQ9A 3AKPA 4M4RA 4NN0A 3WXPA 3C7EA 1ULCA 3A0NA 4XAAA 1NT0A 1XE7A 3WG1A 4BIOA 1BBT3 2WFF1 2Z79A 4TLFA 4LBMA 2XJUA 1I9RA 3KWVA 1UMHA 4AEDB 4BM8A 1MACA 3CQOA 5C7GA 3GJAA 3OUJA 4I01A 4IQPA 3MICA 3CF6E 5I0UA 2GNMA 2RV9A 3HD8B 4GXLA 4KNCA 3V0AA 3ZFFC 2AZ5A 5JWPA 3KF5A 1CR7A 2OVUA 5FO8B 1BJQA 4DIQA 5AC92 2CDPA 1K12A 1QJU3 3WCRA 4DS0A 3GCXA 2YGMA 3DYOA 4LBOA 4NR1A 3PUHA 5BNNC 2ZABA 3K48A 1UPSA 2VNVA 4QX0A 2ZX2A 4CXYA 4RFRB 4QXBA 4PI2A 1W9TA 4R9AA 1AXYA 4L0PA 2XB6C 4NHXA 3WNPA 3C7OA 3K2OA 5ANQA 4CEYA 2W2IA 3OBZA 3BYKA 1VBC2 3NNGA 4E4SA 1RUF1 3TRSB 3EO6A 2I45A 4CDWB 4OHYA 5FLHA 3W58A 5GLQA 5E8AA 4LO7A 5CB7A 3W59A 2ZHLA 3WQ0A 1NX9A 1R092 3AC0A 1VR3A 4JTOA 4MGYE 4YW1A 1DLCA 1UPIA 4LT5A 4Q4W3 5CIRA 4IERA 3H7JA 3PVNA 1NQJA 2Q1MA 3TYJA 2E7AA 1FI2A 2FZ1A 2RR12 1IHMA 3L9JT 1LHUA 2I2SA 1ULOA 1Y4WA 1VE0A 2KD7A 1JI6A 2HWE1 3IIIA 3IPVA 1W0OA 2XBO2 3IAQA 4CU6A 2X5IB 3O1UA 1KFXL 3ZN6A 1XE8A 4CDUB 1VJ2A 1Z78A 3ASIA 3DECA 3KZ4C 4NHLA 3ETPA 1DQ5A 4PT6A 4P9WA 3VBOC 3VDAA 3POWA 1W2TA 2H0VA 4B4PA 5C4WC 3NV2A 2B4WA 3VBUB 1PM4A 2OX0A 3LPGA 2WZEA 1WW7A 2PHDA 2W92A 3Q9OA 1C5HA 1UYXA 1S0EA 2QFEA 3VD3A 2P3IA 2D44A 2JE8A 4ZU7A 1JZ5A 4HK9A 2P3YA 1ND2B 4YNIA 4LBQD 2IFWA 3VDDC 3WASA 4HKOA 4LKDA 3S5AA 1RC6A 2LM3A 3OYWB 1AYM2 5FBJA 5H9RA 1EAH3 3ZLIA 4E4ZA 4QX5A 5ACA1 4YZ2A 4CCCA 2ZKNA 4Q5OA 3NW4A 1ACCA 4E9KA 1OLMA 3SMHA 2B7YA 3OD4A 3ZXFA 4LLFA 4XURA 1WCKA 1RUE1 3M4FA 1JZ3A 2Y34A 2ZJCA 1UU4A 2XVKA 3AMHA 4XZPA 5A1LA 1X9PA 1C28A 1NLRA 2R072 2YPDA 4NPLA 2VQTA 5DUVA 5FZKA 4C90A 5F3CA 5JOYA 5B4XA 5I93A 1T6GC 3NSTA 2YBSA 1YFYA 2VPVA 3GXUA 1FV3A 1GLHA 4GWIA 5FZIA 2VNGA 3TN91 4AAPA 2GC0A 4A4AA 3MEPA 1WCSA 2WQ8A 2E26A 4LIUA 4Y5SA 4TYSA 4NIHA 1HB4A 2VOXA 5CNAA 2XPJA 3GCWA 5JSPA 2LALA 2J42A 5B2GB 2WN3A 4NIGA 3HIFA 3KMHA 3VUOA 2W3JA 5IK5A 5IK8A 4Q4Y2 4HPKB 2Q0AA 2HWF3 2AEYA 5DDJ1 1C1FA 1UNBA 1IGOA 2A3YA 1XRUA 4AFCA 1IPJA 2YU2A 2LUWA 3U4SA 1E5SA 1E5RA 4WM8C 2VD7A 1RL3A 1N1YA 2WYFA 1UXZA 4A6SA 4OI0A 4LR4A 2BYVE 3RZMA 1DU3D 3WHTA 2HYXA 4OHXA 3PIGA 1S2KA 3ETQA 2KXLA 4NWVA 5FZ6A 5GLUA 3FHIB 2CAVA 5EP9A 1VP6A 4XDQA 4JGYC 3LEGA 3HN1A 2DFCA 5JCTA 5JR2A 4MZUA 1NCQC 1SLTA 2A75A 2TBVA 4OHZA 1S55A 5JLVA 5FPBA 3BIEA 5FZ7A 3P5BA 3CIHA 3MIBA 4V1PA 3CJXA 4LUKA 3MI8A 3O1VA 3TN93 4YM0A 4YWAA 1XNCA 3WG4A 3POJA 2EIGA 1W0NA 4QPGA 1HQWA 3MFAA 3AZYA 2Y6KA 3RRDA 5C2MA 4J6GA 3ZYGA 3WEZA 4LK6A 2HLEA 2X09A 4QXCA 1XPWA 4CCKA 4R4ZA 3NAPC 1K5MB 3O1SA 2O14A 4YW4A 1IZ3A 3UGFA 1RUD3 4WM7C 1RUOA 1U12A 4ISRA 4BXSV 3I2GA 1QJEA 2QNKA 4CEWA 4PLNA 1FPN1 5CFCB 1Z7S1 1S0JA 2WZ8A 4OULA 5L7OB 1GR3A 3C2UA 3WNOA 3R67A 1O3TA 4LBQA 1TNRA 1V6LA 4RGKA 5FO7B 4YZ1A 4K7JA 1YQ8A 2WIIB 2EVXA 5LBBA 2Y6FA 4F7ZA 3MDPA 4RGAA 5FDBA 3OGJA 1HV1A 3VB9A 4QQHA 5FZBA 4MG2A 3WPYA 2BGPA 3BU0A 4D7YA 3HBKA 1H8TB 1PO13 3AXEA 2CDOA 3GZTB 3N9QA 1GMMA 3LZZA 3Q8FA 2BW8A 2Y0OA 4KWUA 4U2AA 3KV6A 5F3GA 3KD4A 2WL1A 4JCKA 1TG7A 3AM2A 4WVZA 4CDXC 1SMVA 5CA6A 3HQRA 3K1UA 5KC6A 3ZFFA 2VZQA 4HL0A 3VZNA 2QCSB 4CP2A 1W9SA 1HJFA 3AX4A 3ZYHA 1N1TA 3VKNA 3DCQA 3FLTA 1F35A 1QXPA 1SEFA 2PHXA 1OI6A 2IZWA 3IDAA 3ILFA 5IK7A 2P6CA 2GAUA 1O8PA 1QWRA 1XE0A 4UW4A 3ZR5A 1CIYA 1I1EA 4N4BA 3AYDA 5FFOC 1DIWA 3OM2A 4XJZA 1M06G 4N8MA 1SBFA 4B1MA 1RUI1 1LHVA 2BNMA 2DURA 2D5FA 3G7DA 2XL9A 4KWLA 5IATA 5LBEA 2DBIA 3VD7A 1RUC1 1EUTA 1PZ8A 1RUH1 3DGTA 3FE5A 5IVJA 4PF5A 5F6KA 4CCOA 2YFRA 1SPPA 3UESA 4AL9A 2WZR2 3LIHA 4GWMA 1FMD1 4EWEA 1UY3A 1NY71 2WN2A 3OEAA 3WD5A 1JZ2A 4AE2A 4OQ8A 5I8YA 1RIRA 4LHKA 4Q0VA 1LTEA 3LFIA 3WF2A 4FOWA 1W2NA 5H9SA 1CJPA 1GKBA 1TME2 3NRUA 3Q8EA 1S2EA 4QQ2A 3WR0A 4ONZA 3KV5A 5E88A 4AG4A 3ZXDA 2UY9A 1EYBA 5A7WA 2WDBA 2WNVB 3D8CA 4QDQA 2HWD3 2VECA 3VBOA 2JICA 2DFBA 5C4WA 4B1LA 1JZ8A 3CU7A 2JWPA 1VBB1 2PHUA 4UT5A 2FDFA 4FPCA 4QQOA 1QNYA 4DUVA 1LHNA 3O1MA 4CCEA 3N35A 5FWJA 3AFKA 1D0HA 1OF4A 2ORZA 1Q43A 2W94A 4YSFA 3KSTA 5F8PA 2AR6A 4PDWC 3VDDA 3IDEA 1GUIA 1VBA1 3GALA 1DQ6A 5DAPA 4Z8BA 3CNAA 1W03A 1PK6B 2XKOA 3VSSA 5F2WA 4F3JA 3VHRA 2CWSA 1Q5OA 2ID4A 1AX2A 4FPEA 1POQA 3WDUA 2NZ9A 2VNRA 4EQVA 1U5YA 5FP8A 5JXJA 3ZMOA 1LOBA 3SEPA 2DF7A 4AEJA 1HRV1 3ACIA 4MHRA 2A6WA 2VMDA 2WA3A 5C6CA 5C8CC 2E9QA 1PT2A 4OI1A 5LK5A 3V0BB 2XL7A 2YC0A 2P2KA 5D21A 2RM22 4KL1A 3O1RA 1BYHA 2VZ1A 3T0AA 3BTYA 3IAPA 2JXAA 4BWOA 3PU8A 5FYMA 4Y4RA 5FYHA 3RDIA 1EPZA 1RTVA 1H6XA 4LBJA 4MGKE 1CESA 3ZSEA 1QJY1 2VZPA 2EAKA 4FAGA 4U6DA 3LAGA 3OTFA 2R32A 2XMLA 4LBNA 2QE3A 4LO6B 1EV13 2DVFA 4JGZB 2XLGA 5EWSA 2HWB2 3KHCA 1W6PA 2SLIA 1RUJ3 3VT0A 5GLRA 1NCRC 1M4WA 4J25A 1UN1A 1TMF3 5C9AC 2ENRA 1WCQA 4AK6A 1UY2A 4WM8A 1AR93 1KDKA 2NMOA 2XWJB 1ZZCA 2RMU2 2Y6JA 3UKVA 2DVDA 3E6DA 5JI7A 5BXXA 1S0DA 4LE4A 1SDDB 2XXZA 1HRV3 1UOBA 1UOGA 2AREA 5FUPA 1QXRA 2AEZA 1C4RA 2RS12 4JGYA 5A6YA 5FPUA 1NCQA 3KSCA 2G1MA 2Q8EA 5JPMB 4E2SA 2EXIA 3PTRB 1N3PA 1NOVA 5FY5A 1YFUA 4LXLA 1UY1A 3FHAA 3POYA 3PMEA 5GJ6A 5FUNA 3AYCA 4K1YA 3U07A 3TB0A 1REEA 5A7VB 4WZFA 1F4HA 1LULA 1EUUA 4EN6B 3E5XA 3MZHA 1WD4A 5F6LB 5JOXA 5LATA 3VDCA 4V2WA 1H1IA 2NM1A 5AC91 4OYUA 4OUSA 4QDRA 4D6QA 2V5YA 2VVEA 4WM7A 4AWDA 2VZTA 3AZZA 3DYPA 1LRHA 2A1XA 3FZ3A 2D6OX 3LGRA 1WLCA 3M3EA 2WO3A 3QH7A 1A8DA 1HKDA 5JZGB 4QX2A 4GIQA 3H3UA 5CBLA 1RHI3 5FP7A 1OUXA 1BEV3 2AYHA 4QMAA 2VZRA 3VBHC 4Y24A 2FCVA 2V4AA 2QVSB 5A80A 1ZRCA 4N9IA 1YHFA 2IXJA 4NIAA 4Y1XA 2IXCA 2IUWA 3D0SA 4LA2A 3WAUA 1JZ7A 1W6OA 3R0RA 4OI4A 2E31A 4M3CE 2BP6A 3AVRA 3AKSA 3VL9A 3W5NA 4CDXA 1UXXX 3BTAA 2BOJA 3BN6A 4N1IA 2RR11 4COTA 1R1A2 4H3WA 2XG3A 5A3OA 3RZLA 4AYUA 3JBG2 1DZTA 2XBO1 4QKNA 5IAXA 3IDCB 1XU2A 1XQNA 2F6BA 4O9GA 4RFT0 4IGPA 1SLIA 3BVCA 4CDQC 1GOFA 4EV0A 4RQPB 1IG0A 1CVNA 4YFWA 1MS1A 2D6PA 4NPMA 4N43C 5FUIA 2R062 2J22A 1RMU1 1LGBA 1W8FA 2XQRA 3O7OA 1W18A 1WLTA 2GC2A 1JOPA 1VBC3 4BQ4A 1L7LA 4HMZA 4AHWA 1KQRA 1OQEA 2BBAA 2W52A 1UF2C 1AYM1 1YI9A 3LA3A 1FATA 2ORXA 4LLOA 1R093 1XU1A 2XOMA 2NYYA 1OFSA 5ACA2 3BYJA 3MPBA 2MHFA 1LOFC 5HV4A 3MLLA 1K5JA 1WKYA 3ZXAC 1NQDA 2X53S 5K8SA 1OVSA 2I74A 1WLWA 1U5IA 1VIWB 4XYXA 2RDNA 2P4EA 1MZ6A 3PIJA 1ULFA 3LD8A 2NQYA 4LUMA 4NMIA 4TXWA 2R071 1H4HA 3M70A 3AL5A 4XABA 1T6BX 1H2LA 5IFTA 2YB7A 5KHJA 4KCAA 4N53C 4QKFA 2BOIA 2XJQA 3BODA 4XVHA 3VHOA 1PNGA 3DPRB 5JOWA 2W1UA 1ASJ3 1W06A 3RMXA 2JX9A 4FI9A 4Q1PA 4UF0B 4D94A 3GJBA 1QHDA 1Y9QA 4PDWA 3FHQA 2J1AA 1UCXA 3KF3A 5CAZA 3O1OA 2PAKA 3CZUA 4YVSA 3TEZA 4I30A 2DCKA 4EJRA 2C9KA 3WHUA 4QKBA 4BK5A 1RB8G 1WMFA 4UFLA 2Y38A 2ARAA 3R4DB 4I09A 1UZVA 1ZYBA 1HN0A 4W6WA 4DPNA 4BMEA 4QPIC 5FZ8A 3ITQA 4IV1B 4JAAA 4ES9A 5C8CA 5A32A 2YDEA 1OBNA 1WW6A 1CAXA 3G6JB 3OSDA 5EZWA 3E6CC 2A3XA 1JBCA 3ZYFA 4J1WA 1JU4A 4HVRA 1DGLA 1NXMA 3H1YA 4S2FA 3W5MA 1ZRDA 1WMXA 3LDKA 5FZOA 3THDA 1O5LA 3I3BA 3USUA 2GMPA 1OKQA 3OB8A 3ZR6A 4DEVA 2B42B 1X50A 2VMFA 3L2YA 5FXWA 1X82A 1D2QA 5F5QA 5D8AC 2VBPA 5L9BA 2CSGA 1BCXA 2RS52 1V00A 3AKQA 1Z0HA 1NCRA 4LO4B 4OCTA 1NE6A 4RHV1 3PUQA 1GOHA 2D97A 1POV1 3OBRA 2ERFA 1LEMA 3PDQA 5C3SA 5K0UC 3CBNA 4Q4Y3 2BGOA 3VBRB 5AYEA 3ON7A 3B01A 2WS93 1JYCA 1GZ9A 4Q4X2 4DXSA 4QB6A 4P5YA 2PQQA 4XEZA 1O4TA 5IJRA 1W9YA 1AR81 2DUPA 2Z5WA 1ND3B 4JRLA 4UBHA 5GLZA 1REFA 5C70A 3GYDA 2RS32 3S57A 5FMOS 5JVVA 4XBNA 3RZJA 1GP5A 1K45A 1WA4A 4GZ9A 2AUYA 2EALA 2VUAA 4GMP1 5DZFA 5GKAC 4CCLA 2VMIA 2G9GA 1W8ZA 4MGTA 1GYDB 5FAXA 1J58A 3NJZA 1J83A 2PN5A 2D43A 1COV1 2W0XA 2ZACA 5A3WA 2GMMA 2OW4A 1LGCA 2ZGKA 1YJKA 5AFBA 1HXS1 3EXUA 1JXNA 2PLV2 1W2AX 2ZMNA 4LKSA 1GNHA 2C6SA 3MF6A 3WNLA 4A44A 4AFDA 3SQOA 4UWDA 3RFRA 1OLRA 3W9AA 2WSUA 3KV4A 3B94A 1QDCA 3K4ZA 4IEQA 5HBAA 2Z42A 5IW0A 4QHZA 3AMNA 4XDOA 3N36A 3NMBA 4XETA 5FPLA 3HJRA 4JDNA 4CXXA 4QM9A 4R52A 3AKIA 1XSQA 3PU3A 3GBFA 4XDPA 1NA1B 1YXWA 2FD8A 4HOOA 2X5IC 3J8F2 4Q4V2 1IG3A 3VBHA 1ZM1A 1RUI2 3AMPA 4KMQA 4RS5B 1HDKA 1VALA 1PM7A 5A7NA 1AXZA 2AH2A 1NZCA 2W1QA 2WZR1 4QGLA 5FZMA 2PHRA 3JB8A 4GH4B 5F5IA 1WL7A 5FXVA 1NY72 1US2A 1LOEA 3JZVA 1LEDA 1H9PA 2WLPA 4P9YA 5BNPB 3U75A 4YVWB 5FYTA 1J84A 1JYNA 3PJQA 3ILRA 3T08A 3QEDA 5A7OA 2E33A 4SBVA 2RDQA 1PIV2 1YIPA 2XLFA 2IC1A 1OA4A 3VBFB 4ZZ8A 2D6KA 3J7NA 4YM1A 4CDQA 1LAJA 4UDJA 1MEC1 1G6NA 2WABA 2B46X 3JQXA 5LB6A 4XJWA 4AR2A 1PHMA 5F5CA 1VBB2 1RUG3 2ZEZA 1GNZA 1UY0A 1W8HA 2K2SA 4LITA 3WW2A 5FV3A 4GWJA 2VW1A 1PZ9A 2GALA 1ENQA 2VMEA 4HZFA 2R042 1FT9A 3H42B 5EXOA 1OT5A 1H4GA 2PQSA 3I4IA 5FOJB 5DPNA 3ZFGB 1AJKA 1LB2A 1QMJA 4HT1T 2ZEWA 5AVPA 4NRPA 1LOFA 1MS3A 2WZR3 5FQ0B 5JXIA 4Q1RA 2DVGA 4CSWA 4CU7A 3M3CA 3VDBA 2SBAA 3AYAA 1ZBA3 3T3YA 4EN0A 5IWFA 1PO21 1RITA 4BB3A 2YFTA 3SCHA 1TME3 3GF6A 2W68A 4CUGA 2RM21 3VSRA 2VO5A 1H30A 4TN7A 2QQMA 4BIFA 1H0BA 4L99A 4KH9A 4S2HA 1J3PA 4FT8A 3VSZA 2LROA 3H0OA 4AVAA 4HN0A 4N53A 3RZZA 2VM9A 4K20A 3VGIA 2P3JA 4CP1A 4COVA 3N7JA 4UFKA 2BWCA 4QX3A 1NAEA 1RVF3 2CAUA 3HAGA 2F4PA 1OF3A 5BNOB 2ZCWA 4FAHA 2D6MA 3WDTA 4FOQA 4IE0A 3D5YA 5SV5A 3NNFA 3B00A 5CADA 3WSOA 5DUUA 4HBNA 2YFZA 3MW3A 2DUQA 1OA3A 1VBE3 4M0NA 2DCZA 1Q8OA 4YLZA 2H6CA 4B7EA 4IE7A 3HOBA 3UNPA 1W0PA 4KU8A 3WT3A 2RS11 4CP9B 1S1AA 1IPSA 4AGGA 3H8UA 2RM23 3M3IA 1D4M3 3PURA 1UU5A 2WNUC 4P9JA 4Z92B 4CE8A 2VOWA 4AI3A 2R0HA 3UJQA 5CFCC 5D8AA 2QZ3A 2RDSA 4Q26A 5FZDA 3ZFEB 4NIDA 4AVVA 4WV8A 4LHLA 1R082 4YGBA 4A7ZA 5J3UA 1H6YA 1BK1A 1D0GA 3E6BA 3OPZA 4RGGA 4UFIA 2VCAA 1O4YA 1OC1A 2A73B 3BIWE 4NRQA 4TLGA 2HWB3 3WNNA 1KJLA 2GC1A 2VCCA 4CUAA 4V2VA 3CJIB 4CUCA 3RI9A 2VGDA 4PLOA 5K0UA 5DAVA 4EWAA 3D5OA 1FYUA 4AEDA 1E5HA 1LHWA 1VLNA 1H8TC 4A6OA 1SDWA 1JYIA 1UOFA 3PVBB 3EHKA 2C0ZA 4XMIA 1ZX5A 1CJDA 2WR9A 3AP6A 4UFMA 2OZ6A 5SV8A 2EXKA 3NV3A 2RMU3 2DCYA 3ZO0B 4LMFA 4M0HA 1H2MA 2H6BA 4CXWA 1OD5A 4UYBA 3WQ1A 4XACA 1OPOA 1BKZA 4P5HA 4O9EA 3UJOA 4BE3A 2IVIB 1Q56A 3RPQA 1MQTC 3P3PA 1R64A 2ARCA 2WWUA 4CEYB 5T5LA 4IEOA 5ERLA 4AW7A 2WFF3 5L36A 1WLDA 2VUCA 1US3A 4L92A 2HEWF 1AL21 4WVMB 4DO0A 4CDWA 1R1A1 1OOPC 1GZCA 3HBZA 3CZJA 3RWKX 5EPAA 3JBG1 4I3GA 4CA9A 5I0SA 2J1VA 2AACA 1SLAA 2IWGB 4GAZA 2YU1A 2LRPA 3AYEA 4KQ7A 4FSJA 3WG3A 2C5DA 2RDRA 4KI5M 4C1WA 2WO2A 2BGCA 5FY9A 1UW8A 1LNSA 3IPVB 3LIGA 3LSDA 3BTZA 3PL0A 2R061 2D3PA 1Y9MA 4UW5A 5IVBA 4KMIA 1Y43B 1RMU2 4FXKB 2X5IA 4DEQA 2UU8A 1ZA4A 2JG8B 2QQOA 5KXEA 4OLLA 1TNFA 1CPNA 4LBKA 4LULA 1X33A 3SKJE 1RUF3 2IXKA 3VLBB 1WUVA 3AMMA 3LDBA 1LCLA 3WW3A 3VL8A 4W65A 5C33A 2ARBA 4B7KA 1WD3A 5FZ3A 4WVWA 3R4ZA 2ES3A 2K0GA 5HPOA 3PVEA 1ULPA 1JHJA 1ND2A 3VZKA 4CPBD 3AFGA 3H3ZA 1R1A3 2Z4FA 3OYWA 5FYUA 4UAPA 4AAXA 5J36A 4INDA 2ET1A 2WO7A 4PVIA 3JBG3 2HWE3 2QQUA 1O3RA 5LBFA 3S0MA 1MVQA 2PHLA 3RYPA 4TSVA 2RG4A 4IEPA 2VUJA 2O0OA 2RHPA 5A7QA 1OQDA 1WMEA 2HKXA 4IV3B 1MZEA 4ATFA 2DVBA 4M01A 4GJZA 1DGRA 1JODA 2LW8A 2ZKLA 5LZ6A 3HNBM 2R1DA 2R063 3R4UA 1W8OA 2YYOA 3BPZA 4MXWB 3POEA 4IGOA 1ZREA 1ZZ8A 2ILMA 4GB32 4MGZE 2LS6A 4KG8A 3MUZ1 5LK7B 2BVBA 3OGRA 3RI8A 1LJ7A 3WP6A 5LY1A 1VAKA 4OMCA 3H8OA 4CVUA 3QOPA 3GBGA 4IDZA 4R8HA 1UOJA 1VKDA 4B29A 3BTXA 5DUWA 5ACA3 3RNSA 3BYWA 1CPMA 4JGZC 1GFF2 1TZOA 5BUVA 3ACFA 4O8PA 2JDYA 4IL7A 3ZM8A 5AFEA 2AC1A 1W6NA 1RUE3 4HPKA 3D4KA 4FFGA 3LEKA 1VMFA 4AHYA 2H0BA 4MO3M 5GALA 4PBOA 3PLQA 1IPKA 3ZKYA 3RSJA 1WW4A 3A4UA 1VPHA 3AP4A 2MPFA 5FYBA 4ATEA 1X8EA 1CAVA 4XUOA 3HVDA 3KHBA 3T1LA 3QC2A 4FPOB 3H50A 2RS51 1KD7A 3AKTA 2DCTA 3IKWA 2ZGNA 3SKVA 1F9KA 3WPZA 4RHV2 2NPIA 4QX7A 3LV4A 3FL7A 3NNJA 5LBCA 1OHFA 1TL2A 1C8NA 3WNKA 4Q4X1 1F8VA 4QPGB 1G7YA 2GP3A 3LA7A 1EP0A 4YZ3A 5DDJ3 5T5PA 4YZ4A 1AR82 1XNDA 2VY0A 2VW2A 2PYTA 3NWKA 4XFBA 4UDKA 5C3OA 2ZA9A 4XC9A 4FFIA 2RS31 1OMIA 4FVVA 1UQXA 1K5MA 1QQP1 3R6SA 1JUHA 4D8MA 3SC7X 4LOTA 4YRDA 1SBEA 2RE9A 4GA9A 3WATA 2WNUA 4RN5A 4XFAA 3OGGA 1LKNA 1C3HA 5CFDC 5EIYB 1A8MA 2VU9A 3ZXGA 2C4XA 5CFCA 1COV2 5JZGC 1IS6A 1DQ0A 2DTWA 2VQ0A 4XFFA 1SLLA 5LCWL 5DXDA 2XR4A 5A33A 1N1SA 2O1QA 3HT2A 3JXSA 4DUWA 1MZFA 4BQ3A 2XONA 3CHXA 2RS53 4ARYA 3OBTA 3MHZA 4ORFA 2PLV1 4PI0A 4AVSA 1HXS2 5ANNA 5GLMA 5AVAA 2WC2A 2ZMKA 3B02A 4Z2WA 4OMDA 2YC2A 4XJUA 5DAQA 2XVLA 4ZONA 1XOYA 1H8TA 1STMA 4R4XA 1S0IA 2OYZA 2VQAA 4K9SA 3ZFFB 1E5IA 2QQNA 3ZSLA 3LCPA 4DQAA 2OZJA 2VMCA 2QQLA 4LEJA 1FPN3 3ZYPA 1UX6A 1Z7S3 2WINB 5BNNB 3J8F1 4Q4V1 5FZCA 1D2SA 1N47A 3WP4A 2W5FA 1OLME 2QUOA 4NOTA 3T2OA 3I2HA 4BK4A 1OVPA 1O5UA 4JHZA 4CP0A 1MQTA 1H1MA 2B9VA 1O59A 4FPYA 1ZBE2 2D6NA 4YYOA 2CGPA 4Z07A 4RL7A 5HXVA 3KM5A 1CZVA 1IS5A 3LB9A 4UDGA 2VZ3A 3KB5A 2XVGA 1YCIA 1OOPA 1Q3EA 1RGSA 1YO8A 1AVBA 3AKRA 3N9NA 3VZLA 1PX4A 1J1LA 1VRH2 2CY6A 2QDNA 1LU2A 1SQ4A 1KXGA 4AXOA 3WW4A 3OUHA 1PIV1 4N9HA 4LTAA 5A7SA 1W6QA 2XKPA 1NKGA 1GP6A 1YLLA 4XFGA 2ZGSA 3I2DA 4I0AA 1GWMA 1MEC2 2QDRA 3D82A 3B9CA 3PUIA 2HEYF 5LW9A 2UWBA 2ZTNA 4MX3A 5FK7A 2NLRA 3P1IA 2JIGA 2W91A 4HG6B 4M3CB 2X05A 5A3PA 4GWNA 1YYNA 3ZXEA 5IAVA 1WA6X 3J8F3 3H7YA 4YW7A 5A7WB 5T50A 3JD72 2R041 1RUI3 4META 3TNQA 5FPZA 4OHVA 3RJRA 2FDIA 1XBFA 4H2AA 1RUC3 1RUH3 1CAUA 4OHWA 1LHOA 4SLIA 4YVSC 5T52A 4DUXA 4XF1A 3RMYA 1PNFA 5FREA 3N9LA 3WP3A 1BZWA 1FMD3 5C3QA 4CUBA 2D3RA 3VDDB 1CAWB 5KXCA 4D7TA 5C0PA 2BWAA 4S2DA 5L73A 2GH8A 3K4AA 4FBFA 1PO22 2CTVA 2ZX0A 3DV8A 3IM0A 3OPTA 4LORA 3BI3A 3E97A 2BRTA 2BUKA 2W47A 5FYZA 4QXHA 3OUIA 2WSVA 1AHSA 4MUVA 4KWJA 4AQTA 1YQ6A 1AR71 4IV1C 4NJ4A 4QD2A 1EY2A 3VZOA 1VBB3 3BU7A 4MHUA 1C57A 2HBTA 3DXUA 3KV9A 2Z69A 2GDFA 4G4FA 4OUMA 3I3DA 5A6ZA 2ZGQA 2VZVA 3DXTA 4HXCA 2R49A 4OI2A 2RJKA 5IFPA 5IHRA 5CKMA 1G9FA 4XE9A 2A3WA 3EBRA 3IMNA 2MEV2 3OGSA 1V9U2 4K1ZA 5TSWA 1VAMA 4OFGA 3IMMA 4PLMA 1VBA3 5IVVA 3RVHA 3MLJA 2VXRA 4N2RA 2VUDA 3I2KA 2GU9A 1W2OA 3ME2A 1IKQA 3QD6A 1W6PB 3I59A 4JGZA 2Y6LA 1FAYA 1W99A 2IXLA 3LE0A 2PAEA 5KBFA 1AX1A 5FRAA 5J1XA 3T30A 4DRVA 2PTMA 4DXTA 4WM8B 3LEMA 1UMZA 3I7DA 3K4DA 5A6XA 1Q8SA 5BYNA 4U36A 1XYPA 2BVVA 3ES4A 4UOJA 5IYYA 3WMZA 4IETA 4D69A 1HIXA 1WW5A 1ND3C 1J1TA 3IN9A 1QJY3 1QJU2 3OPWA 4WBBA 3QEEA 4XQ4A 1R081 2L9LA 3AK0A 3WINE 5KXDA 1NCQB 4NHKA 2J1RA 4HANA 3E1F1 2VTXA 3IIAA 3ATGA 2UWCA 4RSUA 5HCBA 1F2NA 2CV6A 4M00A 4XUPA 3CLPA 3SITA 3GDBA 4DXZA 1W3VA 1YI7A 5JMCA 3OM4A 2FBEA 3GZAA 1UV4A 1BVVA 5C5TA 3OCPA 1JMUB 1QKQA 3WQBA 5LRSA 5A7VA 2Z2SB 4LNVA 4IEYA 4XPVA 1JHNA 4A2UA 5IUQA 3NAPB 4Y1ZA 4Q4W2 5A6QA 5GM0A 3OEBA 4UI9L 1N3QA 5FYSA 2D6LX 3O5SA 1SBDA 2J1SA 5F2SA 2QTWB 3PVOA 1BLZA 2JDAA 4LE3A 1TQ5A 1V6OA 5DQ0A 5HCFA 5CFDA 1LOAA 4FTEA 1UKGA 4W6XA 5T5OA 5JZGA 4A45A 5A3NA 2VL4A 5FYVA 4BLIA 4XCAA 1NA1C 4Y20A 4BOWA 3POIA 2P17A 2DVAA 2D7FA 1AL22 5FMDA 4RR3C 1ONAA 3H8XA 3AZVA 2Q1FA 1OKOA 4O8OA 1HRI2 3VBSB 5J98B 5H9PA 3U1XA 4O7XA 4AGVA 4E27A 5AC93 1H1AA 1SHWB 4PCRA 4GH4C 2BU9A 3LOBA 4AVTA 3AB0A 5BNPC 1AXKA 2VTXJ 1EAH2 1ENSA 2A71A 4BPZA 2PELA 1HB1A 4X6RB 1OQ1A 2FCUA 1YFWA 2TNFA 3VSFA 1OD3A 4HVQA 2EIBA 3SNMA 4AQ2A 1GZWA 2A5ZA 5ABJB 4QWNA 3VBFC 4JDOA 3IBMA 5FP3A 2VCBA 2YZ4A 1AF9A 2ZX1A 4ZXEA 5F9TA 1J59A 3KS7A 1MPXA 2FDKA 4Q8KA 1SCRA 3CEWA 1W6MA 4I0BA 1CIWA 3WQ7A 1VBD1 1AR62 4LQRA 5CISA 2OUJA 4MLGA 2W1SA 3OY8B 3IWZA 3S30A 2RR13 5J7MA 4XQWA 4YM2A 5LA2A 4EE2A 2WT2A 1GU3A 1XJAA 3ALQA 3DYMA 3VZMA 3HPNA 2BERA 2XBO3 1B35B 2CGNA 3B7MA 1JN2P 5JR7B 2ADDA 1YUDA 3OGVA 3I54A 1OUSA 1SLCA 4QU2A 1UAIA 2WAOA 5JI9A 3ZSMA 3LWCA 3WDVA 3ZX7A 1OYGA 2HWC1 4MGSA 1RMU3 4P9LA 5F32A 3AKFA 1YQ5A 2PFWA 4E4DX 5FY8A 1OA2A 4GB31 3SH4A 4MXVA 4ASMB 3WNXA 2J1EA 1JH5A 4BYYA 2CYFA 4HLTA 1I3HA 4GJYA 2YXSA 3GHNA 4HKWA 1AYM3 4B4RA 1LU1A 4WZCA 1A3KA 5CKNA 3CKHA 2VDTA 3WMYA 4UF0A 1Y3TA 2PHFA 4H14A 1LOGA 3MIDA 3AP7A 4AOCA 4CTEA 3HN3A 3NL1A 4QKDA 5KR7A 2ZXQA 1NLSA 2WAAA 2WLQA 2ZGRA 4FCAA 3Q8BA 3WOGA 3J26N 2VH9A 2R073 4CCJA 1OH3A 1CONA 5C8CB 2WWSA 4IV1A 2WFPA 4OUEA 1CAXB 3HMYA 5DABA 4JQTA 5A32B 1QH6A 3K3OA 1AYN1 3ZDSA 2GSYA 5E16A 5FY1A 4QX8A 5FZOB 4AFMA 4BMBA 3USUB 4GB33 3FUQA 2W95A 2Y64A 2ZHNA 4XFCA 5GZDA 4Z82A 3VKOA 5FCCA 1NG0A 4ISQA 2WZPP 2DWRA 5JPNB 1HLCA 2OIIA 4AEDC 5G05L 1NUKA 3OF1A 1U0AA 4Y5TA 5IVCA 2IFRA 2GH2A 3A7QA 3U10A 2CHHA 3AZXA 3U11A 3OM6A 2D40A 5LY2A 1C5IA 5C9AB 2YBKA 3WUDA 1PO12 3CJIC 5FMBA 1O4ZA 1QQP2 1F15A 2XLAA 3DUIA 4GD4A 4BQ5A 4X8NA 2E6VA 2VE1A 1NLQA 5DMYA 4IEZA 3VD4A 1ND3A 3K46A 3ACLA 3N7KA 5FO9B 3UYJA 4L8QA 5FPAA 5J48A 3O12A 5A3MA 3H8RA 3T2TA 5J37A 2Q8CA 4QXKA 4CDWC 4NO4A 4BXFA 4IE4A 1H2NA 1YNAA 3VKMA 3NQHA 1ENXA 1KS5A 4RHV3 1QY4A 4D7SA 2BFUL 4LKEA 3EJKA 5CG8A 1POV3 3BUCA 1GYHA 4Z2AA 4HVOA 5IVYA 4Y1UA 4ET7A 3VZJA 1WBFA 1DF0A 2R6QA 2B5HA 4R9CA 5KHHA 1AR83 1CZSA 5IVEA 3QEFA 4PIXA 4P08A 2QBXA 4AQ6A 3WZ1A 1W8UA 4DB5A 3VD9A 1UZWA 2XUEA 4D47A 3I2IA 4CDUC 4GKYA 1RXFA 5E1RA 1ZNPA 4XZUG 3M3QA 4CU8A 3VV1A 4GMP3
chains in the Genus database with same CATH topology
4N4BA 2VZSA 2J1VA 1TVGA 3OM2A 3P2NA 3OBAA 3HNYM 3WN2A 2QQIA 1DP0A 4KI5M 2WO2A 3WPVA 3VD7A 1EUTA 1LNSA 3LIGA 5LA0A 2YFRA 4A42A 3UESA 3GM8A 1Y9MA 4KMIA 3UGGA 3LIHA 4DEQA 1JU3A 1Y9GA 5FLWA 1UY3A 2QQOA 2WN2A 3OEAA 1JZ2A 2YFUA 3WF2A 4JKKA 3SKJE 3LFIA 5FMCA 3NRUA 4ONZA 3R4ZA 4AK5A 5AYDA 4AG4A 5HPOA 2WDBA 4QDQA 1ULPA 1JHJA 3LPFA 1JZ8A 2Z4FA 4UAPA 4AAXA 4PVIA 4DUVA 2QQUA 4KCBA 3FN9A 2W94A 1OF4A 2ORZA 2Y6HA 3KSTA 3TAWA 4UDIA 1GUIA 5A8DA 3ABZA 2LW8A 3VSSA 3HNBM 4P00B 2ID4A 1W8OA 1PMHX 3OM7A 3D3AA 1GOGA 1UX7A 4EQVA 2LS6A 3BGAA 3MUZ1 5JXJA 2X8SA 3OGRA 3UGHA 4ZZ5A 4M4PA 3SEPA 3ACIA 2VMDA 4OMCA 1PT2A 3R4YA 4CVUA 1JYVA 1VKDA 2VZ1A 3T0AA 3EYPA 1XNAA 3IAPA 1O8SA 1K3IA 5FK8A 4JX0A 1H6XA 2YG0A 4U6DA 3ACFA 2VZPA 3IB3A 4O8PA 3ZM8A 5GLPA 1K42A 2AC1A 3AKHA 4FFGA 3LEKA 4MO3M 2VC9A 5FIXA 4LPLA 3VT0A 2ZEYA 5GLRA 4PQQA 2QQKA 5F7UA 4XUOA 5GLLA 5GLNA 1WCQA 4KC8A 4AK6A 4XUTA 5A8CA 4E8DA 1UY2A 3C7FA 3WPUA 2WUHA 3NJVA 4QPWA 5B4NA 2Y6JA 3SKVA 5CZKA 2OKXA 3WPZA 3T09A 1SDDB 3LV4A 3I2JA 3ECQA 3FL7A 3MBWA 1XNTA 3WNKA 1UMIA 3HEIA 2AEZA 1CZTA 4RYDA 4CU9A 1IQDC 2EXIA 4UDKA 2QQJA 4FFIA 3WF0A 3FHAA 1UY1A 3WF1A 4A41A 3SC7X 2W1WA 2V4VA 1KGYA 3WATA 4IUGA 5A7VB 4RN5A 1F4HA 5EIYB 2OXBA 2JKXA 1EUUA 2C4XA 3OG2A 5JOXA 3VDCA 5JOZA 5LCWL 4OYUA 3K75B 4QDRA 2R7EB 2VQUA 2ZEXA 3JXSA 4DUWA 5GLOA 2XONA 2VZTA 4ARYA 3WF3A 3DYPA 3U14A 3ZXLA 5ANNA 5GLMA 2WO3A 4QX2A 5C71A 1YIFA 4OMDA 2YC2A 5JXGA 2VZRA 4E8CA 3VD5A 2QQNA 2X8FA 2VMCA 2QQLA 4W50A 2B4KA 5JMOA 3WAUA 1JZ7A 2E31A 1YQ2A 3W5NA 4AK7A 1UXXX 2W5FA 3BN6A 4N1IA 3T2OA 3SEEA 4BK4A 2RJ2A 2Y8KA 3I2HA 4COTA 4JHZA 2B9VA 1O59A 4ZY9A 2C26A 4O8NA 1XC6A 3D61A 2EICA 1CZVA 4UDGA 5EJZB 3CU9A 2VZ3A 1GOFA 3WN0A 1PX4A 4PVAA 5FUIA 5JUVA 3BYNA 2J22A 2XQRA 3HNMA 4QX1A 5G04L 1W18A 2X8TA 5AYCA 2ADEA 1NKGA 3VT2A 1L7RA 2YFSA 3PUIA 2BBAA 3MV01 2BZDA 2ORXA 1CX1A 5FK7A 3P1IA 2XOMA 2W91A 4HG6B 2X05A 2VR4A 3T0BA 3BYJA 4U6BA 1YRZA 1WKYA 3J7HA 4DXTA 1PMJX 4QQSA 3ACGA 1W8NA 3PIJA 4DUXA 1UZ0A 3LDRA 4TXWA 3MUY1 4CUBA 1UYZA 5IFTA 5C0PA 2YB7A 4KCAA 1OH4A 2J1UA 4QAWA 2JD9A 3GGLA 3K4AA 4XVHA 5JOWA 2W1UA 2X10A 4FI9A 2W46A 2W47A 5GLKA 3FHQA 2J1AA 1Y7BA 3KF3A 1UYPA 3LQCA 1HN1A 2EIDA 4JKMA 3CZUA 4QB1A 5EJ1B 2DCKA 5JXHA 4PF1A 2C9KA 5B6TA 4ARXA 4BK5A 2XQXA 4LHSA 2WBKA 3I3DA 1JZ6A 2VZVA 4KC7A 5DN2A 5IFPA 5IHRA 3K77A 3OM5A 3OGSA 3QZ4A 4DXRA 3MV11 2E32A 4MADA 3F2ZA 1JU4A 4N2RA 2EIEA 3P6BA 3A21A 1D7PM 3I2KA 1W9WA 2Y6GA 2VZOA 3THDA 3LDKA 4NOVA 3ACHA 3I97A 2Y6LA 3BYLA 1W99A 3I3BA 3OB8A 3LE0A 5J1XA 4DEVA 2VMFA 1RYYA 1UYYA 4A3ZA 4BDVB 5HXMA 3QC2A 3LEMA 3K4DA 3THCA 3NJXA 3WMZA 4UOJA 5IYYA 2DCJA 1GOHA 3QEEA 1T2XA 2QQVA 4OZOA 5AYEA 2BGOA 2L9LA 5FKCA 4DXSA 3C8XA 2VTFA 4QB6A 4M4RA 4P5YA 2J1RA 3C7EA 5IJRA 3T0DA 3E1F1 2EXHA 4XUPA 5C70A 4N2ZA 3GDBA 2W87A 1YI7A 5FKBA 5C7GA 3OM4A 1UMHA 3CQOA 1K45A 1GNYA 4GZ9A 1UV4A 1GYDB 2V5DA 3WQBA 2RV9A 3CMGA 5A7VA 2DDUA 1J83A 4FFFA 3KF5A 3WN1A 3LF7A 3OEBA 4UI9L 2CDPA 1K12A 3W5MA 2J1SA 3DYOA 3PUHA 5DQ0A 2JDAA 4QX0A 4FFHA 4LKSA 1W9TA 3WNLA 4A44A 4L0PA 4A45A 3WNPA 2VL4A 3C7OA 3BYKA 3K4ZA 2VZUA 2W9XA 3NNGA 5AY9A 5GLQA 5FMDA 3UETA 4P02B 3HJRA 5LA1A 3AKIA 1I5PA 1NX9A 3AC0A 4O8OA 1DLCA 1DYOA 1SHWB 4KMQA 1L7QA 4TTGA 1ULOA 2KD7A 2W1QA 1Y4WA 1JI6A 3IIIA 4CU6A 3IAQA 3VSFA 1OD3A 2EIBA 1WL7A 1KEXA 3DECA 1US2A 4W4ZA 4XUNA 3U37A 5I0DA 3D5ZA 3ETPA 3U75A 4PT6A 2VCBA 4ZXEA 1MPXA 3VDAA 2B4WA 1J84A 1JYNA 1W2TA 3T08A 3LPGA 3QEDA 2E33A 2WO1A 2WZEA 2W92A 1UYXA 4LQRA 3VD3A 4ZZ8A 2JE8A 4MLGA 2W1SA 1JZ5A 4UDJA 3MO4A 2WABA 3WASA 4MOAA 5LA2A 2ZEZA 1UY0A 1GU3A 3DYMA 3HPNA 2BERA 4MGQA 4GWJA 2J7MA 2VMEA 2ADDA 3OGVA 5CYYA 1OT5A 2PQSA 3CDZB 4XURA 2WAOA 3EB7A 5DPNA 1JZ3A 1OYGA 1SG3A 2ZEWA 4MGSA 5JXIA 2VQTA 3AKFA 4CU7A 5JOYA 5B4XA 3VDBA 3GXUA 2J1EA 4GWIA 2QQWA 4A4AA 2YFTA 3VSRA 4JKLA 2WQ8A 2E26A 2VO5A 2WYSA 3CKHA 2QQMA 2VDTA 2J1TA 3WMYA 3ZXJA 3VSZA 2WN3A 3HN3A 2VM9A 1JYWA 1UWWA 2W3JA 3T2PA 2ZXQA 4UDKE 2WAAA 2AEYA 3LEIA 2RVAA 1F4AA 4QX3A 1NAEA 3A23A 1UXZA 1JZ4A 1GYEB 4OUEA 1OF3A 2HYXA 4XUQA 3PIGA 3C7HA 1GQPA 3D5YA 3WSOA 3LEGA 2VJXA 5JR2A 2YFZA 1P8JA 3AKGA 2W95A 2Y64A 3CIHA 3VT1A 3UNPA 1ST8A 3HOBA 3D60A 3WNMA 3T2QA 2V72A 4QB2A 1W0NA 5G05L 1NUKA 2Y6KA 3A7QA 2EXJA 4BJ0A 2VOTA 5B6SA 3OM6A 3WEZA 2YC4A 2HLEA 2X09A 1XPWA 5FMBA 3I3EA 3UGFA 1H6YA 4YPJA 1PX3A 4BXSV 1UY4A 2VCAA 3I2GA 3A22A 5DMYA 3VD4A 3C7GA 2VCCA 3WNNA 4CUAA 2WZ8A 3K46A 4CUCA 3C2UA 1JYXA 3WNOA 4W8JA 3R67A 4QDSA 4A6OA 3WF4A 2EXKA 3WPYA 2BGPA 3ZXKA 3NQHA 1GYHA 4Z2AA 2CDOA 1GMMA 5A1AA 4KWUA 4D8MA 4ET7A 3RWKX 1TG7A 3K1UA 1BHGA 2VZQA 1CZSA 1R64A 3QEFA 1W9SA 4P08A 2QBXA 3VD9A 4D47A 1US3A 3I2IA 3I2FA 3IDAA 4D0QA 2XHNA 1O8PA 4XZUG 4CU8A 1CIYA 3CZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4B A;  2VZS A;  2J1V A;  1TVG A;  3OM2 A;  3P2N A;  3OBA A;  3HNY M;  3WN2 A;  2QQI A;  1DP0 A;  4KI5 M;  2WO2 A;  3WPV A;  3VD7 A;  1EUT A;  1LNS A;  3LIG A;  5LA0 A;  2YFR A;  4A42 A;  3UES A;  3GM8 A;  1Y9M A;  4KMI A;  3UGG A;  3LIH A;  4DEQ A;  1JU3 A;  1Y9G A;  5FLW A;  1UY3 A;  2QQO A;  2WN2 A;  3OEA A;  1JZ2 A;  2YFU A;  3WF2 A;  4JKK A;  3SKJ E;  3LFI A;  5FMC A;  3NRU A;  4ONZ A;  3R4Z A;  4AK5 A;  5AYD A;  4AG4 A;  5HPO A;  2WDB A;  4QDQ A;  1ULP A;  1JHJ A;  3LPF A;  1JZ8 A;  2Z4F A;  4UAP A;  4AAX A;  4PVI A;  4DUV A;  2QQU A;  4KCB A;  3FN9 A;  2W94 A;  1OF4 A;  2ORZ A;  2Y6H A;  3KST A;  3TAW A;  4UDI A;  1GUI A;  5A8D A;  3ABZ A;  2LW8 A;  3VSS A;  3HNB M;  4P00 B;  2ID4 A;  1W8O A;  1PMH X;  3OM7 A;  3D3A A;  1GOG A;  1UX7 A;  4EQV A;  2LS6 A;  3BGA A;  3MUZ 1;  5JXJ A;  2X8S A;  3OGR A;  3UGH A;  4ZZ5 A;  4M4P A;  3SEP A;  3ACI A;  2VMD A;  4OMC A;  1PT2 A;  3R4Y A;  4CVU A;  1JYV A;  1VKD A;  2VZ1 A;  3T0A A;  3EYP A;  1XNA A;  3IAP A;  1O8S A;  1K3I A;  5FK8 A;  4JX0 A;  1H6X A;  2YG0 A;  4U6D A;  3ACF A;  2VZP A;  3IB3 A;  4O8P A;  3ZM8 A;  5GLP A;  1K42 A;  2AC1 A;  3AKH A;  4FFG A;  3LEK A;  4MO3 M;  2VC9 A;  5FIX A;  4LPL A;  3VT0 A;  2ZEY A;  5GLR A;  4PQQ A;  2QQK A;  5F7U A;  4XUO A;  5GLL A;  5GLN A;  1WCQ A;  4KC8 A;  4AK6 A;  4XUT A;  5A8C A;  4E8D A;  1UY2 A;  3C7F A;  3WPU A;  2WUH A;  3NJV A;  4QPW A;  5B4N A;  2Y6J A;  3SKV A;  5CZK A;  2OKX A;  3WPZ A;  3T09 A;  1SDD B;  3LV4 A;  3I2J A;  3ECQ A;  3FL7 A;  3MBW A;  1XNT A;  3WNK A;  1UMI A;  3HEI A;  2AEZ A;  1CZT A;  4RYD A;  4CU9 A;  1IQD C;  2EXI A;  4UDK A;  2QQJ A;  4FFI A;  3WF0 A;  3FHA A;  1UY1 A;  3WF1 A;  4A41 A;  3SC7 X;  2W1W A;  2V4V A;  1KGY A;  3WAT A;  4IUG A;  5A7V B;  4RN5 A;  1F4H A;  5EIY B;  2OXB A;  2JKX A;  1EUU A;  2C4X A;  3OG2 A;  5JOX A;  3VDC A;  5JOZ A;  5LCW L;  4OYU A;  3K75 B;  4QDR A;  2R7E B;  2VQU A;  2ZEX A;  3JXS A;  4DUW A;  5GLO A;  2XON A;  2VZT A;  4ARY A;  3WF3 A;  3DYP A;  3U14 A;  3ZXL A;  5ANN A;  5GLM A;  2WO3 A;  4QX2 A;  5C71 A;  1YIF A;  4OMD A;  2YC2 A;  5JXG A;  2VZR A;  4E8C A;  3VD5 A;  2QQN A;  2X8F A;  2VMC A;  2QQL A;  4W50 A;  2B4K A;  5JMO A;  3WAU A;  1JZ7 A;  2E31 A;  1YQ2 A;  3W5N A;  4AK7 A;  1UXX X;  2W5F A;  3BN6 A;  4N1I A;  3T2O A;  3SEE A;  4BK4 A;  2RJ2 A;  2Y8K A;  3I2H A;  4COT A;  4JHZ A;  2B9V A;  1O59 A;  4ZY9 A;  2C26 A;  4O8N A;  1XC6 A;  3D61 A;  2EIC A;  1CZV A;  4UDG A;  5EJZ B;  3CU9 A;  2VZ3 A;  1GOF A;  3WN0 A;  1PX4 A;  4PVA A;  5FUI A;  5JUV A;  3BYN A;  2J22 A;  2XQR A;  3HNM A;  4QX1 A;  5G04 L;  1W18 A;  2X8T A;  5AYC A;  2ADE A;  1NKG A;  3VT2 A;  1L7R A;  2YFS A;  3PUI A;  2BBA A;  3MV0 1;  2BZD A;  2ORX A;  1CX1 A;  5FK7 A;  3P1I A;  2XOM A;  2W91 A;  4HG6 B;  2X05 A;  2VR4 A;  3T0B A;  3BYJ A;  4U6B A;  1YRZ A;  1WKY A;  3J7H A;  4DXT A;  1PMJ X;  4QQS A;  3ACG A;  1W8N A;  3PIJ A;  4DUX A;  1UZ0 A;  3LDR A;  4TXW A;  3MUY 1;  4CUB A;  1UYZ A;  5IFT A;  5C0P A;  2YB7 A;  4KCA A;  1OH4 A;  2J1U A;  4QAW A;  2JD9 A;  3GGL A;  3K4A A;  4XVH A;  5JOW A;  2W1U A;  2X10 A;  4FI9 A;  2W46 A;  2W47 A;  5GLK A;  3FHQ A;  2J1A A;  1Y7B A;  3KF3 A;  1UYP A;  3LQC A;  1HN1 A;  2EID A;  4JKM A;  3CZU A;  4QB1 A;  5EJ1 B;  2DCK A;  5JXH A;  4PF1 A;  2C9K A;  5B6T A;  4ARX A;  4BK5 A;  2XQX A;  4LHS A;  2WBK A;  3I3D A;  1JZ6 A;  2VZV A;  4KC7 A;  5DN2 A;  5IFP A;  5IHR A;  3K77 A;  3OM5 A;  3OGS A;  3QZ4 A;  4DXR A;  3MV1 1;  2E32 A;  4MAD A;  3F2Z A;  1JU4 A;  4N2R A;  2EIE A;  3P6B A;  3A21 A;  1D7P M;  3I2K A;  1W9W A;  2Y6G A;  2VZO A;  3THD A;  3LDK A;  4NOV A;  3ACH A;  3I97 A;  2Y6L A;  3BYL A;  1W99 A;  3I3B A;  3OB8 A;  3LE0 A;  5J1X A;  4DEV A;  2VMF A;  1RYY A;  1UYY A;  4A3Z A;  4BDV B;  5HXM A;  3QC2 A;  3LEM A;  3K4D A;  3THC A;  3NJX A;  3WMZ A;  4UOJ A;  5IYY A;  2DCJ A;  1GOH A;  3QEE A;  1T2X A;  2QQV A;  4OZO A;  5AYE A;  2BGO A;  2L9L A;  5FKC A;  4DXS A;  3C8X A;  2VTF A;  4QB6 A;  4M4R A;  4P5Y A;  2J1R A;  3C7E A;  5IJR A;  3T0D A;  3E1F 1;  2EXH A;  4XUP A;  5C70 A;  4N2Z A;  3GDB A;  2W87 A;  1YI7 A;  5FKB A;  5C7G A;  3OM4 A;  1UMH A;  3CQO A;  1K45 A;  1GNY A;  4GZ9 A;  1UV4 A;  1GYD B;  2V5D A;  3WQB A;  2RV9 A;  3CMG A;  5A7V A;  2DDU A;  1J83 A;  4FFF A;  3KF5 A;  3WN1 A;  3LF7 A;  3OEB A;  4UI9 L;  2CDP A;  1K12 A;  3W5M A;  2J1S A;  3DYO A;  3PUH A;  5DQ0 A;  2JDA A;  4QX0 A;  4FFH A;  4LKS A;  1W9T A;  3WNL A;  4A44 A;  4L0P A;  4A45 A;  3WNP A;  2VL4 A;  3C7O A;  3BYK A;  3K4Z A;  2VZU A;  2W9X A;  3NNG A;  5AY9 A;  5GLQ A;  5FMD A;  3UET A;  4P02 B;  3HJR A;  5LA1 A;  3AKI A;  1I5P A;  1NX9 A;  3AC0 A;  4O8O A;  1DLC A;  1DYO A;  1SHW B;  4KMQ A;  1L7Q A;  4TTG A;  1ULO A;  2KD7 A;  2W1Q A;  1Y4W A;  1JI6 A;  3III A;  4CU6 A;  3IAQ A;  3VSF A;  1OD3 A;  2EIB A;  1WL7 A;  1KEX A;  3DEC A;  1US2 A;  4W4Z A;  4XUN A;  3U37 A;  5I0D A;  3D5Z A;  3ETP A;  3U75 A;  4PT6 A;  2VCB A;  4ZXE A;  1MPX A;  3VDA A;  2B4W A;  1J84 A;  1JYN A;  1W2T A;  3T08 A;  3LPG A;  3QED A;  2E33 A;  2WO1 A;  2WZE A;  2W92 A;  1UYX A;  4LQR A;  3VD3 A;  4ZZ8 A;  2JE8 A;  4MLG A;  2W1S A;  1JZ5 A;  4UDJ A;  3MO4 A;  2WAB A;  3WAS A;  4MOA A;  5LA2 A;  2ZEZ A;  1UY0 A;  1GU3 A;  3DYM A;  3HPN A;  2BER A;  4MGQ A;  4GWJ A;  2J7M A;  2VME A;  2ADD A;  3OGV A;  5CYY A;  1OT5 A;  2PQS A;  3CDZ B;  4XUR A;  2WAO A;  3EB7 A;  5DPN A;  1JZ3 A;  1OYG A;  1SG3 A;  2ZEW A;  4MGS A;  5JXI A;  2VQT A;  3AKF A;  4CU7 A;  5JOY A;  5B4X A;  3VDB A;  3GXU A;  2J1E A;  4GWI A;  2QQW A;  4A4A A;  2YFT A;  3VSR A;  4JKL A;  2WQ8 A;  2E26 A;  2VO5 A;  2WYS A;  3CKH A;  2QQM A;  2VDT A;  2J1T A;  3WMY A;  3ZXJ A;  3VSZ A;  2WN3 A;  3HN3 A;  2VM9 A;  1JYW A;  1UWW A;  2W3J A;  3T2P A;  2ZXQ A;  4UDK E;  2WAA A;  2AEY A;  3LEI A;  2RVA A;  1F4A A;  4QX3 A;  1NAE A;  3A23 A;  1UXZ A;  1JZ4 A;  1GYE B;  4OUE A;  1OF3 A;  2HYX A;  4XUQ A;  3PIG A;  3C7H A;  1GQP A;  3D5Y A;  3WSO A;  3LEG A;  2VJX A;  5JR2 A;  2YFZ A;  1P8J A;  3AKG A;  2W95 A;  2Y64 A;  3CIH A;  3VT1 A;  3UNP A;  1ST8 A;  3HOB A;  3D60 A;  3WNM A;  3T2Q A;  2V72 A;  4QB2 A;  1W0N A;  5G05 L;  1NUK A;  2Y6K A;  3A7Q A;  2EXJ A;  4BJ0 A;  2VOT A;  5B6S A;  3OM6 A;  3WEZ A;  2YC4 A;  2HLE A;  2X09 A;  1XPW A;  5FMB A;  3I3E A;  3UGF A;  1H6Y A;  4YPJ A;  1PX3 A;  4BXS V;  1UY4 A;  2VCA A;  3I2G A;  3A22 A;  5DMY A;  3VD4 A;  3C7G A;  2VCC A;  3WNN A;  4CUA A;  2WZ8 A;  3K46 A;  4CUC A;  3C2U A;  1JYX A;  3WNO A;  4W8J A;  3R67 A;  4QDS A;  4A6O A;  3WF4 A;  2EXK A;  3WPY A;  2BGP A;  3ZXK A;  3NQH A;  1GYH A;  4Z2A A;  2CDO A;  1GMM A;  5A1A A;  4KWU A;  4D8M A;  4ET7 A;  3RWK X;  1TG7 A;  3K1U A;  1BHG A;  2VZQ A;  1CZS A;  1R64 A;  3QEF A;  1W9S A;  4P08 A;  2QBX A;  3VD9 A;  4D47 A;  1US3 A;  3I2I A;  3I2F A;  3IDA A;  4D0Q A;  2XHN A;  1O8P A;  4XZU G;  4CU8 A;  1CIY A;  3CZJ A; 
#chains in the Genus database with same CATH topology
 1ZBE 1;  3PJY A;  3INA A;  1ALY A;  1W2U A;  3O0W A;  1MVE A;  3P2N A;  3OBA A;  1COV 3;  1NA1 A;  5FZ0 A;  3VBU C;  2GP5 A;  2QQI A;  1X7N A;  4NRO A;  5FP4 A;  3VBH B;  5KC5 A;  3M2M A;  2JG8 C;  2BEO A;  4RR3 A;  5FBZ A;  3BB6 A;  1X36 A;  2GZW A;  3VHP A;  1ND2 C;  4BQ1 A;  2P6H A;  3GNE A;  1VRH 1;  1HXS 3;  1QIQ A;  5LA0 A;  3GM8 A;  1KIT A;  1ZA7 A;  2D3S A;  1Y9G A;  1JU3 A;  4P9X A;  4GH4 A;  3ZSK A;  2YFU A;  5BNP A;  1V6N A;  4JV4 A;  4NUB A;  4F8A A;  5FMC A;  5A3T A;  3FLP A;  1AL0 G;  3I3M A;  4COW A;  2QKD A;  1V70 A;  2JDH A;  2JG9 B;  1R1Z A;  4Y22 A;  3ZDV A;  3U78 A;  5FY4 A;  3VBF A;  3HR9 A;  3JD7 1;  1W8W A;  1D4V B;  4N43 B;  3N9P A;  1DYK A;  5CEH A;  2PHT A;  4IGQ A;  3M8L A;  1WMD A;  4IV3 C;  5FPV A;  2A70 A;  1H9W A;  4EN9 B;  4KCB A;  2OS2 A;  5FYY A;  2Q8O A;  3W21 A;  2YY1 A;  1JW6 A;  3TAW A;  4BIS A;  4EYU A;  3E5Q A;  3KVB A;  3J7M A;  3TEX A;  5A8D A;  3MLK A;  1NE4 A;  2CGO A;  2XUM A;  3NV4 A;  4KG0 A;  2WQZ C;  5FZF A;  5K9Y A;  1B09 A;  5FQ0 A;  2F17 A;  1Q8V A;  1PMH X;  1FX5 A;  4QT6 A;  2BDR A;  1RUJ 2;  1GOG A;  1UX7 A;  3D3A A;  1PVC 1;  5C3P A;  2YGL A;  4QGN A;  1MEC 3;  4M4P A;  1TMF 2;  2BNO A;  2E51 A;  3DL3 A;  2K9Z A;  1AR7 2;  3GZE A;  4FQ4 A;  3KT4 A;  4L97 A;  3S7E A;  1JYV A;  4BQY A;  1QOT A;  3EYP A;  1FOD 1;  1XNA A;  1AR9 2;  3MW4 A;  4B4Q A;  2E63 A;  3RYR A;  1K3I A;  4N53 B;  1PGL 1;  4ASK A;  2MEV 1;  2JDZ A;  1V9U 1;  3IB3 A;  4K6B A;  1UZY A;  2P34 A;  1OFN A;  3AKH A;  1ZZ9 A;  4ONU A;  4Q0S A;  3VN4 A;  1FXZ A;  4FO9 A;  1XYN A;  2JEC A;  3V56 A;  5I0T A;  3N9O A;  4LPL A;  5FIX A;  3RGB A;  3S5Q A;  4LOS A;  1ZZB A;  4UFJ A;  3RQ0 A;  4JRA A;  4O65 A;  1BK0 A;  1PGW 1;  1UD1 A;  2QQK A;  5F7U A;  1GQG A;  4CCD A;  3PTY A;  3FUO A;  3KGL A;  4QPY A;  1YC6 1;  1K5M C;  1PO2 3;  3NKG A;  4XUT A;  1POV 0;  5DG2 A;  4E8D A;  3C7F A;  3MGU A;  3WPU A;  1QDO A;  4QPI B;  1NZI A;  5A7P A;  2ZZQ A;  3AP9 A;  3NJV A;  2C24 A;  3PUS A;  4JDM A;  4QPW A;  4R9B A;  2GNT A;  3POB A;  2WRA A;  5CZK A;  2XJV A;  2OKX A;  4LJH A;  5EJ3 A;  1HQN A;  1QJU 1;  3IT8 A;  5L7O C;  3ECQ A;  3MBW A;  1CX4 A;  4YGD A;  5F1R A;  1XNT A;  1UMI A;  3HEI A;  4NAO A;  3WX5 A;  1CZT A;  2A6Z A;  4RYD A;  5L9R A;  4Y1V A;  4YGE A;  5FPX A;  2TUN A;  2XHK A;  4GMP 0;  3RZK A;  1RHI 2;  2I07 B;  5D8A B;  2MEV 3;  4FTB A;  4FPL A;  3WF0 A;  1AJO A;  4AZZ A;  4YAR A;  2GNB A;  4A41 A;  2KA3 A;  2Y0I A;  2W1W A;  2VW0 A;  4L9B A;  2V4V A;  3V0A B;  4JC1 A;  2K46 A;  2OXB A;  2OT7 A;  2JKX A;  4DZG A;  1V6I A;  3SXW A;  3O14 A;  4Q4W 1;  4DMI A;  4XTM A;  3CJI A;  4XHB A;  4YG6 A;  4NRM A;  4UBG A;  4ERO A;  5JOZ A;  5K0U B;  3B5L B;  4BCU A;  3K75 B;  3J7L A;  2R7E B;  1BXH A;  4XMA A;  5GLO A;  1KDM A;  2RS1 3;  4LK7 A;  4XOG A;  4ZS2 A;  3WF3 A;  2HYK A;  3U14 A;  3JQW A;  1RJ7 A;  1UZZ A;  3TBD A;  4NHY A;  1UIK A;  5D2A A;  2DUO A;  5JXG A;  3NO8 A;  1DCS A;  2YBP A;  1VB4 A;  4PIZ A;  4XCB A;  3ZPY A;  5JSR A;  1DG6 A;  2ZGM A;  2ZML A;  1DQ2 A;  1YWK A;  5A1F A;  2X8F A;  2Y33 A;  3THT A;  3SLI A;  1JS9 A;  1HRI 1;  1VMJ A;  1W39 A;  2ZAA A;  1BQP A;  4W50 A;  4IXL A;  3M3O A;  3AP5 A;  4HN1 A;  5KHI A;  4LKF A;  4MH0 E;  3NNL A;  4WVM A;  5F3I A;  3KCC A;  2RJ2 A;  2RJL A;  3SEE A;  5I0R A;  1EAH 1;  3BKZ A;  4XHX A;  3APB A;  4O8N A;  3ZN6 B;  2EIC A;  4CDU A;  1Q8P A;  2O8O A;  5APA A;  2XH6 A;  5EJZ B;  2BQP A;  5C8W A;  4GUL A;  3CL1 A;  3FBM A;  3WN0 A;  2WNV C;  2ZS6 B;  3QCW A;  5CKQ A;  4X6Q B;  5JUV A;  4XQD A;  1L3J A;  3VBU A;  2X8T A;  1VBD 2;  2JDP A;  1AR6 1;  1O6U A;  2WT1 A;  3T4H B;  5LEJ A;  1LOC A;  2VBB A;  2FDG A;  4KWK A;  2ADE A;  2JG8 A;  5M0T A;  3VT2 A;  4PHZ A;  1OUR A;  2YFS A;  1AZD A;  1SFY A;  1MZ5 A;  1W9F A;  1AL2 3;  3S7I A;  4WVV A;  1DZR A;  3DEM A;  3IZO A;  5GZG A;  5FJK A;  3MV0 1;  4HSJ A;  2UY8 A;  4ARX A;  2BZD A;  4C91 A;  1W28 A;  1CX1 A;  5LEK A;  1ASJ 2;  2ET7 A;  2ZGP A;  4BLJ A;  3B93 A;  1PK6 C;  1HRI 3;  3SCG A;  4U6B A;  5FYI A;  4ZU5 A;  2PXJ A;  1YRZ A;  4CZS A;  2HBU A;  3CO2 A;  2BV4 A;  3J7H A;  1CGP A;  2XJS A;  2ETE A;  3BOP A;  3QH6 A;  2AGS A;  5FLI A;  1QNW A;  5GZF A;  2HWF 1;  3SH5 A;  5BPX A;  5FZ1 A;  1UZ0 A;  2CU5 A;  2HWC 2;  2UYB A;  1DGR N;  4Q0P A;  4ASL A;  4NVP A;  2E7T A;  4AFA A;  1UYZ A;  4A3X A;  2QZ2 A;  4IES A;  5E6H A;  1S0B A;  1YJL A;  1OH4 A;  2KM2 A;  3ZKU A;  1G9B A;  4IV3 A;  5GZE A;  2JD4 A;  5FOB B;  4HON A;  1G9A A;  5FMO L;  2W46 A;  1AR6 3;  1DZQ A;  4ITC A;  4MXW A;  3USS A;  4YZ5 A;  4AVB A;  1J3R A;  1LR5 A;  1Y7B A;  3OOX A;  3LQC A;  1HN1 A;  4Q27 A;  3R05 A;  3TOJ A;  4OQ9 A;  5JXH A;  5B6T A;  3UKN A;  1BMV 2;  2HJI A;  2OPW A;  1QGL A;  3PUA A;  2B8M A;  4QQL A;  4KC7 A;  4EWD A;  1ULD A;  3D0J A;  1GP4 A;  3HQX A;  3ZIX A;  3QZ4 A;  2XJR A;  4DXR A;  1W6N B;  2E32 A;  3MV1 1;  4FXG B;  4RD7 A;  3BAL A;  1AYN 2;  3F2Z A;  2R0F A;  1RUD 1;  2WS9 2;  5I8S A;  2EIE A;  1KS4 A;  3P6B A;  3KT1 A;  3A21 A;  1D7P M;  1IQA A;  1W9W A;  4URT A;  3FC0 A;  4K3U A;  1LES A;  3H1W A;  3I97 A;  2B39 A;  5DUX A;  2ZBJ A;  3BYL A;  5BNQ A;  4KU7 A;  1CAV B;  5EHD A;  1DGW X;  4L11 A;  5FJH A;  4A3Z A;  4BDV B;  5HI0 A;  4AVC A;  5HXM A;  5C3R A;  2VVF A;  1JOJ A;  3GZU C;  4Z1V A;  3UKT A;  4N90 A;  1GBG A;  5KWR A;  4BZ4 A;  3THC A;  3NJX A;  3FFQ A;  4YW6 A;  1UL9 A;  4FPG A;  4E2Q A;  2DYC A;  2WKK A;  1C8M 2;  4XF0 A;  4O61 A;  5GLT A;  1SCS A;  3QBQ A;  1PO1 1;  2PA7 A;  1TE1 B;  1T2X A;  2QQV A;  4OZO A;  1W05 A;  5FZH A;  5IT6 A;  3JU9 A;  3C8X A;  2WNO A;  5I91 A;  3ZYJ B;  3T0D A;  4CEW B;  1ZRR A;  2EXH A;  4NWW A;  3LKJ A;  1QJX 2;  4N2Z A;  4R9D A;  5DAX A;  1RIN A;  5L19 A;  5L7O A;  4LBQ B;  2W87 A;  1HJG A;  4NE9 A;  4XAE A;  5F3E A;  5FKB A;  1HQL A;  4CPB A;  1GAN A;  4OVE A;  1GNY A;  2WNU B;  4JHT A;  2V5D A;  3CMG A;  2ZHM A;  4EZH A;  1DDL A;  3NVC A;  3N4M A;  2DDU A;  3N3H A;  4FFF A;  4I3P A;  3T1M A;  3O1P A;  4CCN A;  4EZ4 A;  3WN1 A;  4P9I A;  2DU0 A;  2V09 A;  3LF7 A;  5A33 B;  2Q8D A;  1GSL A;  1DBN A;  3ZOI A;  5H9Q A;  5I8T A;  3LFM A;  1V6K A;  3KCY A;  3KLS A;  4Q4X 3;  1S0C A;  3FWE A;  4FFH A;  4DNY A;  1WCD J;  3QAC A;  2Q5T A;  4TZD A;  3ZIW A;  2P37 A;  1YEW A;  4AHZ A;  4N7U A;  5A3L A;  3ORJ A;  1URX A;  3VBS C;  2GME A;  2RS3 3;  2VZU A;  3ZYB A;  2W9X A;  5FXX A;  4COZ A;  5AY9 A;  1QQP 3;  5FY7 A;  3JUU A;  5FZA A;  3SCF A;  3E5U A;  4P02 B;  2OQ7 A;  1GWL A;  4GAL A;  3UET A;  2QJV A;  5LA1 A;  3MIH A;  1I5P A;  4RQP C;  4AK3 A;  2HEV F;  2B9U A;  2V73 A;  1WZX A;  2A7A A;  3O0X A;  4XTP A;  2FHR A;  2BTV C;  2OQ6 A;  2JDK A;  5BNN A;  3TEY A;  4MVT A;  1DYO A;  2ZX4 A;  4F83 A;  4L2N A;  2HWD 1;  1F5J A;  1L7Q A;  3WDX A;  4DY5 A;  5A3U A;  5ABJ C;  4DIN B;  1MQT B;  4TTG A;  1RUG 2;  4GKX A;  2MNG A;  1GZT A;  3FBY A;  1SPP B;  2PLV 3;  5FTT C;  5FY0 A;  3WCS A;  5T54 A;  5ISL A;  5FLJ A;  1JTZ X;  4E2G A;  3POG A;  4S2G A;  3MIE A;  1KEX A;  4W4Z A;  2ZAH A;  3S6P A;  4XUN A;  1QF3 A;  3U37 A;  4Q0U A;  5I0D A;  2YV8 A;  1OOP B;  3MF9 A;  3D5Z A;  3BOW A;  5DAW A;  3PNA A;  4NII A;  3K51 A;  3AJY A;  1SZB A;  5C5U A;  1IKP A;  2UWA A;  5FZL A;  2WO1 A;  2ATF A;  3ROU A;  1PGS A;  4AI9 A;  1W6Q B;  1CN1 A;  1G8W A;  1B35 C;  2Q1Z B;  2F4L A;  2CWM A;  2OUH A;  3H1M A;  1ZBA 2;  4Q4V 3;  3SHR A;  3MO4 A;  4H7L A;  2FQP A;  4J1X A;  1N1V A;  1NYW A;  3VBO B;  4AEM A;  4DFS A;  2WNV A;  5C4W B;  2FZ2 A;  3ZVX A;  4UW3 A;  1KRI A;  4MOA A;  1O3S A;  1AUY A;  1WCU A;  4PJY A;  5FZG A;  1MS8 A;  4M3C A;  3DPR C;  4MGQ A;  4HET A;  2J7M A;  2HH9 A;  3M1H A;  1XSR A;  4I2O A;  2R16 A;  5CYY A;  1UU6 A;  4IEW A;  2FMD A;  4FPH A;  3CDZ B;  1CAU B;  3EB7 A;  1HX6 A;  1QOO A;  2BFU S;  4Y33 A;  5J96 B;  1SG3 A;  3FFZ A;  1EV1 1;  1PK6 A;  3IDB B;  1VMH A;  5LRR A;  1RVF 2;  5F5A A;  1RUJ 1;  1PIV 3;  1QJZ A;  1ZVF A;  3ZN5 A;  1PVC 2;  1CAW A;  3DKQ A;  4XFI A;  3V65 A;  1IS4 A;  2JEN A;  1LOD A;  1TMF 1;  2QQW A;  2XJP A;  3AJZ A;  3M7A A;  4Y1Y A;  3RWN A;  4B8E A;  2YPJ A;  4ZXK A;  4JKL A;  3V0B A;  3B3Q E;  3NV1 A;  2WYS A;  3ZXJ A;  3HWJ A;  1CD3 G;  1AR9 1;  1FOD 2;  2J1T A;  5T5J A;  1VBE 2;  4JQR A;  1PGL 2;  5EYY A;  2R04 3;  5K7P A;  1JYW A;  1UWW A;  3I3Q A;  3T2P A;  4UDK E;  5D1I A;  1XNB A;  1C1L A;  3WP5 A;  3WDW A;  1SFP A;  3LEI A;  4UW6 A;  5FXZ A;  4AI8 A;  1D4M 2;  2RVA A;  1MS0 A;  4XF9 A;  2QQP A;  1F4A A;  3MYX A;  4FOY A;  3A23 A;  1BBT 2;  1MS4 A;  1JZ4 A;  1GYE B;  4CYD A;  1PGW 2;  5JSO A;  3ZN4 A;  4XUQ A;  2XJT A;  3C7H A;  4JVA A;  4LHN A;  1GQP A;  1X8M A;  3VBR C;  5DG1 A;  2VJX A;  3I59 B;  5FYC A;  3SH3 A;  2EA7 A;  2ZGU A;  4I0W B;  2VCM A;  4XBL A;  1P8J A;  1IOA A;  1DHK B;  1RED A;  1VRB A;  3THP A;  3AKG A;  4C0H A;  3VT1 A;  1GV9 A;  3NKT A;  1ST8 A;  1AR7 3;  3D60 A;  3WNM A;  3I2O A;  4JGY B;  3T2Q A;  1XYO A;  2C9A A;  2V72 A;  4W6Y A;  1LEC A;  2A6X A;  1KFU L;  4QB2 A;  2DTY A;  3X29 B;  3POF A;  4Y5Z 0;  1OXC A;  2EXJ A;  4IEX A;  2VOT A;  3TNP B;  3VKF C;  3WDY A;  4BJ0 A;  1RHI 1;  5B6S A;  2Y60 A;  2YC4 A;  1QJF A;  3EQE A;  3FLR A;  1BEV 1;  1GIC A;  4Q0Q A;  5BY5 A;  3VKL A;  3BCW A;  2JDU A;  3I3E A;  1GQH A;  5T55 A;  4YM3 A;  1BVP 1;  1V6J A;  3HQU A;  4Y26 A;  1SAC A;  3ZYI B;  4XIO A;  3RYK A;  4YPJ A;  5CG9 A;  1PX3 A;  4XJA A;  1UY4 A;  3A22 A;  4H7M A;  1PVX A;  3C7G A;  4MV2 A;  2VMG A;  2WFF 2;  2WA4 A;  2ZGL A;  1VAV A;  1E57 A;  2IXH A;  3PMS A;  4XBQ A;  1JYX A;  3J4U H;  4W8J A;  1OSG A;  2FMY A;  4QDS A;  4LO5 B;  3WVJ A;  1ZRI A;  1SFN A;  4WM7 B;  1MR5 A;  2WQ4 A;  3WF4 A;  1QXJ A;  1A34 A;  2FDJ A;  2E53 A;  3Q8C A;  2NMN A;  4COY A;  1IS3 A;  5EFU A;  4YW2 A;  5A70 A;  3ZXK A;  3NAP A;  4Y4Y A;  1G86 A;  4ZKT B;  4FTS A;  5A1A A;  4BU2 A;  1DQ1 A;  5CFD B;  1R08 3;  2ARX A;  2G4I A;  4I02 A;  5F39 A;  2Y26 A;  4IE6 A;  4RS5 C;  5HV0 A;  1BHG A;  2D98 A;  1W6O B;  5KHG A;  1DGW A;  4KGG A;  4P9G A;  4Y20 B;  4DRR A;  1VBC 1;  2VOK A;  3A0K A;  4XXP A;  4FQZ A;  4FPJ A;  4CDX B;  5JIU A;  3I2F A;  3ELN A;  1RUF 2;  4D0Q A;  2XHN A;  1ODN A;  2DBN A;  2VAU A;  1U5X A;  4QHO A;  1XXN A;  4AI1 A;  1UIJ A;  1R09 1;  4YVW C;  4AEK A;  2G19 A;  4AI0 A;  2VZS A;  2PHW A;  4QQP A;  5IK4 A;  1TVG A;  3VBS A;  3HNY M;  3WN2 A;  4BQW A;  1DP0 A;  1MS5 A;  5E89 A;  3O0V A;  3B9I A;  1SLB A;  2N7G A;  3WPV A;  2VOV A;  1F5F A;  2VUL A;  4PQ9 A;  4RQP A;  4XFH A;  2XDV A;  3SIS A;  2IVJ A;  2HWE 2;  2B45 X;  4YGC A;  1UKR A;  5K4L A;  3UGG A;  2YHJ A;  2ZHK A;  4A42 A;  2BPA 2;  3AXD A;  4NPR A;  5FLW A;  1JOB A;  1GZW B;  2JG9 C;  2VMH A;  3RJ2 X;  1RJ8 A;  2X8K A;  5ABJ A;  4DY3 A;  4JKK A;  2WJS A;  4XIL A;  4E4H A;  1ULG A;  3DN7 A;  1W6M B;  2WNE A;  3KQR A;  1ASJ 1;  4YG0 A;  3ZFG C;  1LEN A;  3KGZ A;  3U4X A;  4NAM A;  4AK5 A;  1S2B A;  4CRQ A;  5AYD A;  1J3Q A;  3H9A A;  1ZZ7 A;  4NHM A;  3OY8 A;  4LIV A;  2VXJ A;  3LPF A;  2W39 A;  4FOV A;  3LOI A;  2HWF 2;  1X9T A;  1F31 A;  3TWI A;  5GZC A;  2JE7 A;  1B35 A;  3FN9 A;  4HFS A;  2Y6H A;  4KBZ A;  2BNN A;  1GWK A;  1H2K A;  2XGX A;  3J9S A;  4G3Y C;  4UDI A;  1RUE 2;  4HKL A;  1KJR A;  3UT0 A;  3ABZ A;  2ZGO A;  1QH7 A;  3FMG A;  4K40 A;  3O1T A;  3DPR A;  3ZMN A;  4BQ2 A;  4P00 B;  4IE5 A;  3MPP G;  3WG2 A;  1VBD 3;  3UV9 A;  4PDW B;  4A7Y A;  3OM7 A;  3KVA A;  2YRO A;  3D6E A;  3BGA A;  2D93 A;  2X8S A;  3MFC A;  1V0A A;  2DV9 A;  1FV2 A;  4YVS B;  3UGH A;  4AF9 A;  4ZZ5 A;  1O3Q A;  4FP2 A;  4XF3 A;  3LA2 A;  3TN9 2;  2E7Q A;  1V6M A;  3R4Y A;  3AVS A;  5BNO C;  1BMV 1;  3DKW A;  4HK8 A;  4M3C F;  2UYA A;  3JCI A;  4IEV A;  1QEX A;  1MS9 A;  1O8S A;  1OPM A;  3ST7 A;  2ZGT A;  5FK8 A;  4JX0 A;  3F95 A;  2YG0 A;  4A7K A;  5GLP A;  5IVF A;  2XWB B;  4Q4Y 1;  1K42 A;  3LSE A;  1DFQ A;  1CWP A;  4D6R A;  3OD0 A;  2WS9 1;  1RUD 2;  5DDJ 2;  4XJ9 A;  2EAA A;  4LA3 A;  2HWC 3;  3AL6 A;  3HT1 A;  1A6C A;  2VC9 A;  2EF6 A;  1FNY A;  2ZOE B;  3TEW A;  1W90 A;  2ZEY A;  1I5Z A;  4PQQ A;  5EYX A;  5FZ9 A;  1TEI A;  2C1F A;  5GLV A;  3P3N A;  3W20 A;  2JB4 A;  2JE9 A;  4IEU A;  5GLL A;  5GLN A;  3ZPO A;  4KC8 A;  3ZFE C;  5A8C A;  2W08 A;  2VG9 A;  3H3L A;  2IXI A;  3N9M A;  1NCR B;  2WUH A;  1QU0 A;  3GHM A;  5B4N A;  1C8M 1;  2R30 A;  5KHK A;  4XW3 A;  3T09 A;  2JJ6 A;  4B3N A;  3I2J A;  1HW5 A;  2KR2 A;  5FP9 A;  3WV6 A;  4RA0 A;  5DZE A;  4FPF A;  4OZX A;  3VBR A;  5J09 A;  5CU1 A;  2NP0 A;  1S0F A;  4CU9 A;  5BV6 A;  1A78 A;  4URA A;  1IQD C;  4XF4 A;  3ENR A;  4BH9 A;  3L2H A;  4ZHN A;  4PBP A;  1QJX 1;  3OJB A;  2QQJ A;  2A6V A;  2Q4S A;  3U0Z A;  5C9A A;  1RXG A;  4PIY A;  3K3N A;  3WF1 A;  2JIJ A;  3URF A;  1AYN 3;  2PMW B;  2ZZJ A;  1KGY A;  1ULE A;  4IUG A;  5T3N A;  1W3X A;  3ZYR A;  4FPK A;  2A6Y A;  5JDB A;  3I49 A;  4ZU4 A;  5FZE A;  4H55 A;  1FPN 2;  4COU A;  1U5Z A;  1Z7S 2;  3OG2 A;  4EN7 B;  4C8D A;  1N3O A;  2X29 A;  4QGM A;  3V64 A;  1QOS A;  1O7F A;  4G9S B;  4D3W A;  4CEY C;  5GLW A;  1S4C A;  2VQU A;  2G9Z A;  2ZEX A;  4C1X A;  1WGP A;  3ZSJ A;  1RUN A;  3ZXL A;  2O8Q A;  5LWB A;  3KT7 A;  2P3K A;  4K21 A;  4EN8 B;  1C8M 3;  1YIF A;  5C71 A;  3FJS A;  1DLL A;  2Q30 A;  4BQX A;  1OLQ A;  1WWY A;  4Q29 A;  4K8F A;  4XJ8 A;  4BHP A;  1YFX A;  3ES1 A;  4E8C A;  2TEP A;  3VD5 A;  4Q8L A;  1VB2 A;  3RS6 A;  3QLQ A;  2AEN A;  4XXA A;  2JKB A;  3NNM A;  2B4K A;  1QJX 3;  2G9F A;  5JMO A;  4AHX A;  3WLU A;  4AGR A;  2JDM A;  1ODM A;  1YQ2 A;  1LGN A;  2VBD A;  4N7I A;  4AK7 A;  4C0B A;  4QHB A;  2HWD 2;  4RS5 A;  2Y8K A;  1RUG 1;  2WWJ A;  2BBV A;  1ZRF A;  4ZY9 A;  2C26 A;  3MIG A;  4IW3 A;  1XC6 A;  3D61 A;  2DU1 A;  4K8R B;  4KBB A;  3ILN A;  3KQ4 B;  1H8V A;  2CNA A;  3B69 A;  4RR3 B;  2NN8 A;  5LAS A;  1W8T A;  1DQ4 A;  2BJS A;  3CU9 A;  4BA6 A;  1RUC 2;  1RUH 2;  1XNK A;  1ZZ6 A;  4YVW A;  3WW1 A;  4PVA A;  3BYN A;  2OA2 A;  2VVD A;  3HNM A;  4QX1 A;  5G04 L;  5LA9 A;  4LBL A;  3VHN A;  5FR3 A;  1FMD 2;  5HCH A;  1EPW A;  5AYC A;  2FCT A;  3N7M A;  4CDQ B;  3RZG A;  1ZBA 1;  1L7R A;  2D5H A;  4TWT A;  2P5B A;  4AI2 A;  4AFB A;  4YG3 A;  3NJY A;  4Y3O A;  5EQU A;  2R1B A;  1WBL A;  3R4S A;  1TME 1;  5EV7 A;  1ZBE 3;  5L9V A;  3UL2 A;  2VR4 A;  4Y22 B;  3T0B A;  2JG9 A;  3DF0 A;  1JYT A;  4GQ7 A;  4Q2F A;  4ZS3 A;  4QU1 A;  3C3V A;  1GYK A;  1PMJ X;  4QQS A;  2JB8 A;  3ACG A;  4N43 A;  1W8N A;  3ZFG A;  3AZW A;  1NXD 1;  1EV1 2;  1VRH 3;  2ZPX A;  1HB3 A;  3LDR A;  4JTN A;  4DOU A;  1RVF 1;  2GN3 A;  2P1B A;  3BPS A;  2UUR A;  3MUY 1;  4YFZ A;  3RG0 A;  3MW2 A;  5CVR A;  4D6S A;  4MSV A;  4KGQ A;  3TAY A;  2J1U A;  1VBA 2;  1PZ7 A;  2JD9 A;  4QAW A;  5DZG A;  3GGL A;  5FWE A;  2GC3 A;  3EMR A;  3POS A;  2X10 A;  1HV0 A;  2JDN A;  1VBE 1;  5GLK A;  3Q8A A;  3PHM A;  4YW3 A;  1UYP A;  3JD7 3;  4QM8 A;  2EID A;  4JKM A;  4X8P A;  4QB1 A;  1HRV 2;  1PMI A;  1YQC A;  5EJ1 B;  3T4V A;  2PAM A;  2YUE A;  4PF1 A;  2XQX A;  1D4M 1;  1JUI A;  4LHS A;  2WBK A;  4MGI E;  1UO9 A;  3KCX A;  5KXB A;  1JZ6 A;  5DN2 A;  1XB9 A;  1BBT 1;  4MYE A;  3K77 A;  2OPK A;  1G9C A;  3OM5 A;  3JB4 C;  1QJY 2;  1HB2 A;  3AMQ A;  5HCA A;  4MAD A;  4JZR A;  4UFH A;  4ZPI A;  2ZX3 A;  5BNO A;  1ENR A;  4UXA A;  2YMZ A;  2GN7 A;  4YW5 A;  2GND A;  2Y6G A;  2VZO A;  2WT0 A;  2HWB 1;  4NOV A;  3ACH A;  4QPG C;  1G9D A;  3WUC A;  2FDH A;  1O91 A;  1PVC 3;  3GBW A;  4CCM A;  1DYP A;  1FNZ A;  3RZH A;  1RYY A;  1UYY A;  2VNO A;  1W04 A;  4AQS A;  1AX0 A;  4CP9 A;  1APN A;  4ES8 A;  1Q8Q A;  3FX3 A;  5JIA A;  4QPI A;  3N7L A;  1FOD 3;  2RMU 1;  5FZ4 A;  3MIF A;  4XIK A;  2DCJ A;  4CEW C;  4FP3 A;  4MLO A;  1BEV 2;  1S0G A;  1I6X A;  1V9U 3;  2CL2 A;  4P14 A;  3UK9 A;  3WY6 A;  4LO8 A;  3I8T A;  5FKC A;  3ZFE A;  5JAX A;  5F37 A;  2JEM A;  4HSL A;  2VTF A;  2LTN A;  1CQ9 A;  3AKP A;  4M4R A;  4NN0 A;  3WXP A;  3C7E A;  1ULC A;  3A0N A;  4XAA A;  1NT0 A;  1XE7 A;  3WG1 A;  4BIO A;  1BBT 3;  2WFF 1;  2Z79 A;  4TLF A;  4LBM A;  2XJU A;  1I9R A;  3KWV A;  1UMH A;  4AED B;  4BM8 A;  1MAC A;  3CQO A;  5C7G A;  3GJA A;  3OUJ A;  4I01 A;  4IQP A;  3MIC A;  3CF6 E;  5I0U A;  2GNM A;  2RV9 A;  3HD8 B;  4GXL A;  4KNC A;  3V0A A;  3ZFF C;  2AZ5 A;  5JWP A;  3KF5 A;  1CR7 A;  2OVU A;  5FO8 B;  1BJQ A;  4DIQ A;  5AC9 2;  2CDP A;  1K12 A;  1QJU 3;  3WCR A;  4DS0 A;  3GCX A;  2YGM A;  3DYO A;  4LBO A;  4NR1 A;  3PUH A;  5BNN C;  2ZAB A;  3K48 A;  1UPS A;  2VNV A;  4QX0 A;  2ZX2 A;  4CXY A;  4RFR B;  4QXB A;  4PI2 A;  1W9T A;  4R9A A;  1AXY A;  4L0P A;  2XB6 C;  4NHX A;  3WNP A;  3C7O A;  3K2O A;  5ANQ A;  4CEY A;  2W2I A;  3OBZ A;  3BYK A;  1VBC 2;  3NNG A;  4E4S A;  1RUF 1;  3TRS B;  3EO6 A;  2I45 A;  4CDW B;  4OHY A;  5FLH A;  3W58 A;  5GLQ A;  5E8A A;  4LO7 A;  5CB7 A;  3W59 A;  2ZHL A;  3WQ0 A;  1NX9 A;  1R09 2;  3AC0 A;  1VR3 A;  4JTO A;  4MGY E;  4YW1 A;  1DLC A;  1UPI A;  4LT5 A;  4Q4W 3;  5CIR A;  4IER A;  3H7J A;  3PVN A;  1NQJ A;  2Q1M A;  3TYJ A;  2E7A A;  1FI2 A;  2FZ1 A;  2RR1 2;  1IHM A;  3L9J T;  1LHU A;  2I2S A;  1ULO A;  1Y4W A;  1VE0 A;  2KD7 A;  1JI6 A;  2HWE 1;  3III A;  3IPV A;  1W0O A;  2XBO 2;  3IAQ A;  4CU6 A;  2X5I B;  3O1U A;  1KFX L;  3ZN6 A;  1XE8 A;  4CDU B;  1VJ2 A;  1Z78 A;  3ASI A;  3DEC A;  3KZ4 C;  4NHL A;  3ETP A;  1DQ5 A;  4PT6 A;  4P9W A;  3VBO C;  3VDA A;  3POW A;  1W2T A;  2H0V A;  4B4P A;  5C4W C;  3NV2 A;  2B4W A;  3VBU B;  1PM4 A;  2OX0 A;  3LPG A;  2WZE A;  1WW7 A;  2PHD A;  2W92 A;  3Q9O A;  1C5H A;  1UYX A;  1S0E A;  2QFE A;  3VD3 A;  2P3I A;  2D44 A;  2JE8 A;  4ZU7 A;  1JZ5 A;  4HK9 A;  2P3Y A;  1ND2 B;  4YNI A;  4LBQ D;  2IFW A;  3VDD C;  3WAS A;  4HKO A;  4LKD A;  3S5A A;  1RC6 A;  2LM3 A;  3OYW B;  1AYM 2;  5FBJ A;  5H9R A;  1EAH 3;  3ZLI A;  4E4Z A;  4QX5 A;  5ACA 1;  4YZ2 A;  4CCC A;  2ZKN A;  4Q5O A;  3NW4 A;  1ACC A;  4E9K A;  1OLM A;  3SMH A;  2B7Y A;  3OD4 A;  3ZXF A;  4LLF A;  4XUR A;  1WCK A;  1RUE 1;  3M4F A;  1JZ3 A;  2Y34 A;  2ZJC A;  1UU4 A;  2XVK A;  3AMH A;  4XZP A;  5A1L A;  1X9P A;  1C28 A;  1NLR A;  2R07 2;  2YPD A;  4NPL A;  2VQT A;  5DUV A;  5FZK A;  4C90 A;  5F3C A;  5JOY A;  5B4X A;  5I93 A;  1T6G C;  3NST A;  2YBS A;  1YFY A;  2VPV A;  3GXU A;  1FV3 A;  1GLH A;  4GWI A;  5FZI A;  2VNG A;  3TN9 1;  4AAP A;  2GC0 A;  4A4A A;  3MEP A;  1WCS A;  2WQ8 A;  2E26 A;  4LIU A;  4Y5S A;  4TYS A;  4NIH A;  1HB4 A;  2VOX A;  5CNA A;  2XPJ A;  3GCW A;  5JSP A;  2LAL A;  2J42 A;  5B2G B;  2WN3 A;  4NIG A;  3HIF A;  3KMH A;  3VUO A;  2W3J A;  5IK5 A;  5IK8 A;  4Q4Y 2;  4HPK B;  2Q0A A;  2HWF 3;  2AEY A;  5DDJ 1;  1C1F A;  1UNB A;  1IGO A;  2A3Y A;  1XRU A;  4AFC A;  1IPJ A;  2YU2 A;  2LUW A;  3U4S A;  1E5S A;  1E5R A;  4WM8 C;  2VD7 A;  1RL3 A;  1N1Y A;  2WYF A;  1UXZ A;  4A6S A;  4OI0 A;  4LR4 A;  2BYV E;  3RZM A;  1DU3 D;  3WHT A;  2HYX A;  4OHX A;  3PIG A;  1S2K A;  3ETQ A;  2KXL A;  4NWV A;  5FZ6 A;  5GLU A;  3FHI B;  2CAV A;  5EP9 A;  1VP6 A;  4XDQ A;  4JGY C;  3LEG A;  3HN1 A;  2DFC A;  5JCT A;  5JR2 A;  4MZU A;  1NCQ C;  1SLT A;  2A75 A;  2TBV A;  4OHZ A;  1S55 A;  5JLV A;  5FPB A;  3BIE A;  5FZ7 A;  3P5B A;  3CIH A;  3MIB A;  4V1P A;  3CJX A;  4LUK A;  3MI8 A;  3O1V A;  3TN9 3;  4YM0 A;  4YWA A;  1XNC A;  3WG4 A;  3POJ A;  2EIG A;  1W0N A;  4QPG A;  1HQW A;  3MFA A;  3AZY A;  2Y6K A;  3RRD A;  5C2M A;  4J6G A;  3ZYG A;  3WEZ A;  4LK6 A;  2HLE A;  2X09 A;  4QXC A;  1XPW A;  4CCK A;  4R4Z A;  3NAP C;  1K5M B;  3O1S A;  2O14 A;  4YW4 A;  1IZ3 A;  3UGF A;  1RUD 3;  4WM7 C;  1RUO A;  1U12 A;  4ISR A;  4BXS V;  3I2G A;  1QJE A;  2QNK A;  4CEW A;  4PLN A;  1FPN 1;  5CFC B;  1Z7S 1;  1S0J A;  2WZ8 A;  4OUL A;  5L7O B;  1GR3 A;  3C2U A;  3WNO A;  3R67 A;  1O3T A;  4LBQ A;  1TNR A;  1V6L A;  4RGK A;  5FO7 B;  4YZ1 A;  4K7J A;  1YQ8 A;  2WII B;  2EVX A;  5LBB A;  2Y6F A;  4F7Z A;  3MDP A;  4RGA A;  5FDB A;  3OGJ A;  1HV1 A;  3VB9 A;  4QQH A;  5FZB A;  4MG2 A;  3WPY A;  2BGP A;  3BU0 A;  4D7Y A;  3HBK A;  1H8T B;  1PO1 3;  3AXE A;  2CDO A;  3GZT B;  3N9Q A;  1GMM A;  3LZZ A;  3Q8F A;  2BW8 A;  2Y0O A;  4KWU A;  4U2A A;  3KV6 A;  5F3G A;  3KD4 A;  2WL1 A;  4JCK A;  1TG7 A;  3AM2 A;  4WVZ A;  4CDX C;  1SMV A;  5CA6 A;  3HQR A;  3K1U A;  5KC6 A;  3ZFF A;  2VZQ A;  4HL0 A;  3VZN A;  2QCS B;  4CP2 A;  1W9S A;  1HJF A;  3AX4 A;  3ZYH A;  1N1T A;  3VKN A;  3DCQ A;  3FLT A;  1F35 A;  1QXP A;  1SEF A;  2PHX A;  1OI6 A;  2IZW A;  3IDA A;  3ILF A;  5IK7 A;  2P6C A;  2GAU A;  1O8P A;  1QWR A;  1XE0 A;  4UW4 A;  3ZR5 A;  1CIY A;  1I1E A;  4N4B A;  3AYD A;  5FFO C;  1DIW A;  3OM2 A;  4XJZ A;  1M06 G;  4N8M A;  1SBF A;  4B1M A;  1RUI 1;  1LHV A;  2BNM A;  2DUR A;  2D5F A;  3G7D A;  2XL9 A;  4KWL A;  5IAT A;  5LBE A;  2DBI A;  3VD7 A;  1RUC 1;  1EUT A;  1PZ8 A;  1RUH 1;  3DGT A;  3FE5 A;  5IVJ A;  4PF5 A;  5F6K A;  4CCO A;  2YFR A;  1SPP A;  3UES A;  4AL9 A;  2WZR 2;  3LIH A;  4GWM A;  1FMD 1;  4EWE A;  1UY3 A;  1NY7 1;  2WN2 A;  3OEA A;  3WD5 A;  1JZ2 A;  4AE2 A;  4OQ8 A;  5I8Y A;  1RIR A;  4LHK A;  4Q0V A;  1LTE A;  3LFI A;  3WF2 A;  4FOW A;  1W2N A;  5H9S A;  1CJP A;  1GKB A;  1TME 2;  3NRU A;  3Q8E A;  1S2E A;  4QQ2 A;  3WR0 A;  4ONZ A;  3KV5 A;  5E88 A;  4AG4 A;  3ZXD A;  2UY9 A;  1EYB A;  5A7W A;  2WDB A;  2WNV B;  3D8C A;  4QDQ A;  2HWD 3;  2VEC A;  3VBO A;  2JIC A;  2DFB A;  5C4W A;  4B1L A;  1JZ8 A;  3CU7 A;  2JWP A;  1VBB 1;  2PHU A;  4UT5 A;  2FDF A;  4FPC A;  4QQO A;  1QNY A;  4DUV A;  1LHN A;  3O1M A;  4CCE A;  3N35 A;  5FWJ A;  3AFK A;  1D0H A;  1OF4 A;  2ORZ A;  1Q43 A;  2W94 A;  4YSF A;  3KST A;  5F8P A;  2AR6 A;  4PDW C;  3VDD A;  3IDE A;  1GUI A;  1VBA 1;  3GAL A;  1DQ6 A;  5DAP A;  4Z8B A;  3CNA A;  1W03 A;  1PK6 B;  2XKO A;  3VSS A;  5F2W A;  4F3J A;  3VHR A;  2CWS A;  1Q5O A;  2ID4 A;  1AX2 A;  4FPE A;  1POQ A;  3WDU A;  2NZ9 A;  2VNR A;  4EQV A;  1U5Y A;  5FP8 A;  5JXJ A;  3ZMO A;  1LOB A;  3SEP A;  2DF7 A;  4AEJ A;  1HRV 1;  3ACI A;  4MHR A;  2A6W A;  2VMD A;  2WA3 A;  5C6C A;  5C8C C;  2E9Q A;  1PT2 A;  4OI1 A;  5LK5 A;  3V0B B;  2XL7 A;  2YC0 A;  2P2K A;  5D21 A;  2RM2 2;  4KL1 A;  3O1R A;  1BYH A;  2VZ1 A;  3T0A A;  3BTY A;  3IAP A;  2JXA A;  4BWO A;  3PU8 A;  5FYM A;  4Y4R A;  5FYH A;  3RDI A;  1EPZ A;  1RTV A;  1H6X A;  4LBJ A;  4MGK E;  1CES A;  3ZSE A;  1QJY 1;  2VZP A;  2EAK A;  4FAG A;  4U6D A;  3LAG A;  3OTF A;  2R32 A;  2XML A;  4LBN A;  2QE3 A;  4LO6 B;  1EV1 3;  2DVF A;  4JGZ B;  2XLG A;  5EWS A;  2HWB 2;  3KHC A;  1W6P A;  2SLI A;  1RUJ 3;  3VT0 A;  5GLR A;  1NCR C;  1M4W A;  4J25 A;  1UN1 A;  1TMF 3;  5C9A C;  2ENR A;  1WCQ A;  4AK6 A;  1UY2 A;  4WM8 A;  1AR9 3;  1KDK A;  2NMO A;  2XWJ B;  1ZZC A;  2RMU 2;  2Y6J A;  3UKV A;  2DVD A;  3E6D A;  5JI7 A;  5BXX A;  1S0D A;  4LE4 A;  1SDD B;  2XXZ A;  1HRV 3;  1UOB A;  1UOG A;  2ARE A;  5FUP A;  1QXR A;  2AEZ A;  1C4R A;  2RS1 2;  4JGY A;  5A6Y A;  5FPU A;  1NCQ A;  3KSC A;  2G1M A;  2Q8E A;  5JPM B;  4E2S A;  2EXI A;  3PTR B;  1N3P A;  1NOV A;  5FY5 A;  1YFU A;  4LXL A;  1UY1 A;  3FHA A;  3POY A;  3PME A;  5GJ6 A;  5FUN A;  3AYC A;  4K1Y A;  3U07 A;  3TB0 A;  1REE A;  5A7V B;  4WZF A;  1F4H A;  1LUL A;  1EUU A;  4EN6 B;  3E5X A;  3MZH A;  1WD4 A;  5F6L B;  5JOX A;  5LAT A;  3VDC A;  4V2W A;  1H1I A;  2NM1 A;  5AC9 1;  4OYU A;  4OUS A;  4QDR A;  4D6Q A;  2V5Y A;  2VVE A;  4WM7 A;  4AWD A;  2VZT A;  3AZZ A;  3DYP A;  1LRH A;  2A1X A;  3FZ3 A;  2D6O X;  3LGR A;  1WLC A;  3M3E A;  2WO3 A;  3QH7 A;  1A8D A;  1HKD A;  5JZG B;  4QX2 A;  4GIQ A;  3H3U A;  5CBL A;  1RHI 3;  5FP7 A;  1OUX A;  1BEV 3;  2AYH A;  4QMA A;  2VZR A;  3VBH C;  4Y24 A;  2FCV A;  2V4A A;  2QVS B;  5A80 A;  1ZRC A;  4N9I A;  1YHF A;  2IXJ A;  4NIA A;  4Y1X A;  2IXC A;  2IUW A;  3D0S A;  4LA2 A;  3WAU A;  1JZ7 A;  1W6O A;  3R0R A;  4OI4 A;  2E31 A;  4M3C E;  2BP6 A;  3AVR A;  3AKS A;  3VL9 A;  3W5N A;  4CDX A;  1UXX X;  3BTA A;  2BOJ A;  3BN6 A;  4N1I A;  2RR1 1;  4COT A;  1R1A 2;  4H3W A;  2XG3 A;  5A3O A;  3RZL A;  4AYU A;  3JBG 2;  1DZT A;  2XBO 1;  4QKN A;  5IAX A;  3IDC B;  1XU2 A;  1XQN A;  2F6B A;  4O9G A;  4RFT 0;  4IGP A;  1SLI A;  3BVC A;  4CDQ C;  1GOF A;  4EV0 A;  4RQP B;  1IG0 A;  1CVN A;  4YFW A;  1MS1 A;  2D6P A;  4NPM A;  4N43 C;  5FUI A;  2R06 2;  2J22 A;  1RMU 1;  1LGB A;  1W8F A;  2XQR A;  3O7O A;  1W18 A;  1WLT A;  2GC2 A;  1JOP A;  1VBC 3;  4BQ4 A;  1L7L A;  4HMZ A;  4AHW A;  1KQR A;  1OQE A;  2BBA A;  2W52 A;  1UF2 C;  1AYM 1;  1YI9 A;  3LA3 A;  1FAT A;  2ORX A;  4LLO A;  1R09 3;  1XU1 A;  2XOM A;  2NYY A;  1OFS A;  5ACA 2;  3BYJ A;  3MPB A;  2MHF A;  1LOF C;  5HV4 A;  3MLL A;  1K5J A;  1WKY A;  3ZXA C;  1NQD A;  2X53 S;  5K8S A;  1OVS A;  2I74 A;  1WLW A;  1U5I A;  1VIW B;  4XYX A;  2RDN A;  2P4E A;  1MZ6 A;  3PIJ A;  1ULF A;  3LD8 A;  2NQY A;  4LUM A;  4NMI A;  4TXW A;  2R07 1;  1H4H A;  3M70 A;  3AL5 A;  4XAB A;  1T6B X;  1H2L A;  5IFT A;  2YB7 A;  5KHJ A;  4KCA A;  4N53 C;  4QKF A;  2BOI A;  2XJQ A;  3BOD A;  4XVH A;  3VHO A;  1PNG A;  3DPR B;  5JOW A;  2W1U A;  1ASJ 3;  1W06 A;  3RMX A;  2JX9 A;  4FI9 A;  4Q1P A;  4UF0 B;  4D94 A;  3GJB A;  1QHD A;  1Y9Q A;  4PDW A;  3FHQ A;  2J1A A;  1UCX A;  3KF3 A;  5CAZ A;  3O1O A;  2PAK A;  3CZU A;  4YVS A;  3TEZ A;  4I30 A;  2DCK A;  4EJR A;  2C9K A;  3WHU A;  4QKB A;  4BK5 A;  1RB8 G;  1WMF A;  4UFL A;  2Y38 A;  2ARA A;  3R4D B;  4I09 A;  1UZV A;  1ZYB A;  1HN0 A;  4W6W A;  4DPN A;  4BME A;  4QPI C;  5FZ8 A;  3ITQ A;  4IV1 B;  4JAA A;  4ES9 A;  5C8C A;  5A32 A;  2YDE A;  1OBN A;  1WW6 A;  1CAX A;  3G6J B;  3OSD A;  5EZW A;  3E6C C;  2A3X A;  1JBC A;  3ZYF A;  4J1W A;  1JU4 A;  4HVR A;  1DGL A;  1NXM A;  3H1Y A;  4S2F A;  3W5M A;  1ZRD A;  1WMX A;  3LDK A;  5FZO A;  3THD A;  1O5L A;  3I3B A;  3USU A;  2GMP A;  1OKQ A;  3OB8 A;  3ZR6 A;  4DEV A;  2B42 B;  1X50 A;  2VMF A;  3L2Y A;  5FXW A;  1X82 A;  1D2Q A;  5F5Q A;  5D8A C;  2VBP A;  5L9B A;  2CSG A;  1BCX A;  2RS5 2;  1V00 A;  3AKQ A;  1Z0H A;  1NCR A;  4LO4 B;  4OCT A;  1NE6 A;  4RHV 1;  3PUQ A;  1GOH A;  2D97 A;  1POV 1;  3OBR A;  2ERF A;  1LEM A;  3PDQ A;  5C3S A;  5K0U C;  3CBN A;  4Q4Y 3;  2BGO A;  3VBR B;  5AYE A;  3ON7 A;  3B01 A;  2WS9 3;  1JYC A;  1GZ9 A;  4Q4X 2;  4DXS A;  4QB6 A;  4P5Y A;  2PQQ A;  4XEZ A;  1O4T A;  5IJR A;  1W9Y A;  1AR8 1;  2DUP A;  2Z5W A;  1ND3 B;  4JRL A;  4UBH A;  5GLZ A;  1REF A;  5C70 A;  3GYD A;  2RS3 2;  3S57 A;  5FMO S;  5JVV A;  4XBN A;  3RZJ A;  1GP5 A;  1K45 A;  1WA4 A;  4GZ9 A;  2AUY A;  2EAL A;  2VUA A;  4GMP 1;  5DZF A;  5GKA C;  4CCL A;  2VMI A;  2G9G A;  1W8Z A;  4MGT A;  1GYD B;  5FAX A;  1J58 A;  3NJZ A;  1J83 A;  2PN5 A;  2D43 A;  1COV 1;  2W0X A;  2ZAC A;  5A3W A;  2GMM A;  2OW4 A;  1LGC A;  2ZGK A;  1YJK A;  5AFB A;  1HXS 1;  3EXU A;  1JXN A;  2PLV 2;  1W2A X;  2ZMN A;  4LKS A;  1GNH A;  2C6S A;  3MF6 A;  3WNL A;  4A44 A;  4AFD A;  3SQO A;  4UWD A;  3RFR A;  1OLR A;  3W9A A;  2WSU A;  3KV4 A;  3B94 A;  1QDC A;  3K4Z A;  4IEQ A;  5HBA A;  2Z42 A;  5IW0 A;  4QHZ A;  3AMN A;  4XDO A;  3N36 A;  3NMB A;  4XET A;  5FPL A;  3HJR A;  4JDN A;  4CXX A;  4QM9 A;  4R52 A;  3AKI A;  1XSQ A;  3PU3 A;  3GBF A;  4XDP A;  1NA1 B;  1YXW A;  2FD8 A;  4HOO A;  2X5I C;  3J8F 2;  4Q4V 2;  1IG3 A;  3VBH A;  1ZM1 A;  1RUI 2;  3AMP A;  4KMQ A;  4RS5 B;  1HDK A;  1VAL A;  1PM7 A;  5A7N A;  1AXZ A;  2AH2 A;  1NZC A;  2W1Q A;  2WZR 1;  4QGL A;  5FZM A;  2PHR A;  3JB8 A;  4GH4 B;  5F5I A;  1WL7 A;  5FXV A;  1NY7 2;  1US2 A;  1LOE A;  3JZV A;  1LED A;  1H9P A;  2WLP A;  4P9Y A;  5BNP B;  3U75 A;  4YVW B;  5FYT A;  1J84 A;  1JYN A;  3PJQ A;  3ILR A;  3T08 A;  3QED A;  5A7O A;  2E33 A;  4SBV A;  2RDQ A;  1PIV 2;  1YIP A;  2XLF A;  2IC1 A;  1OA4 A;  3VBF B;  4ZZ8 A;  2D6K A;  3J7N A;  4YM1 A;  4CDQ A;  1LAJ A;  4UDJ A;  1MEC 1;  1G6N A;  2WAB A;  2B46 X;  3JQX A;  5LB6 A;  4XJW A;  4AR2 A;  1PHM A;  5F5C A;  1VBB 2;  1RUG 3;  2ZEZ A;  1GNZ A;  1UY0 A;  1W8H A;  2K2S A;  4LIT A;  3WW2 A;  5FV3 A;  4GWJ A;  2VW1 A;  1PZ9 A;  2GAL A;  1ENQ A;  2VME A;  4HZF A;  2R04 2;  1FT9 A;  3H42 B;  5EXO A;  1OT5 A;  1H4G A;  2PQS A;  3I4I A;  5FOJ B;  5DPN A;  3ZFG B;  1AJK A;  1LB2 A;  1QMJ A;  4HT1 T;  2ZEW A;  5AVP A;  4NRP A;  1LOF A;  1MS3 A;  2WZR 3;  5FQ0 B;  5JXI A;  4Q1R A;  2DVG A;  4CSW A;  4CU7 A;  3M3C A;  3VDB A;  2SBA A;  3AYA A;  1ZBA 3;  3T3Y A;  4EN0 A;  5IWF A;  1PO2 1;  1RIT A;  4BB3 A;  2YFT A;  3SCH A;  1TME 3;  3GF6 A;  2W68 A;  4CUG A;  2RM2 1;  3VSR A;  2VO5 A;  1H30 A;  4TN7 A;  2QQM A;  4BIF A;  1H0B A;  4L99 A;  4KH9 A;  4S2H A;  1J3P A;  4FT8 A;  3VSZ A;  2LRO A;  3H0O A;  4AVA A;  4HN0 A;  4N53 A;  3RZZ A;  2VM9 A;  4K20 A;  3VGI A;  2P3J A;  4CP1 A;  4COV A;  3N7J A;  4UFK A;  2BWC A;  4QX3 A;  1NAE A;  1RVF 3;  2CAU A;  3HAG A;  2F4P A;  1OF3 A;  5BNO B;  2ZCW A;  4FAH A;  2D6M A;  3WDT A;  4FOQ A;  4IE0 A;  3D5Y A;  5SV5 A;  3NNF A;  3B00 A;  5CAD A;  3WSO A;  5DUU A;  4HBN A;  2YFZ A;  3MW3 A;  2DUQ A;  1OA3 A;  1VBE 3;  4M0N A;  2DCZ A;  1Q8O A;  4YLZ A;  2H6C A;  4B7E A;  4IE7 A;  3HOB A;  3UNP A;  1W0P A;  4KU8 A;  3WT3 A;  2RS1 1;  4CP9 B;  1S1A A;  1IPS A;  4AGG A;  3H8U A;  2RM2 3;  3M3I A;  1D4M 3;  3PUR A;  1UU5 A;  2WNU C;  4P9J A;  4Z92 B;  4CE8 A;  2VOW A;  4AI3 A;  2R0H A;  3UJQ A;  5CFC C;  5D8A A;  2QZ3 A;  2RDS A;  4Q26 A;  5FZD A;  3ZFE B;  4NID A;  4AVV A;  4WV8 A;  4LHL A;  1R08 2;  4YGB A;  4A7Z A;  5J3U A;  1H6Y A;  1BK1 A;  1D0G A;  3E6B A;  3OPZ A;  4RGG A;  4UFI A;  2VCA A;  1O4Y A;  1OC1 A;  2A73 B;  3BIW E;  4NRQ A;  4TLG A;  2HWB 3;  3WNN A;  1KJL A;  2GC1 A;  2VCC A;  4CUA A;  4V2V A;  3CJI B;  4CUC A;  3RI9 A;  2VGD A;  4PLO A;  5K0U A;  5DAV A;  4EWA A;  3D5O A;  1FYU A;  4AED A;  1E5H A;  1LHW A;  1VLN A;  1H8T C;  4A6O A;  1SDW A;  1JYI A;  1UOF A;  3PVB B;  3EHK A;  2C0Z A;  4XMI A;  1ZX5 A;  1CJD A;  2WR9 A;  3AP6 A;  4UFM A;  2OZ6 A;  5SV8 A;  2EXK A;  3NV3 A;  2RMU 3;  2DCY A;  3ZO0 B;  4LMF A;  4M0H A;  1H2M A;  2H6B A;  4CXW A;  1OD5 A;  4UYB A;  3WQ1 A;  4XAC A;  1OPO A;  1BKZ A;  4P5H A;  4O9E A;  3UJO A;  4BE3 A;  2IVI B;  1Q56 A;  3RPQ A;  1MQT C;  3P3P A;  1R64 A;  2ARC A;  2WWU A;  4CEY B;  5T5L A;  4IEO A;  5ERL A;  4AW7 A;  2WFF 3;  5L36 A;  1WLD A;  2VUC A;  1US3 A;  4L92 A;  2HEW F;  1AL2 1;  4WVM B;  4DO0 A;  4CDW A;  1R1A 1;  1OOP C;  1GZC A;  3HBZ A;  3CZJ A;  3RWK X;  5EPA A;  3JBG 1;  4I3G A;  4CA9 A;  5I0S A;  2J1V A;  2AAC A;  1SLA A;  2IWG B;  4GAZ A;  2YU1 A;  2LRP A;  3AYE A;  4KQ7 A;  4FSJ A;  3WG3 A;  2C5D A;  2RDR A;  4KI5 M;  4C1W A;  2WO2 A;  2BGC A;  5FY9 A;  1UW8 A;  1LNS A;  3IPV B;  3LIG A;  3LSD A;  3BTZ A;  3PL0 A;  2R06 1;  2D3P A;  1Y9M A;  4UW5 A;  5IVB A;  4KMI A;  1Y43 B;  1RMU 2;  4FXK B;  2X5I A;  4DEQ A;  2UU8 A;  1ZA4 A;  2JG8 B;  2QQO A;  5KXE A;  4OLL A;  1TNF A;  1CPN A;  4LBK A;  4LUL A;  1X33 A;  3SKJ E;  1RUF 3;  2IXK A;  3VLB B;  1WUV A;  3AMM A;  3LDB A;  1LCL A;  3WW3 A;  3VL8 A;  4W65 A;  5C33 A;  2ARB A;  4B7K A;  1WD3 A;  5FZ3 A;  4WVW A;  3R4Z A;  2ES3 A;  2K0G A;  5HPO A;  3PVE A;  1ULP A;  1JHJ A;  1ND2 A;  3VZK A;  4CPB D;  3AFG A;  3H3Z A;  1R1A 3;  2Z4F A;  3OYW A;  5FYU A;  4UAP A;  4AAX A;  5J36 A;  4IND A;  2ET1 A;  2WO7 A;  4PVI A;  3JBG 3;  2HWE 3;  2QQU A;  1O3R A;  5LBF A;  3S0M A;  1MVQ A;  2PHL A;  3RYP A;  4TSV A;  2RG4 A;  4IEP A;  2VUJ A;  2O0O A;  2RHP A;  5A7Q A;  1OQD A;  1WME A;  2HKX A;  4IV3 B;  1MZE A;  4ATF A;  2DVB A;  4M01 A;  4GJZ A;  1DGR A;  1JOD A;  2LW8 A;  2ZKL A;  5LZ6 A;  3HNB M;  2R1D A;  2R06 3;  3R4U A;  1W8O A;  2YYO A;  3BPZ A;  4MXW B;  3POE A;  4IGO A;  1ZRE A;  1ZZ8 A;  2ILM A;  4GB3 2;  4MGZ E;  2LS6 A;  4KG8 A;  3MUZ 1;  5LK7 B;  2BVB A;  3OGR A;  3RI8 A;  1LJ7 A;  3WP6 A;  5LY1 A;  1VAK A;  4OMC A;  3H8O A;  4CVU A;  3QOP A;  3GBG A;  4IDZ A;  4R8H A;  1UOJ A;  1VKD A;  4B29 A;  3BTX A;  5DUW A;  5ACA 3;  3RNS A;  3BYW A;  1CPM A;  4JGZ C;  1GFF 2;  1TZO A;  5BUV A;  3ACF A;  4O8P A;  2JDY A;  4IL7 A;  3ZM8 A;  5AFE A;  2AC1 A;  1W6N A;  1RUE 3;  4HPK A;  3D4K A;  4FFG A;  3LEK A;  1VMF A;  4AHY A;  2H0B A;  4MO3 M;  5GAL A;  4PBO A;  3PLQ A;  1IPK A;  3ZKY A;  3RSJ A;  1WW4 A;  3A4U A;  1VPH A;  3AP4 A;  2MPF A;  5FYB A;  4ATE A;  1X8E A;  1CAV A;  4XUO A;  3HVD A;  3KHB A;  3T1L A;  3QC2 A;  4FPO B;  3H50 A;  2RS5 1;  1KD7 A;  3AKT A;  2DCT A;  3IKW A;  2ZGN A;  3SKV A;  1F9K A;  3WPZ A;  4RHV 2;  2NPI A;  4QX7 A;  3LV4 A;  3FL7 A;  3NNJ A;  5LBC A;  1OHF A;  1TL2 A;  1C8N A;  3WNK A;  4Q4X 1;  1F8V A;  4QPG B;  1G7Y A;  2GP3 A;  3LA7 A;  1EP0 A;  4YZ3 A;  5DDJ 3;  5T5P A;  4YZ4 A;  1AR8 2;  1XND A;  2VY0 A;  2VW2 A;  2PYT A;  3NWK A;  4XFB A;  4UDK A;  5C3O A;  2ZA9 A;  4XC9 A;  4FFI A;  2RS3 1;  1OMI A;  4FVV A;  1UQX A;  1K5M A;  1QQP 1;  3R6S A;  1JUH A;  4D8M A;  3SC7 X;  4LOT A;  4YRD A;  1SBE A;  2RE9 A;  4GA9 A;  3WAT A;  2WNU A;  4RN5 A;  4XFA A;  3OGG A;  1LKN A;  1C3H A;  5CFD C;  5EIY B;  1A8M A;  2VU9 A;  3ZXG A;  2C4X A;  5CFC A;  1COV 2;  5JZG C;  1IS6 A;  1DQ0 A;  2DTW A;  2VQ0 A;  4XFF A;  1SLL A;  5LCW L;  5DXD A;  2XR4 A;  5A33 A;  1N1S A;  2O1Q A;  3HT2 A;  3JXS A;  4DUW A;  1MZF A;  4BQ3 A;  2XON A;  3CHX A;  2RS5 3;  4ARY A;  3OBT A;  3MHZ A;  4ORF A;  2PLV 1;  4PI0 A;  4AVS A;  1HXS 2;  5ANN A;  5GLM A;  5AVA A;  2WC2 A;  2ZMK A;  3B02 A;  4Z2W A;  4OMD A;  2YC2 A;  4XJU A;  5DAQ A;  2XVL A;  4ZON A;  1XOY A;  1H8T A;  1STM A;  4R4X A;  1S0I A;  2OYZ A;  2VQA A;  4K9S A;  3ZFF B;  1E5I A;  2QQN A;  3ZSL A;  3LCP A;  4DQA A;  2OZJ A;  2VMC A;  2QQL A;  4LEJ A;  1FPN 3;  3ZYP A;  1UX6 A;  1Z7S 3;  2WIN B;  5BNN B;  3J8F 1;  4Q4V 1;  5FZC A;  1D2S A;  1N47 A;  3WP4 A;  2W5F A;  1OLM E;  2QUO A;  4NOT A;  3T2O A;  3I2H A;  4BK4 A;  1OVP A;  1O5U A;  4JHZ A;  4CP0 A;  1MQT A;  1H1M A;  2B9V A;  1O59 A;  4FPY A;  1ZBE 2;  2D6N A;  4YYO A;  2CGP A;  4Z07 A;  4RL7 A;  5HXV A;  3KM5 A;  1CZV A;  1IS5 A;  3LB9 A;  4UDG A;  2VZ3 A;  3KB5 A;  2XVG A;  1YCI A;  1OOP A;  1Q3E A;  1RGS A;  1YO8 A;  1AVB A;  3AKR A;  3N9N A;  3VZL A;  1PX4 A;  1J1L A;  1VRH 2;  2CY6 A;  2QDN A;  1LU2 A;  1SQ4 A;  1KXG A;  4AXO A;  3WW4 A;  3OUH A;  1PIV 1;  4N9H A;  4LTA A;  5A7S A;  1W6Q A;  2XKP A;  1NKG A;  1GP6 A;  1YLL A;  4XFG A;  2ZGS A;  3I2D A;  4I0A A;  1GWM A;  1MEC 2;  2QDR A;  3D82 A;  3B9C A;  3PUI A;  2HEY F;  5LW9 A;  2UWB A;  2ZTN A;  4MX3 A;  5FK7 A;  2NLR A;  3P1I A;  2JIG A;  2W91 A;  4HG6 B;  4M3C B;  2X05 A;  5A3P A;  4GWN A;  1YYN A;  3ZXE A;  5IAV A;  1WA6 X;  3J8F 3;  3H7Y A;  4YW7 A;  5A7W B;  5T50 A;  3JD7 2;  2R04 1;  1RUI 3;  4MET A;  3TNQ A;  5FPZ A;  4OHV A;  3RJR A;  2FDI A;  1XBF A;  4H2A A;  1RUC 3;  1RUH 3;  1CAU A;  4OHW A;  1LHO A;  4SLI A;  4YVS C;  5T52 A;  4DUX A;  4XF1 A;  3RMY A;  1PNF A;  5FRE A;  3N9L A;  3WP3 A;  1BZW A;  1FMD 3;  5C3Q A;  4CUB A;  2D3R A;  3VDD B;  1CAW B;  5KXC A;  4D7T A;  5C0P A;  2BWA A;  4S2D A;  5L73 A;  2GH8 A;  3K4A A;  4FBF A;  1PO2 2;  2CTV A;  2ZX0 A;  3DV8 A;  3IM0 A;  3OPT A;  4LOR A;  3BI3 A;  3E97 A;  2BRT A;  2BUK A;  2W47 A;  5FYZ A;  4QXH A;  3OUI A;  2WSV A;  1AHS A;  4MUV A;  4KWJ A;  4AQT A;  1YQ6 A;  1AR7 1;  4IV1 C;  4NJ4 A;  4QD2 A;  1EY2 A;  3VZO A;  1VBB 3;  3BU7 A;  4MHU A;  1C57 A;  2HBT A;  3DXU A;  3KV9 A;  2Z69 A;  2GDF A;  4G4F A;  4OUM A;  3I3D A;  5A6Z A;  2ZGQ A;  2VZV A;  3DXT A;  4HXC A;  2R49 A;  4OI2 A;  2RJK A;  5IFP A;  5IHR A;  5CKM A;  1G9F A;  4XE9 A;  2A3W A;  3EBR A;  3IMN A;  2MEV 2;  3OGS A;  1V9U 2;  4K1Z A;  5TSW A;  1VAM A;  4OFG A;  3IMM A;  4PLM A;  1VBA 3;  5IVV A;  3RVH A;  3MLJ A;  2VXR A;  4N2R A;  2VUD A;  3I2K A;  2GU9 A;  1W2O A;  3ME2 A;  1IKQ A;  3QD6 A;  1W6P B;  3I59 A;  4JGZ A;  2Y6L A;  1FAY A;  1W99 A;  2IXL A;  3LE0 A;  2PAE A;  5KBF A;  1AX1 A;  5FRA A;  5J1X A;  3T30 A;  4DRV A;  2PTM A;  4DXT A;  4WM8 B;  3LEM A;  1UMZ A;  3I7D A;  3K4D A;  5A6X A;  1Q8S A;  5BYN A;  4U36 A;  1XYP A;  2BVV A;  3ES4 A;  4UOJ A;  5IYY A;  3WMZ A;  4IET A;  4D69 A;  1HIX A;  1WW5 A;  1ND3 C;  1J1T A;  3IN9 A;  1QJY 3;  1QJU 2;  3OPW A;  4WBB A;  3QEE A;  4XQ4 A;  1R08 1;  2L9L A;  3AK0 A;  3WIN E;  5KXD A;  1NCQ B;  4NHK A;  2J1R A;  4HAN A;  3E1F 1;  2VTX A;  3IIA A;  3ATG A;  2UWC A;  4RSU A;  5HCB A;  1F2N A;  2CV6 A;  4M00 A;  4XUP A;  3CLP A;  3SIT A;  3GDB A;  4DXZ A;  1W3V A;  1YI7 A;  5JMC A;  3OM4 A;  2FBE A;  3GZA A;  1UV4 A;  1BVV A;  5C5T A;  3OCP A;  1JMU B;  1QKQ A;  3WQB A;  5LRS A;  5A7V A;  2Z2S B;  4LNV A;  4IEY A;  4XPV A;  1JHN A;  4A2U A;  5IUQ A;  3NAP B;  4Y1Z A;  4Q4W 2;  5A6Q A;  5GM0 A;  3OEB A;  4UI9 L;  1N3Q A;  5FYS A;  2D6L X;  3O5S A;  1SBD A;  2J1S A;  5F2S A;  2QTW B;  3PVO A;  1BLZ A;  2JDA A;  4LE3 A;  1TQ5 A;  1V6O A;  5DQ0 A;  5HCF A;  5CFD A;  1LOA A;  4FTE A;  1UKG A;  4W6X A;  5T5O A;  5JZG A;  4A45 A;  5A3N A;  2VL4 A;  5FYV A;  4BLI A;  4XCA A;  1NA1 C;  4Y20 A;  4BOW A;  3POI A;  2P17 A;  2DVA A;  2D7F A;  1AL2 2;  5FMD A;  4RR3 C;  1ONA A;  3H8X A;  3AZV A;  2Q1F A;  1OKO A;  4O8O A;  1HRI 2;  3VBS B;  5J98 B;  5H9P A;  3U1X A;  4O7X A;  4AGV A;  4E27 A;  5AC9 3;  1H1A A;  1SHW B;  4PCR A;  4GH4 C;  2BU9 A;  3LOB A;  4AVT A;  3AB0 A;  5BNP C;  1AXK A;  2VTX J;  1EAH 2;  1ENS A;  2A71 A;  4BPZ A;  2PEL A;  1HB1 A;  4X6R B;  1OQ1 A;  2FCU A;  1YFW A;  2TNF A;  3VSF A;  1OD3 A;  4HVQ A;  2EIB A;  3SNM A;  4AQ2 A;  1GZW A;  2A5Z A;  5ABJ B;  4QWN A;  3VBF C;  4JDO A;  3IBM A;  5FP3 A;  2VCB A;  2YZ4 A;  1AF9 A;  2ZX1 A;  4ZXE A;  5F9T A;  1J59 A;  3KS7 A;  1MPX A;  2FDK A;  4Q8K A;  1SCR A;  3CEW A;  1W6M A;  4I0B A;  1CIW A;  3WQ7 A;  1VBD 1;  1AR6 2;  4LQR A;  5CIS A;  2OUJ A;  4MLG A;  2W1S A;  3OY8 B;  3IWZ A;  3S30 A;  2RR1 3;  5J7M A;  4XQW A;  4YM2 A;  5LA2 A;  4EE2 A;  2WT2 A;  1GU3 A;  1XJA A;  3ALQ A;  3DYM A;  3VZM A;  3HPN A;  2BER A;  2XBO 3;  1B35 B;  2CGN A;  3B7M A;  1JN2 P;  5JR7 B;  2ADD A;  1YUD A;  3OGV A;  3I54 A;  1OUS A;  1SLC A;  4QU2 A;  1UAI A;  2WAO A;  5JI9 A;  3ZSM A;  3LWC A;  3WDV A;  3ZX7 A;  1OYG A;  2HWC 1;  4MGS A;  1RMU 3;  4P9L A;  5F32 A;  3AKF A;  1YQ5 A;  2PFW A;  4E4D X;  5FY8 A;  1OA2 A;  4GB3 1;  3SH4 A;  4MXV A;  4ASM B;  3WNX A;  2J1E A;  1JH5 A;  4BYY A;  2CYF A;  4HLT A;  1I3H A;  4GJY A;  2YXS A;  3GHN A;  4HKW A;  1AYM 3;  4B4R A;  1LU1 A;  4WZC A;  1A3K A;  5CKN A;  3CKH A;  2VDT A;  3WMY A;  4UF0 A;  1Y3T A;  2PHF A;  4H14 A;  1LOG A;  3MID A;  3AP7 A;  4AOC A;  4CTE A;  3HN3 A;  3NL1 A;  4QKD A;  5KR7 A;  2ZXQ A;  1NLS A;  2WAA A;  2WLQ A;  2ZGR A;  4FCA A;  3Q8B A;  3WOG A;  3J26 N;  2VH9 A;  2R07 3;  4CCJ A;  1OH3 A;  1CON A;  5C8C B;  2WWS A;  4IV1 A;  2WFP A;  4OUE A;  1CAX B;  3HMY A;  5DAB A;  4JQT A;  5A32 B;  1QH6 A;  3K3O A;  1AYN 1;  3ZDS A;  2GSY A;  5E16 A;  5FY1 A;  4QX8 A;  5FZO B;  4AFM A;  4BMB A;  3USU B;  4GB3 3;  3FUQ A;  2W95 A;  2Y64 A;  2ZHN A;  4XFC A;  5GZD A;  4Z82 A;  3VKO A;  5FCC A;  1NG0 A;  4ISQ A;  2WZP P;  2DWR A;  5JPN B;  1HLC A;  2OII A;  4AED C;  5G05 L;  1NUK A;  3OF1 A;  1U0A A;  4Y5T A;  5IVC A;  2IFR A;  2GH2 A;  3A7Q A;  3U10 A;  2CHH A;  3AZX A;  3U11 A;  3OM6 A;  2D40 A;  5LY2 A;  1C5I A;  5C9A B;  2YBK A;  3WUD A;  1PO1 2;  3CJI C;  5FMB A;  1O4Z A;  1QQP 2;  1F15 A;  2XLA A;  3DUI A;  4GD4 A;  4BQ5 A;  4X8N A;  2E6V A;  2VE1 A;  1NLQ A;  5DMY A;  4IEZ A;  3VD4 A;  1ND3 A;  3K46 A;  3ACL A;  3N7K A;  5FO9 B;  3UYJ A;  4L8Q A;  5FPA A;  5J48 A;  3O12 A;  5A3M A;  3H8R A;  3T2T A;  5J37 A;  2Q8C A;  4QXK A;  4CDW C;  4NO4 A;  4BXF A;  4IE4 A;  1H2N A;  1YNA A;  3VKM A;  3NQH A;  1ENX A;  1KS5 A;  4RHV 3;  1QY4 A;  4D7S A;  2BFU L;  4LKE A;  3EJK A;  5CG8 A;  1POV 3;  3BUC A;  1GYH A;  4Z2A A;  4HVO A;  5IVY A;  4Y1U A;  4ET7 A;  3VZJ A;  1WBF A;  1DF0 A;  2R6Q A;  2B5H A;  4R9C A;  5KHH A;  1AR8 3;  1CZS A;  5IVE A;  3QEF A;  4PIX A;  4P08 A;  2QBX A;  4AQ6 A;  3WZ1 A;  1W8U A;  4DB5 A;  3VD9 A;  1UZW A;  2XUE A;  4D47 A;  3I2I A;  4CDU C;  4GKY A;  1RXF A;  5E1R A;  1ZNP A;  4XZU G;  3M3Q A;  4CU8 A;  3VV1 A;  4GMP 3; 
#chains in the Genus database with same CATH homology
 4N4B A;  2VZS A;  2J1V A;  1TVG A;  3OM2 A;  3P2N A;  3OBA A;  3HNY M;  3WN2 A;  2QQI A;  1DP0 A;  4KI5 M;  2WO2 A;  3WPV A;  3VD7 A;  1EUT A;  1LNS A;  3LIG A;  5LA0 A;  2YFR A;  4A42 A;  3UES A;  3GM8 A;  1Y9M A;  4KMI A;  3UGG A;  3LIH A;  4DEQ A;  1JU3 A;  1Y9G A;  5FLW A;  1UY3 A;  2QQO A;  2WN2 A;  3OEA A;  1JZ2 A;  2YFU A;  3WF2 A;  4JKK A;  3SKJ E;  3LFI A;  5FMC A;  3NRU A;  4ONZ A;  3R4Z A;  4AK5 A;  5AYD A;  4AG4 A;  5HPO A;  2WDB A;  4QDQ A;  1ULP A;  1JHJ A;  3LPF A;  1JZ8 A;  2Z4F A;  4UAP A;  4AAX A;  4PVI A;  4DUV A;  2QQU A;  4KCB A;  3FN9 A;  2W94 A;  1OF4 A;  2ORZ A;  2Y6H A;  3KST A;  3TAW A;  4UDI A;  1GUI A;  5A8D A;  3ABZ A;  2LW8 A;  3VSS A;  3HNB M;  4P00 B;  2ID4 A;  1W8O A;  1PMH X;  3OM7 A;  3D3A A;  1GOG A;  1UX7 A;  4EQV A;  2LS6 A;  3BGA A;  3MUZ 1;  5JXJ A;  2X8S A;  3OGR A;  3UGH A;  4ZZ5 A;  4M4P A;  3SEP A;  3ACI A;  2VMD A;  4OMC A;  1PT2 A;  3R4Y A;  4CVU A;  1JYV A;  1VKD A;  2VZ1 A;  3T0A A;  3EYP A;  1XNA A;  3IAP A;  1O8S A;  1K3I A;  5FK8 A;  4JX0 A;  1H6X A;  2YG0 A;  4U6D A;  3ACF A;  2VZP A;  3IB3 A;  4O8P A;  3ZM8 A;  5GLP A;  1K42 A;  2AC1 A;  3AKH A;  4FFG A;  3LEK A;  4MO3 M;  2VC9 A;  5FIX A;  4LPL A;  3VT0 A;  2ZEY A;  5GLR A;  4PQQ A;  2QQK A;  5F7U A;  4XUO A;  5GLL A;  5GLN A;  1WCQ A;  4KC8 A;  4AK6 A;  4XUT A;  5A8C A;  4E8D A;  1UY2 A;  3C7F A;  3WPU A;  2WUH A;  3NJV A;  4QPW A;  5B4N A;  2Y6J A;  3SKV A;  5CZK A;  2OKX A;  3WPZ A;  3T09 A;  1SDD B;  3LV4 A;  3I2J A;  3ECQ A;  3FL7 A;  3MBW A;  1XNT A;  3WNK A;  1UMI A;  3HEI A;  2AEZ A;  1CZT A;  4RYD A;  4CU9 A;  1IQD C;  2EXI A;  4UDK A;  2QQJ A;  4FFI A;  3WF0 A;  3FHA A;  1UY1 A;  3WF1 A;  4A41 A;  3SC7 X;  2W1W A;  2V4V A;  1KGY A;  3WAT A;  4IUG A;  5A7V B;  4RN5 A;  1F4H A;  5EIY B;  2OXB A;  2JKX A;  1EUU A;  2C4X A;  3OG2 A;  5JOX A;  3VDC A;  5JOZ A;  5LCW L;  4OYU A;  3K75 B;  4QDR A;  2R7E B;  2VQU A;  2ZEX A;  3JXS A;  4DUW A;  5GLO A;  2XON A;  2VZT A;  4ARY A;  3WF3 A;  3DYP A;  3U14 A;  3ZXL A;  5ANN A;  5GLM A;  2WO3 A;  4QX2 A;  5C71 A;  1YIF A;  4OMD A;  2YC2 A;  5JXG A;  2VZR A;  4E8C A;  3VD5 A;  2QQN A;  2X8F A;  2VMC A;  2QQL A;  4W50 A;  2B4K A;  5JMO A;  3WAU A;  1JZ7 A;  2E31 A;  1YQ2 A;  3W5N A;  4AK7 A;  1UXX X;  2W5F A;  3BN6 A;  4N1I A;  3T2O A;  3SEE A;  4BK4 A;  2RJ2 A;  2Y8K A;  3I2H A;  4COT A;  4JHZ A;  2B9V A;  1O59 A;  4ZY9 A;  2C26 A;  4O8N A;  1XC6 A;  3D61 A;  2EIC A;  1CZV A;  4UDG A;  5EJZ B;  3CU9 A;  2VZ3 A;  1GOF A;  3WN0 A;  1PX4 A;  4PVA A;  5FUI A;  5JUV A;  3BYN A;  2J22 A;  2XQR A;  3HNM A;  4QX1 A;  5G04 L;  1W18 A;  2X8T A;  5AYC A;  2ADE A;  1NKG A;  3VT2 A;  1L7R A;  2YFS A;  3PUI A;  2BBA A;  3MV0 1;  2BZD A;  2ORX A;  1CX1 A;  5FK7 A;  3P1I A;  2XOM A;  2W91 A;  4HG6 B;  2X05 A;  2VR4 A;  3T0B A;  3BYJ A;  4U6B A;  1YRZ A;  1WKY A;  3J7H A;  4DXT A;  1PMJ X;  4QQS A;  3ACG A;  1W8N A;  3PIJ A;  4DUX A;  1UZ0 A;  3LDR A;  4TXW A;  3MUY 1;  4CUB A;  1UYZ A;  5IFT A;  5C0P A;  2YB7 A;  4KCA A;  1OH4 A;  2J1U A;  4QAW A;  2JD9 A;  3GGL A;  3K4A A;  4XVH A;  5JOW A;  2W1U A;  2X10 A;  4FI9 A;  2W46 A;  2W47 A;  5GLK A;  3FHQ A;  2J1A A;  1Y7B A;  3KF3 A;  1UYP A;  3LQC A;  1HN1 A;  2EID A;  4JKM A;  3CZU A;  4QB1 A;  5EJ1 B;  2DCK A;  5JXH A;  4PF1 A;  2C9K A;  5B6T A;  4ARX A;  4BK5 A;  2XQX A;  4LHS A;  2WBK A;  3I3D A;  1JZ6 A;  2VZV A;  4KC7 A;  5DN2 A;  5IFP A;  5IHR A;  3K77 A;  3OM5 A;  3OGS A;  3QZ4 A;  4DXR A;  3MV1 1;  2E32 A;  4MAD A;  3F2Z A;  1JU4 A;  4N2R A;  2EIE A;  3P6B A;  3A21 A;  1D7P M;  3I2K A;  1W9W A;  2Y6G A;  2VZO A;  3THD A;  3LDK A;  4NOV A;  3ACH A;  3I97 A;  2Y6L A;  3BYL A;  1W99 A;  3I3B A;  3OB8 A;  3LE0 A;  5J1X A;  4DEV A;  2VMF A;  1RYY A;  1UYY A;  4A3Z A;  4BDV B;  5HXM A;  3QC2 A;  3LEM A;  3K4D A;  3THC A;  3NJX A;  3WMZ A;  4UOJ A;  5IYY A;  2DCJ A;  1GOH A;  3QEE A;  1T2X A;  2QQV A;  4OZO A;  5AYE A;  2BGO A;  2L9L A;  5FKC A;  4DXS A;  3C8X A;  2VTF A;  4QB6 A;  4M4R A;  4P5Y A;  2J1R A;  3C7E A;  5IJR A;  3T0D A;  3E1F 1;  2EXH A;  4XUP A;  5C70 A;  4N2Z A;  3GDB A;  2W87 A;  1YI7 A;  5FKB A;  5C7G A;  3OM4 A;  1UMH A;  3CQO A;  1K45 A;  1GNY A;  4GZ9 A;  1UV4 A;  1GYD B;  2V5D A;  3WQB A;  2RV9 A;  3CMG A;  5A7V A;  2DDU A;  1J83 A;  4FFF A;  3KF5 A;  3WN1 A;  3LF7 A;  3OEB A;  4UI9 L;  2CDP A;  1K12 A;  3W5M A;  2J1S A;  3DYO A;  3PUH A;  5DQ0 A;  2JDA A;  4QX0 A;  4FFH A;  4LKS A;  1W9T A;  3WNL A;  4A44 A;  4L0P A;  4A45 A;  3WNP A;  2VL4 A;  3C7O A;  3BYK A;  3K4Z A;  2VZU A;  2W9X A;  3NNG A;  5AY9 A;  5GLQ A;  5FMD A;  3UET A;  4P02 B;  3HJR A;  5LA1 A;  3AKI A;  1I5P A;  1NX9 A;  3AC0 A;  4O8O A;  1DLC A;  1DYO A;  1SHW B;  4KMQ A;  1L7Q A;  4TTG A;  1ULO A;  2KD7 A;  2W1Q A;  1Y4W A;  1JI6 A;  3III A;  4CU6 A;  3IAQ A;  3VSF A;  1OD3 A;  2EIB A;  1WL7 A;  1KEX A;  3DEC A;  1US2 A;  4W4Z A;  4XUN A;  3U37 A;  5I0D A;  3D5Z A;  3ETP A;  3U75 A;  4PT6 A;  2VCB A;  4ZXE A;  1MPX A;  3VDA A;  2B4W A;  1J84 A;  1JYN A;  1W2T A;  3T08 A;  3LPG A;  3QED A;  2E33 A;  2WO1 A;  2WZE A;  2W92 A;  1UYX A;  4LQR A;  3VD3 A;  4ZZ8 A;  2JE8 A;  4MLG A;  2W1S A;  1JZ5 A;  4UDJ A;  3MO4 A;  2WAB A;  3WAS A;  4MOA A;  5LA2 A;  2ZEZ A;  1UY0 A;  1GU3 A;  3DYM A;  3HPN A;  2BER A;  4MGQ A;  4GWJ A;  2J7M A;  2VME A;  2ADD A;  3OGV A;  5CYY A;  1OT5 A;  2PQS A;  3CDZ B;  4XUR A;  2WAO A;  3EB7 A;  5DPN A;  1JZ3 A;  1OYG A;  1SG3 A;  2ZEW A;  4MGS A;  5JXI A;  2VQT A;  3AKF A;  4CU7 A;  5JOY A;  5B4X A;  3VDB A;  3GXU A;  2J1E A;  4GWI A;  2QQW A;  4A4A A;  2YFT A;  3VSR A;  4JKL A;  2WQ8 A;  2E26 A;  2VO5 A;  2WYS A;  3CKH A;  2QQM A;  2VDT A;  2J1T A;  3WMY A;  3ZXJ A;  3VSZ A;  2WN3 A;  3HN3 A;  2VM9 A;  1JYW A;  1UWW A;  2W3J A;  3T2P A;  2ZXQ A;  4UDK E;  2WAA A;  2AEY A;  3LEI A;  2RVA A;  1F4A A;  4QX3 A;  1NAE A;  3A23 A;  1UXZ A;  1JZ4 A;  1GYE B;  4OUE A;  1OF3 A;  2HYX A;  4XUQ A;  3PIG A;  3C7H A;  1GQP A;  3D5Y A;  3WSO A;  3LEG A;  2VJX A;  5JR2 A;  2YFZ A;  1P8J A;  3AKG A;  2W95 A;  2Y64 A;  3CIH A;  3VT1 A;  3UNP A;  1ST8 A;  3HOB A;  3D60 A;  3WNM A;  3T2Q A;  2V72 A;  4QB2 A;  1W0N A;  5G05 L;  1NUK A;  2Y6K A;  3A7Q A;  2EXJ A;  4BJ0 A;  2VOT A;  5B6S A;  3OM6 A;  3WEZ A;  2YC4 A;  2HLE A;  2X09 A;  1XPW A;  5FMB A;  3I3E A;  3UGF A;  1H6Y A;  4YPJ A;  1PX3 A;  4BXS V;  1UY4 A;  2VCA A;  3I2G A;  3A22 A;  5DMY A;  3VD4 A;  3C7G A;  2VCC A;  3WNN A;  4CUA A;  2WZ8 A;  3K46 A;  4CUC A;  3C2U A;  1JYX A;  3WNO A;  4W8J A;  3R67 A;  4QDS A;  4A6O A;  3WF4 A;  2EXK A;  3WPY A;  2BGP A;  3ZXK A;  3NQH A;  1GYH A;  4Z2A A;  2CDO A;  1GMM A;  5A1A A;  4KWU A;  4D8M A;  4ET7 A;  3RWK X;  1TG7 A;  3K1U A;  1BHG A;  2VZQ A;  1CZS A;  1R64 A;  3QEF A;  1W9S A;  4P08 A;  2QBX A;  3VD9 A;  4D47 A;  1US3 A;  3I2I A;  3I2F A;  3IDA A;  4D0Q A;  2XHN A;  1O8P A;  4XZU G;  4CU8 A;  1CIY A;  3CZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...