3C7FA

Crystal structure of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis in complex with xylotriose.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
487
structure length
487
Chain Sequence
ATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
publication title Structural analysis of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase in complex with xylotetraose reveals a different binding mechanism compared with other members of the same family.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 135
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c7fA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3c7fA02
1DYOA 1O8SA 3I2GA 3K4DA 5AYDA 5GLLA 2QQNA 2X8SA 2XOMA 2EICA 2RVAA 5EJZB 2W1QA 3DYMA 3OM5A 2BBAA 3P1IA 3LPGA 3LIHA 3OEBA 5GLQA 1W2TA 5IJRA 4E8CA 4KMQA 1Y9MA 2ZEWA 2W46A 2VDTA 5AY9A 5C7GA 1K3IA 1OT5A 5LA2A 3VD9A 5HXMA 3C7EA 1GYHA 3C7FA 5DN2A 3VT0A 3LPFA 5B4XA 5A7VB 4DXTA 3WPVA 4MO3M 1SDDB 4UI9L 4BDVB 3A23A 2X8FA 4OYUA 4D0QA 1W8OA 3J7HA 1JZ3A 4FFGA 3WQBA 1XNTA 4JX0A 2OKXA 3OM2A 4OUEA 3LV4A 3CIHA 2JE8A 4KCBA 2ZEZA 3FHQA 2XHNA 3KF5A 3AKGA 4OMDA 3T0BA 3VDAA 2Y6LA 4AK6A 1DP0A 4O8PA 1GYEB 1D7PM 3WF4A 2J1SA 2Y6GA 3UGGA 2R7EB 1VKDA 4GZ9A 1ULOA 4YPJA 3FL7A 3AKFA 5FLWA 3CDZB 4D8MA 4MGSA 4XVHA 1JU4A 2AC1A 1W99A 1EUTA 3I97A 3LEGA 3R4ZA 3CQOA 4ZY9A 3BYNA 4DXRA 2X10A 2ORZA 4CUAA 1NKGA 5FMBA 2WAAA 5B6SA 3VT1A 2VMFA 4AG4A 3CU9A 2WN3A 2VC9A 2VL4A 2VZSA 5GLKA 4GWJA 3BGAA 2W1SA 3FHAA 4LHSA 1YIFA 4P02B 2B9VA 2XONA 4FFFA 3I3BA 4W4ZA 2W5FA 4JHZA 3T09A 5FMCA 4N1IA 4DUVA 5FIXA 2JD9A 3C7HA 3MUZ1 2OXBA 2VZQA 3WMZA 4PT6A 2Z4FA 4NOVA 4QDRA 4QAWA 2ZXQA 3VT2A 2VZRA 3D61A 3RWKX 5FK8A 2QQOA 3LEIA 3WN0A 2XQXA 1UY4A 1UY1A 1ULPA 2YFSA 3C2UA 4RN5A 3ACGA 2WABA 1Y7BA 4MGQA 4XUQA 1UY2A 1GU3A 3HNBM 2J1RA 4CVUA 3A21A 3ZXKA 5IYYA 1H6XA 2KD7A 3W5NA 2J1TA 2WO3A 4A6OA 4UDKA 1I5PA 1UXXX 3WEZA 3NNGA 1XC6A 3CMGA 2EXIA 3IDAA 2VZOA 5HPOA 2VMDA 1OH4A 4LQRA 2X8TA 1F4HA 5CYYA 3K4AA 3SEPA 3T2PA 2EIBA 1J84A 5FK7A 1PMJX 4JKLA 4N4BA 1K12A 3NRUA 3VSZA 4GWIA 4QB1A 3R4YA 2X05A 2W9XA 2VZ1A 2VM9A 1GUIA 2E32A 2J1VA 3PUHA 1OYGA 3A7QA 2EIEA 2VZUA 2CDPA 2YG0A 1CZVA 3WPUA 4QDSA 1NAEA 4DUXA 3I2JA 4BK4A 5ANNA 1O8PA 2YC4A 5A7VA 1UZ0A 2YFRA 4KMIA 2YFUA 4IUGA 2WYSA 1GYDB 2X09A 1JI6A 1UYXA 1GQPA 1CZSA 2EIDA 5FKBA 3C7OA 5JXHA 4QX0A 2WQ8A 4XZUG 3WN2A 4A4AA 3UGFA 3WPZA 2QQVA 2ZEXA 3HN3A 2W3JA 4QB2A 3QEEA 4DXSA 1Y9GA 5JOXA 4UAPA 3IIIA 2ORXA 3SKVA 1JZ8A 2ADDA 2ZEYA 1SHWB 1WCQA 2WAOA 3K46A 4CU7A 2BZDA 2QQKA 3I2IA 3VDCA 4AK5A 2J1UA 3UNPA 3AKHA 2DCJA 2PQSA 3HNMA 4FFIA 3K1UA 5GLRA 4QX1A 3U75A 2YFTA 1JYVA 5I0DA 4XURA 3GM8A 2WO1A 5C71A 2VZVA 3P2NA 3D5YA 2V4VA 3VSFA 2WUHA 3OG2A 4P5YA 3VDBA 2E33A 3UESA 3HPNA 4MOAA 3WPYA 2DCKA 2W1WA 1PT2A 2VTFA 4N2ZA 5A8DA 3BYLA 3OM4A 4XUPA 3HEIA 2W95A 1IQDC 2Y6KA 2JKXA 1GNYA 4XUNA 3QEFA 1W9WA 3WATA 3CZJA 2WZEA 5FKCA 3UGHA 3AC0A 2BERA 5B6TA 2C9KA 3MUY1 2VO5A 2YB7A 4A44A 3LDRA 4UDIA 3DYPA 3K75B 3TAWA 3OEAA 4P08A 4QDQA 1Y4WA 3VD5A 3NQHA 2Y8KA 3LF7A 5AYEA 3MV11 1JYXA 2V72A 5LA1A 4W8JA 3T0DA 4RYDA 3HOBA 2W87A 3U37A 2B4KA 1L7QA 5FUIA 1XPWA 4Z2AA 3SC7X 3SKJE 1L7RA 5JXIA 3WAUA 3VSRA 3WMYA 4A3ZA 4DEQA 4LKSA 2QQUA 4ZZ5A 3PIGA 1TG7A 4XUTA 3KF3A 2E31A 4PVAA 3ABZA 2W94A 3NJVA 4OMCA 1SG3A 2C4XA 3EB7A 1GOGA 4COTA 3D60A 4HG6B 3OGSA 3HNYM 3IAQA 1YRZA 2YC2A 4UDJA 4O8NA 5JXJA 1PMHX 4KC8A 2QQWA 2J1AA 3I3DA 1K45A 1OF3A 3I3EA 5GLPA 4QPWA 2VZTA 3C8XA 2J7MA 3WF1A 3ACFA 5JMOA 4L0PA 1UYPA 5DQ0A 2AEYA 3WN1A 4OZOA 4AK7A 3OGVA 3T0AA 3ZXLA 5G04L 1JYNA 2AEZA 5LA0A 4QB6A 1BHGA 4CU8A 2VCCA 4TTGA 2VCAA 5FMDA 3WSOA 4LPLA 2VOTA 3T08A 3P6BA 4EQVA 5CZKA 4CUCA 4PF1A 1NX9A 3THDA 2CDOA 1JZ4A 3U14A 1F4AA 1UWWA 2B4WA 5G05L 3AKIA 2W47A 4CU9A 2Y6JA 1WL7A 5JR2A 1UYYA 2VQUA 1DLCA 2DDUA 1UYZA 4PVIA 1US3A 2W91A 1XNAA 1UY0A 3LDKA 1O59A 1W18A 5LCWL 2WZ8A 2QBXA 3T2QA 4JKMA 1NUKA 4CU6A 3THCA 2EXJA 4AAXA 4ONZA 5GLOA 3OB8A 4U6DA 3ZM8A 1K42A 2L9LA 1JYWA 3KSTA 3WNOA 3WNMA 1UMIA 1JHJA 3QC2A 5IFTA 1WKYA 5AYCA 5DPNA 2QQIA 3ZXJA 4QQSA 1JZ5A 1KEXA 4BK5A 3WNPA 1MPXA 2RV9A 2VR4A 5IFPA 1ST8A 4UDGA 2E26A 3WNLA 3GDBA 4FFHA 3I2KA 4U6BA 1T2XA 4XUOA 1W0NA 5JOWA 2W92A 1J83A 3NJXA 2HYXA 2V5DA 5IHRA 3DYOA 3OM6A 2BGOA 1JZ2A 4KCAA 3LEMA 3CZUA 1W9TA 4N2RA 5JOZA 4D47A 1UV4A 3GXUA 1JZ6A 3PIJA 2JDAA 3VD4A 1GMMA 5A1AA 2VMEA 3WASA 4KC7A 4MLGA 3E1F1 3WF0A 3MBWA 2C26A 3WNNA 3A22A 4ET7A 1H6YA 3PUIA 5EJ1B 2LW8A 2QQMA 1YI7A 1PX4A 4M4PA 3VSSA 4KWUA 1YQ2A 3ECQA 1LNSA 2RJ2A 2VZPA 3WNKA 3F2ZA 1JZ7A 5GLMA 1GOHA 1UXZA 5J1XA 4BXSV 1CZTA 4W50A 4P00B 4UOJA 5B4NA 3BYJA 1HN1A 2Y6HA 3CKHA 4ARXA 4QX3A 1UMHA 3MO4A 4JKKA 1CX1A 2VCBA 3W5MA 4O8OA 3OBAA 2HLEA 3ACIA 1CIYA 4QX2A 3K4ZA 3VD7A 2W1UA 3LIGA 2VMCA 4M4RA 2EXHA 2J22A 5A8CA 2BGPA 3DECA 3FN9A 3K77A 5JOYA 4UDKE 1PX3A 3MV01 3OGRA 5JXGA 4BJ0A 2XQRA 3OM7A 3ACHA 2QQLA 4A45A 3D5ZA 4PQQA 5EIYB 1US2A 1W9SA 1R64A 5C0PA 1JU3A 1OD3A 1P8JA 3GGLA 4ARYA 2WO2A 5GLNA 3BYKA 3I2FA 3ETPA 3D3AA 1EUUA 1KGYA 3JXSA 3QZ4A 1UX7A 2QQJA 4E8DA 3LQCA 1GOFA 3WF2A 1RYYA 4FI9A 3BN6A 1UY3A 4KI5M 2WDBA 1TVGA 2ID4A 3IB3A 3SEEA 4DUWA 5JUVA 3IAPA 3HJRA 1OF4A 2VZ3A 2WN2A 3WF3A 3LE0A 5DMYA 3EYPA 4TXWA 4A42A 3UETA 4ZXEA 4A41A 4MADA 5C70A 2EXKA 2YFZA 3LFIA 2LS6A 2J1EA 2ADEA 4DEVA 3R67A 2VJXA 2Y64A 3C7GA 3VD3A 3T2OA 4ZZ8A 3I2HA 1W8NA 2WBKA 3LEKA 2VQTA 5F7UA 3QEDA 4CUBA
chains in the Genus database with same CATH superfamily
3ZSEA 3AVSA 2FDFA 1ZA7A 1QJZA 3K4DA 2TNFA 4RFT0 2K46A 2ZGSA 2WT2A 1CJDA 5LY1A 2RMU1 2X8SA 3MZHA 3H7JA 3WHTA 2W1QA 2VOVA 2WR9A 4JRAA 2BTVC 2CAVA 5HCAA 5GLQA 5BUVA 3OEBA 4D94A 1W2TA 4RR3C 3AZXA 4NPLA 4CXWA 1W0OA 5KHKA 1BJQA 1K5MC 1Y9MA 3O1UA 1G9CA 1RUF3 1KJRA 5HBAA 3UJOA 4QKDA 4NHLA 1OT5A 1ACCA 1HQWA 2RR13 1WUVA 1YLLA 2DVGA 4K6BA 4NO4A 5LA2A 3VD9A 1QOTA 3C7EA 1CQ9A 2BNNA 5FZBA 1VBD1 3SH3A 3MFCA 3MLKA 4LNVA 2KA3A 4UI9L 1O3QA 1J1LA 1TQ5A 3A23A 3J7HA 5ACA2 5CG9A 4FFGA 3ZFGA 4GH4A 1XNTA 1HXS3 2R49A 1IS4A 1UOGA 2F6BA 2D5HA 3WT3A 3UT0A 5KXBA 2LROA 2HEWF 2VOWA 3CIHA 3L2HA 3RZKA 1SMVA 1AYM2 1UZZA 2ZEZA 4QQLA 2YPJA 3ITQA 4XW3A 3X29B 5T55A 4OMDA 4H7LA 3T0BA 3ZDSA 3ZXGA 4O8PA 1Q8OA 1YIPA 4AI9A 1QXJA 4IE7A 2VH9A 3WF4A 4OHWA 3EJKA 1BVVA 3UGGA 1UPSA 2RS31 4UXAA 2Q8EA 4URAA 1ULOA 3AKSA 1VBE2 1DBNA 4YSFA 3AKFA 5KC5A 3BODA 4D8MA 5KHIA 4AI0A 3WDVA 1JU4A 2AZ5A 2I74A 2AC1A 5AFBA 4LE4A 3I97A 5EV7A 2VMIA 4V2WA 4ES9A 1H30A 4K3UA 4MHUA 1CR7A 4D7YA 4XCBA 5FZ0A 4DXRA 2X10A 1WW6A 2ORZA 4XHXA 5FMBA 2WAAA 5LATA 1SDWA 4UW5A 4PIZA 3KT4A 3VBUA 5IVYA 2WN3A 1PGL1 2VL4A 1PHMA 4IEWA 4M3CA 4GWJA 4ASKA 4CCJA 1CAWA 2JG8C 3VBRC 2XJQA 5FREA 4FO9A 4IE6A 1Y9QA 1YQ8A 2RM21 4P02B 5FV3A 1I1EA 5DDJ1 2WT0A 4FP3A 1WCDJ 2B9VA 1AX2A 1W0PA 3FZ3A 4FFFA 1AR63 3T09A 3RYKA 4Q4V2 3I4IA 4GIQA 1RUOA 2O1QA 3SH5A 1QNYA 4N1IA 5K9YA 5BNOC 1UAIA 4HFSA 3C7HA 3NNLA 5KR7A 1D4VB 1RMU3 1ZZBA 4NAMA 4PT6A 2Z4FA 1VAMA 1YUDA 2I07B 5FZIA 3M3EA 4RR3B 4P9WA 2VZRA 4YGDA 2XJRA 3IWZA 4X6RB 4CXXA 5JPMB 3O1MA 3HT1A 5FLIA 4RS5C 3FWEA 5FQ0A 3R05A 1F35A 2PQQA 4RN5A 3ACGA 1ODNA 1J58A 4MGQA 2YDEA 3ON7A 3HN1A 1QMJA 2HWE3 2Q0AA 2VUCA 4FPLA 4YWAA 3RVHA 4A2UA 1AR73 3KQ4B 2IFWA 3HNBM 4XJAA 3ZXKA 4E4SA 4HSLA 1H6XA 2H6CA 4K9SA 3K48A 4AE2A 3HVDA 3LA7A 1CAXA 4YZ5A 1RVF1 1YWKA 4FPYA 4XF0A 2ZX4A 2JX9A 1X82A 2EXIA 3INAA 2ZJCA 2E7TA 1BBT3 4HETA 3ZYHA 3KHCA 2UWCA 1FOD1 4BYYA 4ZKTB 1RGSA 2C0ZA 2XL7A 3E97A 1SACA 2W68A 3K4AA 4QPGC 3T2PA 1QDCA 2UYBA 1V70A 1HV0A 5T3NA 3RJRA 4CEYA 4N53C 3NRUA 3ZSLA 1O7FA 3OBRA 4UFMA 1STMA 4OI4A 4J1XA 1ZBA1 2LM3A 2VZ1A 4UFLA 1H8TC 3NL1A 3RI8A 1REFA 3PUHA 1ULEA 2GH2A 3A7QA 2ZZJA 4CUGA 1OLME 4A7ZA 5FYCA 1RUI1 1W8FA 3ZSJA 1NAEA 1VRH3 2FDJA 3LB9A 3POIA 3WX5A 4EE2A 1N1VA 4MSVA 1AJOA 2XBO3 3I2JA 3AZWA 3VZMA 1OFSA 5FYIA 4BQYA 5HCHA 4HZFA 3N7MA 2PELA 1LHVA 4IUGA 2K9ZA 1QXRA 1VB2A 2RS11 1GYDB 1JI6A 3DPRC 3VHNA 1CZSA 1FPN2 1QJU1 4P9YA 5C9AC 1BEV1 1WLTA 5ERLA 2NN8A 2JG8B 4LKEA 4XZUG 1R082 3UGFA 3VBRB 3HQUA 3W20A 4A4AA 2QQVA 1LOFA 3BPZA 4LHLA 4OZXA 1ULDA 1KDMA 4QB2A 4DXSA 4ONUA 1GR3A 2SBAA 2PHWA 3I8TA 4LLOA 4UAPA 2ORXA 3SKVA 1JZ8A 5A3MA 1W6NB 2VBBA 1PGW2 3W58A 4XQ4A 5BNOB 4CU7A 2WNOA 2DF7A 3VDCA 3RZGA 1V6OA 4RSUA 5DUWA 2PQSA 1H4HA 2GMMA 4FFIA 3AZYA 3Q8CA 3SCGA 2GALA 1W03A 2EAKA 2R061 4RS5B 1RUE2 4LUKA 4HN1A 1WCSA 1JYTA 1PIV1 1PO11 1QJX1 5C71A 2IVJA 2IXCA 3FFZA 1SLBA 3QH6A 5BV6A 5LZ6A 5FMOS 4KWJA 1LOCA 2MEV1 4R52A 2QE3A 3VDBA 1QH6A 1OFNA 1QU0A 2BU9A 1RUC3 2E33A 3UESA 3B01A 3D4KA 1DDLA 2DCKA 1PT2A 5A8DA 3NNFA 2P3YA 1MEC1 5EJ1B 3FBMA 3S0MA 3OM4A 5L36A 3KZ4C 2W95A 2QCSB 1SFPA 2VVFA 4FOWA 4W6WA 1GNYA 3OPZA 2CHHA 4CP9B 1W9YA 2R0HA 4LIUA 4NHXA 2QKDA 1F8VA 2ZHKA 1W9WA 5T5JA 3WQ7A 3V0AB 3QEFA 3WATA 5FKCA 4LBMA 2C9AA 3CNAA 2JDUA 5BY5A 2XJVA 5IAXA 5B6TA 2C9KA 5AVAA 2P2KA 4A44A 2BUKA 3LDRA 4N53B 5I93A 3K75B 4L99A 1V9U1 4UDIA 1GZWB 1QDOA 1VBC1 5EPAA 3IDCB 1DLLA 4P08A 4QDQA 4RR3A 1Y4WA 3VD5A 1ASJ3 2Y8KA 1H8TB 3ZYFA 2OIIA 5IVVA 3P3NA 3CEWA 5IVCA 1LRHA 3LAGA 3NKGA 1CJPA 3AMMA 4F3JA 3O1PA 2RDNA 4G9SB 3U37A 2B4KA 1LOBA 4RHV1 3Q8AA 4Z2AA 3JD72 5FOJB 4OQ9A 3WMYA 2X53S 3VSRA 2ET7A 1H0BA 5HXVA 4YZ1A 4LKSA 1MS9A 2R072 3PIGA 4E4DX 3GJAA 4E2QA 1RUH3 4QU1A 1QWRA 2E31A 3IMMA 5LBCA 4PVAA 2W94A 4OMCA 2NMNA 3DPRB 3OJBA 5C9AB 4COTA 2XUEA 2DVAA 1R093 5E89A 5LBBA 5CIRA 5JI7A 4DRVA 1ZA4A 1TME3 3A0NA 1WGPA 4BWOA 2QQWA 5IK5A 2RJLA 3KCCA 3ZIWA 5F3CA 5M0TA 2RS52 2J7MA 2JE9A 2P5BA 1B09A 3BU7A 2BNMA 3MW2A 3POGA 5FYBA 4H14A 3WN1A 4YM1A 3J4UH 1X9TA 3T0AA 3MIBA 3MLJA 5FBJA 4DINB 3UJQA 2VCCA 2VQ0A 3M4FA 4L9BA 3OOXA 1RUJ2 2IVIB 4FOVA 4LPLA 1NLQA 5FZ1A 2DFCA 3AJZA 2V4AA 3HT2A 4O7XA 3T08A 4EQVA 2GP3A 2R32A 4ISQA 4CUCA 4WZFA 4PI2A 4YVWC 1EV13 3WDUA 5FZ9A 3BTZA 2ARAA 1OKOA 4KL1A 1AR83 4BOWA 3U11A 1JZ4A 3E6DA 4BU2A 2QNKA 2VW1A 1LEDA 5CU1A 5FLHA 3U14A 2IXKA 4AWDA 1IQAA 1SEFA 3VBRA 2P3JA 2W47A 3ZN4A 5F1RA 3JQWA 1ND2C 1UYYA 1X50A 4CCKA 3GBWA 2ZKNA 4LLFA 3WDXA 4PVIA 3PL0A 4QX8A 1XNAA 2FD8A 4XJWA 5FYYA 3BPSA 1RUD2 1W6NA 4LR4A 3ZIXA 2WZ8A 5BNOA 4QXHA 1PVC1 3AP9A 4JDNA 4PLMA 4XDQA 3MF6A 3L2YA 2D40A 2A6WA 1IKQA 2WNUA 1VR3A 4OULA 1D4M1 5J7MA 5A33B 1V6LA 5C4WC 1URXA 2XJSA 3FC0A 4Y5SA 5A70A 1J3RA 1QQP3 3AZZA 4RS5A 4UT5A 4QT6A 1HB4A 2YBSA 5IK8A 4YVSC 4A7KA 4CCLA 1JOBA 4FTSA 2VULA 3HAGA 3Q9OA 4HKLA 4C0BA 5A7OA 4DOUA 2D6MA 4LO7A 4YM2A 3RDIA 2W0XA 5FJKA 3KV6A 5BNQA 2A5ZA 3RI9A 1KD7A 3POYA 2WZPP 4QQSA 4Z1VA 3H42B 4NHKA 4KU8A 4L11A 4C1XA 1JZ5A 2VCMA 3WDWA 3RZMA 2ILMA 4IXLA 4CP9A 5GLUA 1YJKA 3GZTB 1T2XA 1UO9A 4YW1A 4AFMA 5IWFA 4NROA 2ARCA 1ZRRA 2W92A 2Y0IA 4COYA 3NJXA 1WBFA 3RFRA 4Q4Y3 1BZWA 5EP9A 2HYXA 2V5DA 4EZHA 4YARA 5FYZA 3VB9A 3IBMA 1CN1A 5DABA 5LWBA 2HWC3 1GZWA 4XOGA 3AKQA 5F3IA 2NPIA 3WDTA 2Y38A 5F3EA 1H8TA 4NR1A 1UV4A 2DVDA 4D47A 4XQDA 3PIJA 3FLRA 3ZDVA 1SFNA 3R4UA 5ACA1 4IEQA 3K3OA 3POBA 4XF1A 1H2NA 2A6VA 4TN7A 4JGYC 1ENSA 2ETEA 1MS5A 2GMPA 3AXDA 1AYM1 1YFWA 2PN5A 3UKVA 1I6XA 4YVWB 4QM9A 3JZVA 4ZHNA 3WF0A 1VBB3 3OF1A 2DUPA 2WINB 3DPRA 1UU4A 1UIKA 5C9AA 2QQMA 1JW6A 2EF6A 3OYWB 4M0HA 2ZPXA 4RFRB 4I09A 3I3QA 1ULFA 1ND2B 2TEPA 4KWUA 4YZ2A 1VBE1 1X8MA 2JDPA 1LNSA 4V2VA 5DZFA 5FPAA 1JZ7A 4XETA 1UXZA 2R042 3RSJA 3T4VA 4BXSV 5IK4A 4P00B 4UOJA 5I0RA 3BYJA 3NV2A 4FSJA 2Y6HA 1ZZ7A 3CKHA 3AMNA 1R1A3 4GMP1 1CD3G 3R6SA 2HWB3 3KM5A 4YM3A 5APAA 4O8OA 1RJ8A 1SLCA 2XLGA 2HLEA 1ZZ6A 1CIYA 3ILFA 3OBAA 4I2OA 1C8M3 1NQDA 2OYZA 5FUPA 5FY4A 4M4RA 1W6QB 2XMLA 2J22A 1LGNA 5T5LA 1C4RA 2GDFA 2BGPA 3FN9A 3KV4A 5JOYA 3EXUA 3VBOA 5LBFA 3NVCA 1PZ8A 4YVSB 3VBFC 3MV01 5A6XA 4UDKE 2PHDA 2UY8A 5JXGA 4BJ0A 1H1MA 4Q4V1 4A45A 4IEXA 4B4QA 4PQQA 5F5IA 4BQ5A 1P8JA 1LOEA 3GGLA 2V5YA 2WO2A 1HLCA 1WW7A 3LKJA 4OFGA 2YUEA 3H1WA 5CKMA 3SHRA 3WOGA 4N43C 3BYKA 3I2FA 5FY5A 1EUUA 2QJVA 4BISA 2BJSA 3MIFA 2E53A 2OS2A 4B3NA 1GOFA 1WLCA 1PO21 4GH4C 1JXNA 4AFCA 4CA9A 4NIGA 5L9RA 5T5OA 4YZ4A 1W6PB 2B5HA 4M0NA 2ID4A 3IB3A 3SEEA 3T3YA 1W6MB 2ZGKA 1V00A 5A33A 4OUSA 3TN92 4QKNA 3LE0A 3P5BA 1HXS2 3UETA 4KG8A 1T6GC 2DVFA 2F17A 3LFIA 4JGYB 1AL23 2J1EA 4NN0A 5F5CA 1GQGA 3KD4A 1Q5OA 2RG4A 3C7GA 4Y20A 2LRPA 5FYUA 4S2GA 3I2HA 5FZFA 1WLDA 2ERFA 2WBKA 3LEKA 4R9CA 4CCNA 3D5OA 4DNYA 4BLIA 4R9AA 1WMEA 4IDZA 1O4YA 4QGMA 3ZN5A 2JJ6A 1IS3A 1E57A 4Z82A 1UL9A 3AZVA 1TMF3 4AGVA 5FPUA 4XIOA 3PUAA 4WM8C 3AMPA 2PHLA 2W2IA 4U2AA 3OM5A 1U0AA 2YZ4A 3P1IA 3Q8EA 4TLFA 3LIHA 4YRDA 2A3XA 3I7DA 1KXGA 1ZZ8A 4CPBD 5KBFA 1OUXA 2P3IA 3ZKYA 3RMYA 4E8CA 3EHKA 1V0AA 2TUNA 1YHFA 2ZEWA 4XAEA 1JBCA 5C7GA 1KDKA 1XB9A 3AMQA 2GNDA 1IOAA 5HXMA 3ZMOA 3LOIA 1FPN1 3ZYPA 1GV9A 5AVPA 1GZCA 1YFYA 3PMSA 2WFPA 1NT0A 5JSOA 3VT0A 1R081 1MQTC 5B4XA 1AR62 3VN4A 3FLPA 4DXTA 1TNRA 2W52A 3VBFB 2IZWA 1AYN3 1NCQC 4QQ2A 1LKNA 4YVWA 2O8OA 3WQBA 1PGW1 2FCVA 1VBA3 3AJYA 3ZFEC 4JX0A 3N9MA 4MH0E 3IM0A 5BYNA 4R4ZA 3FBYA 4MXWA 3OYWA 5GZDA 4QQHA 3RZHA 4LBLA 5FPZA 4N43B 4I02A 3KHBA 3OY8B 3RQ0A 3DN7A 4AK6A 1H8VA 2Y6LA 3AKTA 1RUE1 3BALA 4GAZA 5IAVA 4QHOA 2HWE2 1U5IA 2JECA 1AR72 1JH5A 1M4WA 2RDRA 2DBIA 4LBQD 1CVNA 3IDEA 1O6UA 4GH4B 1DGLA 2Y6GA 2HWF3 5KHGA 1NZIA 2BVBA 4Y22A 1VB4A 2H0BA 4HONA 3FLTA 3UL2A 5ISLA 2P6HA 2UWAA 1AXZA 4FPHA 4XVHA 1LR5A 3HWJA 1W99A 4KBBA 3JB4C 1EUTA 4CEYC 1HB3A 1W6QA 1BBT2 3R4ZA 2WO7A 4EYUA 4F8AA 5ABJB 4BQ1A 4YVSA 4GJZA 4HBNA 1UNBA 2VGDA 2XPJA 1DYKA 3GBFA 4AG4A 4LOSA 1UIJA 2VY0A 1VBD3 4HPKB 5GLKA 5C6CA 3ZYRA 2ARXA 3FHAA 4LHSA 5CVRA 1ZREA 1ZM1A 4IESA 2PAMA 1LHOA 2D3PA 2XONA 5FMCA 4JHZA 1ULGA 1FV3A 3W21A 2CU5A 2CGPA 1QKQA 3O0XA 4E2GA 4WM8B 5FXWA 2D5FA 4MGTA 1NOVA 2WFF2 2OXBA 1VRH2 3A0KA 3CHXA 1G7YA 1H9PA 4WBBA 4NOVA 1WLWA 3WD5A 3JD71 4K21A 4QAWA 2ZXQA 4QM8A 3PVEA 5FZOA 3D61A 1HRI3 1W6PA 3RWKX 5FAXA 1DGWX 4PIYA 3H8XA 5LRRA 2R071 1ULPA 2DVBA 1W6MA 3C2UA 3O7OA 1XYNA 2WLQA 5C3SA 1NXD1 1IG3A 5JWPA 5C3RA 1ND3C 1UZWA 2BFUL 3N9QA 3FX3A 3TRSB 3POFA 3A21A 3WQ1A 2G9FA 2UYAA 5IYYA 4JGYA 3MLLA 1MQTB 4IEPA 3CBNA 5CKQA 4DXZA 1Q56A 3KV5A 4J6GA 4UDKA 2QTWB 1QXPA 5A6ZA 1NCQB 4CDUC 4HSJA 1DU3D 3NNGA 1XC6A 4HVOA 4K1ZA 4NRQA 3TNQA 1O3RA 1AUYA 4ATFA 4CCDA 1CWPA 1C5HA 3IDAA 2RS51 4Q4X2 3ZFEB 2FHRA 1OH4A 2OX0A 2WJSA 3S5QA 1RHI3 3WUDA 5A7WA 4LQRA 1QHDA 3RYRA 4IV1A 5CYYA 4CP0A 2EIBA 5DDJ3 1J84A 4AFBA 1F5JA 3ZKUA 4N4BA 4JKLA 1IHMA 1X7NA 1K12A 2FMDA 2UWBA 2XHKA 4UFJA 4KGGA 2AREA 2GNMA 5CNAA 4GWIA 5T54A 3R4YA 1RUJ1 2W9XA 3S7IA 2G9GA 3GHMA 1Z7S3 2D98A 1GUIA 1RUC2 4Q0SA 4B29A 4Y5TA 4FOYA 5F2WA 3I49A 1LOGA 4AVTA 1F15A 1UZVA 2VZUA 2YG0A 1YFUA 3IDBB 3VKNA 5SV8A 5A32B 1D0HA 2BDRA 4OQ8A 4CEYB 3T2TA 5DAXA 4EN6B 4BQXA 4DUXA 4LK6A 5J3UA 4Y3OA 3QBQA 2YC4A 2ZX1A 3OGGA 4LK7A 4I0WB 3VBFA 2YFUA 5IVFA 4K7JA 2WYSA 3O0VA 5FPBA 3H3UA 5T50A 4FXKB 2VPVA 1UYXA 1GQPA 3IPVB 4BHPA 5A80A 1RUD1 4UFKA 1QOSA 3OD4A 1Q8SA 3LCPA 2WQ8A 3IKWA 4YG3A 3WPZA 1POV0 4LKDA 2VW2A 2GN3A 4JGZB 1ASJ2 4NVPA 2O0OA 1YNAA 2R30A 4S2FA 5FJHA 1LENA 2V73A 4QMAA 3QEEA 4N43A 1S1AA 2ZTNA 3OY8A 1XXNA 3B94A 1UOFA 1WBLA 1FOD3 3TBDA 1C28A 2RDQA 4O61A 2A6ZA 3DGTA 2FDGA 4Y1ZA 2OUJA 1ZX5A 2FDIA 3HMYA 1QJEA 3M7AA 3DXTA 4Q2FA 4C91A 4AVSA 3K1UA 4QX5A 5BXXA 4NHYA 4CDWC 1RUH2 2YFTA 5I0DA 3USSA 3JCIA 2XB6C 3GM8A 5F6KA 5A3NA 2A3WA 1R092 4QQOA 1ND3B 3ZFFC 3D0JA 3VSFA 2Q8DA 4HK8A 1CONA 3B5LB 5ABJA 2WUHA 4PHZA 1RUI3 1OKQA 1PVXA 4BMBA 4DY3A 3PLQA 2VTFA 5FY9A 1IS5A 3B00A 4HPKA 4I0AA 4CDUB 1DGWA 3E6CC 1M06G 3OSDA 4E27A 3HEIA 3AKPA 3QACA 1POV1 3VBSC 4QD2A 4TWTA 2C5DA 5FZ8A 2RS13 2Y0OA 4GKXA 4WM7A 5K4LA 3CZJA 2FCTA 1O4ZA 4LMFA 3Q8FA 1FMD2 4WM8A 1GZ9A 3M1HA 3ROUA 2YU2A 1W04A 1J59A 1MVEA 2OVUA 3QD6A 2PHRA 1EV12 3NQHA 1ZVFA 1QH7A 5AYEA 1PK6C 3MV11 4XJUA 5H9SA 5LA1A 1CPNA 5FUIA 4WVWA 4EROA 2D6KA 2R063 4Q0VA 1REEA 4A3ZA 2HYKA 3BOPA 1QJX3 2CV6A 1MQTA 4LKFA 2JB8A 2WNUC 3GZEA 1LESA 1OXCA 3LGRA 4AQSA 4CZSA 1LGBA 1EPZA 5IW0A 1NCQA 1WA4A 3NJVA 4QXBA 1D2QA 4GB33 2P3KA 1G8WA 3THPA 3TEWA 2R041 1GBGA 3WR0A 3HNYM 3ZFEA 3OPTA 4QKFA 1PO22 1W39A 4ZPIA 5IUQA 1H1IA 5JXJA 3DKWA 5FYTA 4KC8A 3NW4A 1QQP2 3TAYA 3PNAA 2J1AA 4MHRA 5ANQA 1K45A 2PA7A 2VNGA 1MS4A 4UWDA 5CADA 5FO9B 2WWSA 5JSPA 3JBG3 1EY2A 2VW0A 4LO5B 1CGPA 1WMDA 3ACFA 4SBVA 5IVEA 1UYPA 3PURA 4M01A 1QEXA 5JMOA 1YEWA 4YFZA 1W90A 3R4DB 1V9U3 2MHFA 4W65A 5AFEA 4CDWB 2BW8A 5FY8A 1SQ4A 4CU8A 2LUWA 1GP6A 4XDOA 5A32A 4XBQA 4TSVA 1MZ5A 2JKBA 4DS0A 2VBPA 3ZMNA 3P6BA 5GJ6A 2FZ1A 3ZFFB 3GZUC 4AVVA 4PF1A 3THDA 1UW8A 2NZ9A 5FZGA 5DAPA 4RGGA 1UOBA 2B39A 4Q4Y2 1ZNPA 2QZ2A 4TYSA 5AC92 4ITCA 1F4AA 3WY6A 2ZBJA 1UWWA 3IPVA 1DFQA 4IV3C 5JZGC 5G05L 2B4WA 2CGOA 1DZTA 2HWC2 3BB6A 5FTTC 5FUNA 3VHOA 2P34A 4NPRA 2Y6JA 5EFUA 4Q5OA 3VBSB 4CU9A 3GZAA 2VQUA 1SFYA 1DLCA 1OBNA 4JGZA 4DIQA 5FZEA 1C57A 1MZEA 4IGOA 2FMYA 4BA6A 3TN91 4FOQA 5FP3A 3HQXA 2D6PA 1W8HA 5LCWL 1HXS1 2D43A 5F5QA 4DY5A 1S2KA 3AK0A 1EP0A 4FQ4A 2CWSA 1W2UA 5GLOA 1LHNA 3OB8A 4AI2A 5D2AA 3BIEA 4B4RA 2L9LA 5A6YA 1K42A 3KSTA 1PK6B 2D97A 4Q27A 1LJ7A 3WDYA 3ZXEA 1BCXA 2IXIA 3WNMA 4I01A 2HWD2 4MG2A 1ND3A 1KS4A 3VZOA 2YC0A 2FBEA 3AL6A 4K8FA 4LJHA 3ST7A 2P17A 1O3TA 3EO6A 3HR9A 4X6QB 2WNUB 4XFHA 1LCLA 4AVCA 2QQIA 3BTYA 4S2DA 3ZXJA 1GP5A 4AR2A 3MHZA 1MPXA 2RV9A 3WNPA 4CDUA 1COV3 1I9RA 1ST8A 5FP9A 3T4HB 1SLLA 1N3QA 1MZ6A 1W8WA 1R1A2 3I3MA 2HWB2 3GDBA 2NLRA 3NNMA 5FP4A 4FFHA 4KH9A 3NNJA 4XFAA 3VBOC 3B02A 3VZKA 4BQWA 4U6BA 1C8M2 1QY4A 4XUOA 5JOWA 1DZQA 4P5HA 1GWKA 3ZPOA 4B4PA 3O12A 1JOJA 3DYOA 1JZ2A 4CTEA 5TSWA 3LEMA 1S2EA 2VD7A 3MW3A 1JHNA 3N36A 3VL9A 1AR61 2E51A 5KHHA 1W9TA 1XNBA 1V6MA 3GXUA 4OHZA 3RNSA 1KFXL 2JDAA 2BWCA 4HKOA 5DAVA 3IZOA 2XWJB 4PLOA 2HKXA 3WXPA 3ZYBA 2DWRA 4COVA 2A1XA 2YU1A 5A1AA 2VMEA 3OUJA 3BU0A 3USUB 1F2NA 2WA4A 3BUCA 3NV1A 1LAJA 4A3XA 4ES8A 3KMHA 1EAH3 2PHUA 5C3OA 4JAAA 2IXJA 4CCEA 1VAVA 2JDNA 3D8CA 1Q8QA 1F9KA 2NMOA 2ZGPA 2HWE1 3ES4A 2YBKA 3FMGA 4LE3A 2JICA 3WNNA 1AR71 1RUG3 1S0JA 2BOIA 2IFRA 2LW8A 1GWMA 3GNEA 3L9JT 1YI7A 3LZZA 4IV3B 1VPHA 4META 4OUMA 4XABA 3VSSA 5CFDC 2OA2A 1LULA 2Y60A 1A34A 2XKOA 1RXGA 1YQ2A 3O1TA 3ECQA 3MIEA 5LK5A 5IK7A 1HQLA 2QDRA 3WNKA 4ORFA 3F2ZA 2E9QA 3THTA 3VGIA 1VE0A 1HRV3 4XPVA 2ATFA 1BBT1 1OA3A 2EALA 1AL22 1HN1A 1W3XA 4SLIA 4Z92B 1UMHA 4XZPA 1QJY2 3HBZA 1XE7A 4D69A 3GBGA 2CTVA 3LIGA 5CEHA 4CDWA 3DECA 4XTPA 4D6RA 1B35A 4LA2A 3N3HA 1HW5A 2B9UA 2XWBB 4QX7A 3K2OA 4XDPA 1ZZ9A 5ACA3 3T1LA 3FFQA 3ZFFA 2NM1A 4BMEA 2XQRA 3ACHA 4Q1RA 3D5ZA 1US2A 5HCBA 2WFF1 2XR4A 1VRH1 1JU3A 3PU3A 4JDMA 3WG4A 1V6IA 5GLNA 3PU8A 4IQPA 2EVXA 3MFAA 1RITA 5DAWA 3D3AA 3VBSA 4CP2A 1JYIA 3SISA 1KGYA 1EYBA 5LEJA 1ENQA 3VBOB 3G6JB 3QZ4A 4D6SA 3HD8B 2GC3A 2WSUA 3LQCA 4E8DA 4RGKA 1G9BA 5BNPC 2QZ3A 3VKOA 1YFXA 3RMXA 2PAKA 3BN6A 4KI5M 3KWVA 1DIWA 4P9LA 4BQ2A 1AYN2 5DXDA 1V6KA 5JUVA 3IAPA 2WWJA 2X8KA 4K8RB 5JR7B 2EIGA 4IEUA 2WN2A 5E16A 2WL1A 3VDDC 1PK6A 3EYPA 4NWVA 3WF3A 1OPMA 4GMP3 4DZGA 2ZGUA 4A42A 1AR92 4E4HA 4Q0PA 2YFZA 3ASIA 4Q4X1 4XFBA 1S0DA 3RPQA 1YC61 1XU2A 4ASMB 5EWSA 4AGRA 1SCSA 1ZBE3 2VJXA 2Y64A 2YGLA 3IMNA 1DQ0A 3T2OA 3VD3A 3TEZA 4OI0A 1W8NA 3AFKA 5E1RA 2BRTA 5CA6A 2R1DA 2GH8A 1DYOA 5A3PA 4GJYA 1O8SA 1FI2A 4Q4V3 2HWF2 1W3VA 2JEMA 2VNOA 4URTA 5FZ3A 4FTEA 1N47A 1RUC1 2XOMA 2G9ZA 2OZJA 3KSCA 3ELNA 1GZTA 4PBOA 4RA0A 4LULA 5CFDB 1H2KA 3U0ZA 5FZMA 5C5TA 5JIAA 3LPGA 2DYCA 4Y20B 4P14A 1KJLA 1L3JA 5LB6A 4KMQA 4ZS2A 3LSEA 2CWMA 2JWPA 3JUUA 3NMBA 1R1ZA 1U5XA 3J8F3 1AHSA 4L97A 3ZSMA 3RZJA 2VDTA 3DF0A 5AY9A 4X8PA 4IEZA 5F6LB 4N9IA 5FZHA 1OUSA 4FAGA 2Q4SA 2W08A 1SBEA 4HKWA 2X29A 1GYHA 5DN2A 3PVOA 3AYEA 2A6XA 1GKBA 4RD7A 4MO3M 3USUA 2JDKA 1ASJ1 3WCRA 4DO0A 5FPVA 1JOPA 4BDVB 1ZRDA 3LDBA 1UF2C 4FVVA 3O1VA 1W6OB 1V6JA 1W8OA 4OLLA 1FX5A 1FV2A 5KXCA 1OLRA 3LA3A 4GD4A 2OKXA 3LSDA 4AFAA 4AI8A 4P9XA 5FXXA 3OM2A 5JZGA 3LV4A 1HRI2 4IV3A 2JE8A 4ZS3A 4KCBA 2WT1A 2HEVF 2AACA 1H4GA 3KF5A 4ISRA 2Z79A 5K0UC 3VHPA 1IZ3A 5GZEA 1RUH1 1DP0A 5JMCA 1GYEB 4AYUA 1RXFA 2ZHNA 4FPFA 4NJ4A 5BNPB 4XJZA 1QIQA 3W9AA 2KR2A 1R091 3FUQA 2QVSB 3ZYIB 3WCSA 3SITA 2R7EB 2WZR3 1VKDA 4GZ9A 2QDNA 3CLPA 3PTRB 3FL7A 3RJ2X 3VKLA 4NWWA 2RDSA 4IV1C 4MXWB 3CDZB 4EWAA 4MGSA 1NYWA 3A4UA 4E4ZA 2PFWA 2Y6FA 2PLV2 2FDHA 1A6CA 3VDDB 4H2AA 3TEYA 1X33A 5FZ6A 1E5IA 1RHI2 1UOJA 3SMHA 3BYNA 2UURA 4JHTA 2O8QA 1NKGA 4B1LA 2PTMA 3ZXDA 1ZYBA 4J1WA 2VC9A 2VZSA 3PTYA 4Y22B 2YMZA 1S4CA 5DG1A 1K5JA 3BGAA 3VBHC 4B7KA 1FMD1 4CDQA 4I3GA 1WW5A 4NOTA 5EQUA 1YIFA 2XL9A 4YNIA 2UU8A 4IEYA 4BIOA 4N7IA 1JTZX 4HXCA 1Z7S2 4PCRA 4RL7A 4YGCA 4QGLA 5FPXA 1EV11 2XGXA 2WSVA 2FDKA 4BZ4A 1BMV2 4YW2A 2Q8OA 4DUVA 2A6YA 5FIXA 3LOBA 2VZQA 3WMZA 4M3CF 4Y4YA 4JC1A 5LBEA 4QDRA 1GQHA 3VT2A 1FAYA 1EPWA 1S0GA 3B3QE 3LEIA 4UFIA 2XQXA 3HIFA 3N9OA 1UY4A 5I0TA 1UY1A 5DUUA 3AFGA 1RUF2 4XUQA 1UY2A 1GU3A 2RR12 1QNWA 1NZCA 2F4LA 2IC1A 5LY2A 4C8DA 4QWNA 5A3UA 1G9DA 2TBVA 2ZOEB 3BYWA 4AK3A 1C8NA 2KD7A 1L7LA 4CCOA 1HIXA 5FZOB 1RC6A 1XYPA 2ZGMA 1UXXX 2Q1FA 1QQP1 5FY1A 3PUSA 5FRAA 3AP5A 2GN7A 2YBPA 3PJQA 4BPZA 5HPOA 1XJAA 1E5RA 2B45X 2VMDA 4A6SA 1TL2A 1W8UA 4AEKA 4Q4W3 4MGKE 3SQOA 2X8TA 4EN8B 3SXWA 5ABJC 2P1BA 4Q0QA 5CFDA 5E88A 5K0UB 5FK7A 1PMJX 4OCTA 5JZGB 4CEWC 1DQ6A 2NQYA 4N9HA 1UD1A 4YW5A 4PDWC 1NQJA 4YW7A 2X05A 4EJRA 2X5IC 1VMJA 4WM7C 1XE8A 2XLFA 4NIDA 5A7WB 1OYGA 5DAQA 1FNYA 3JD73 4IV1B 2CDPA 3WPUA 1CZVA 4OHVA 5F8PA 4Q4Y1 4QDSA 5AC91 3VUOA 1OOPB 1TEIA 4XXAA 4ZXKA 2WS93 3M3IA 4Y5Z0 4FPOB 5FPLA 1AL0G 2HWC1 3QCWA 1NY72 3V64A 1O8PA 1Y3TA 4BK4A 4KGQA 2D6OX 3DL3A 2Y33A 4HMZA 1DYPA 1S0IA 3MICA 4LHNA 4Q8KA 4KMIA 4HT1T 1C1LA 1W6OA 2X09A 2VMHA 2EIDA 4PI0A 4DFSA 3SCHA 4GXLA 4H7MA 4NAOA 4QX0A 4XJ9A 3VBHB 1YJLA 3M3QA 5FYSA 1MS1A 2YPDA 2W3JA 2GC1A 3D6EA 4XC9A 5FZ4A 4Y26A 2VTXJ 1VALA 4LBOA 3IIIA 4EN0A 4XFIA 2GC0A 2ADDA 5JSRA 2YXSA 1X8EA 1PZ7A 1N3OA 2WAOA 2ZMKA 5SV5A 5BNPA 3I2IA 1XSQA 4XYXA 1D0GA 5FBZA 5C8CC 3UNPA 3AKHA 2DCJA 2HWD1 1RMU2 3HNMA 1DG6A 5DUXA 2BBVA 5GLRA 4QX1A 3U75A 3H1YA 4IW3A 4O65A 2KM2A 2ZAAA 1RUJ3 4XMIA 4XURA 1ENXA 2CGNA 3H1MA 4GB32 1HN0A 2Y26A 4UFHA 3V0BA 2WO1A 5FZKA 3RS6A 3VDDA 3P2NA 4AL9A 1GSLA 2XKPA 3CO2A 3D5YA 4DMIA 5T5PA 3H3LA 1R1A1 4J25A 2RMU3 4P5YA 2HWB1 1ULCA 3H8UA 4MOAA 1Z78A 1RL3A 1I3HA 2W1WA 1VLNA 1C8M1 3N9LA 1IPKA 1POQA 3NO8A 4Y33A 4DQAA 3DCQA 3JBG2 3RYPA 4XUPA 4I3PA 2UY9A 4MX3A 2H0VA 2JKXA 4CDXA 1J3PA 1W28A 4RQPA 1AJKA 1RUD3 4XFFA 4HLTA 5FLJA 2WZEA 5I8TA 3I2DA 3B93A 1JS9A 2WRAA 2BERA 2JDHA 3AC0A 4XHBA 2YROA 3TNPB 3UGHA 3WW1A 3RZLA 3MUY1 4QPIC 3J9SA 2YB7A 4EN9B 1WMXA 4CEWB 4UF0B 3PJYA 4LBQB 1A8MA 1VMHA 4PDWB 1Y43B 4IL7A 4OI1A 1GFF2 3MGUA 2X5IB 4JGZC 2ENRA 1OPOA 2ZZQA 4WM7B 2BP6A 1RINA 4MV2A 3HOBA 2W87A 2ZGOA 3O0WA 2Z2SB 1Q8VA 3PMEA 3I2OA 4FAHA 1QGLA 1XPWA 4P9JA 3SKJE 1L7RA 5JXIA 2GNBA 4XBNA 3U07A 4CSWA 3UK9A 2QQUA 1BYHA 3OCPA 1TG7A 2XBO2 3O5SA 4Z07A 2Z5WA 4EWEA 1AXYA 4XUTA 3M3OA 4NE9A 3ZR6A 1RUNA 1SG3A 3EB7A 1GOGA 2VQAA 4H55A 2B46X 2A3YA 2K2SA 3CF6E 4F7ZA 3D60A 2VUJA 1PZ9A 2VBDA 1YRZA 1W2OA 3IAQA 3AMHA 2RS33 2YC2A 1OI6A 1AL21 3O14A 4HN0A 2WQ4A 1TE1B 1PMHX 1QJY1 4LITA 5FOBB 1OF3A 3MI8A 4D3WA 5K0UA 4QPWA 2VZTA 2ZA9A 5DZGA 5BNNA 1FYUA 3N7JA 3VKMA 3DEMA 3WF1A 4L0PA 5C5UA 5GZCA 1ZZCA 4C1WA 2AENA 4AK7A 5IVJA 4GKYA 5C8CB 3OGVA 4MGZE 4W6YA 2Q1MA 2Z42A 1AXKA 4IGPA 3ZXLA 4KBZA 3WQ0A 4AQ6A 1BHGA 3UKTA 4TTGA 2ZGRA 3KLSA 5D8AC 3E5XA 3TYJA 1COV2 3BIWE 1XU1A 1OOPA 2BFUS 2RM23 2VOTA 4YW3A 5A3TA 2DCZA 5CZKA 3GALA 3KQRA 2O14A 1G9AA 1NX9A 1MR5A 4I30A 2CDOA 3QLQA 5JVVA 1C5IA 3AYAA 3NAPA 4FPJA 4YGEA 4E2SA 1JMUB 3POWA 2JDMA 3Q8BA 4IGQA 1OQDA 3VBHA 1NE4A 5EJ3A 2AUYA 2C24A 2ZGNA 1WL7A 2R6QA 4UYBA 5B2GB 1GP4A 4Y1XA 5JR2A 4IE5A 4P9GA 1AYN1 3RGBA 3LD8A 2R043 4AEJA 1UYZA 1FT9A 4QQPA 2W91A 1ALYA 1UU6A 1UY0A 2A7AA 2W39A 1O59A 3NJZA 5T52A 1W18A 5EZWA 4QPIB 4ZU5A 1AR91 1CAVB 2NYYA 3TOJA 1NUKA 4CPBA 2DTYA 3GHNA 4CU6A 5FCCA 3AP6A 2AGSA 1EAH2 3V56A 4LEJA 4LHKA 2VUDA 1RVF3 4LBKA 1RUG2 1SLAA 2ZKLA 2EA7A 1FNZA 3C3VA 4UBGA 4NIHA 1JHJA 2P37A 1U12A 4JQRA 2VXRA 1PM7A 1YYNA 2HWF1 1C1FA 4YW4A 5GALA 5L7OC 4FXGB 2GNTA 5AYCA 3N7LA 5DPNA 1Q3EA 3WP4A 3WP5A 2LTNA 5F2SA 2FQPA 1HRV2 3FE5A 5HV0A 4BK5A 5JPNB 4UW3A 5A6QA 3OBTA 5IFPA 5E6HA 5C2MA 1ZBA3 3FHIB 2A71A 4XJ8A 1B35C 2HJIA 4BCUA 2VOXA 4L2NA 3PHMA 1W0NA 1TME2 1S2BA 1J83A 1LHWA 3WHUA 5IHRA 1YO8A 3OM6A 4D7SA 1RTVA 3MW4A 4AGGA 4KCAA 4CEWA 1VRBA 3DV8A 3TWIA 1W8TA 4UF0A 1XNCA 4XACA 4LBQA 4PDWA 4OHXA 3TN93 5DG2A 4N2RA 5JOZA 2XVKA 3J7MA 2X5IA 3PVBB 1JZ6A 2DU1A 4R4XA 2R16A 3VD4A 1IS6A 1WWYA 1QJU3 1BEV3 2OZ6A 1IKPA 1GMMA 2XJPA 1OA2A 4HVQA 4S2HA 5D8AB 2WNVC 1H1AA 4X8NA 4R9DA 5A3LA 1HRI1 4KQ7A 4YG0A 5GLZA 4AEMA 5A7QA 1VAKA 3MPPG 2JB4A 2VUAA 4KC7A 1WA6X 1X36A 2VTXA 4FCAA 2CYFA 4LO6B 3U1XA 1DGRA 1XE0A 4QPYA 5CISA 5E8AA 4R8HA 1AR82 1SZBA 2C26A 4K20A 3A22A 4TZDA 4ET7A 1CAUB 2E6VA 1H2LA 1SLTA 2ZHLA 3M3CA 2ZX0A 1G86A 3PUIA 3AX4A 4KNCA 4RGAA 1JODA 4NRPA 5A7NA 1HQNA 3S7EA 1WCKA 3AKRA 4LIVA 3WLUA 1E5SA 1GNZA 4V1PA 3MIHA 2RJ2A 2VZPA 2VECA 1PIV3 1PO13 4AHWA 1GOHA 2PLV1 5J1XA 2Z69A 1CZTA 1AVBA 4W50A 5B4NA 4BQ3A 5L73A 2MEV3 2Q5TA 1RHI1 4XF4A 3MO4A 1LU1A 5C8CA 2XDVA 4IETA 1ZBE2 2VCBA 3W5MA 3ACIA 3K4ZA 2JIGA 2W1UA 3OGJA 4XXPA 4INDA 4JCKA 2VMCA 1MEC3 3WNXA 4Y24A 2ZCWA 1N3PA 3K77A 3ZYJB 3ZN6B 3N9PA 2CSGA 4QGNA 1Z7S1 4EN7B 1BK0A 3B69A 3OGRA 3UV9A 1N1YA 5L7OB 3OM7A 5EYXA 4B8EA 5J98B 4MGIE 4Q29A 1BMV1 3OUIA 5L9VA 5EIYB 1YQ5A 4IEVA 1W9SA 1R64A 3KGLA 2A70A 1K5MB 3KCYA 3WG3A 1OD3A 1VBC3 4JVAA 2RHPA 1UCXA 2RJKA 3J8F2 3ETPA 4C90A 4CCCA 4FPKA 1B35B 4WVZA 1APNA 1QOOA 2IUWA 1BXHA 2XJUA 2ZHMA 2WNEA 3ME2A 1RUF1 3W59A 2HBUA 2YY1A 3WF2A 4RHV3 5GZFA 4BH9A 5JCTA 4MUVA 2JXAA 1RYYA 5J37A 4QPIA 3WW2A 2RR11 1CAVA 1UY3A 2WDBA 3V65A 3ZXFA 4BXFA 4Y1UA 4JDOA 4DUWA 3ZOIA 2E63A 2JG9C 3HJRA 1OF4A 2VZ3A 2XLAA 3EQEA 1LTEA 1CX4A 5DMYA 2ZGLA 5GLWA 3NKTA 4MYEA 4TXWA 1NE6A 4C0HA 1O5UA 4XEZA 4MADA 3ZSKA 5A1LA 5C70A 2EXKA 3WW4A 4Y4RA 2WNVB 2LS6A 5CB7A 4A7YA 2ADEA 4DEVA 1LGCA 3FJSA 4HANA 4D6QA 4CUBA 4E9KA 2YGMA 1IG0A 5F7UA 2VXJA 3GJBA 1HJFA 3I2GA 3B7MA 1VBB2 1F31A 3LWCA 5K7PA 3FUOA 3ORJA 2WZR2 5A7SA 5AYDA 5GLLA 1RJ7A 2QQNA 2WFF3 4AOCA 3RWNA 5EJZB 2EICA 2RVAA 4ZU7A 3BTXA 4FTBA 5FZLA 5FO7B 3DYMA 2BBAA 4QHZA 3KGZA 5IJRA 4LXLA 2ZX3A 4CDQC 3OPWA 3N4MA 3GCXA 2JE7A 2XVLA 3POEA 4CP1A 4DPNA 1DGRN 1NY71 2W46A 3PDQA 4JTNA 2G4IA 4YLZA 3SCFA 1PNFA 2BV4A 4QKBA 1K3IA 4BB3A 4CYDA 5LK7B 1DHKB 5FFOC 1S0FA 5I8YA 2DUOA 2AYHA 4GWNA 2XJTA 5FY7A 5I0UA 3CL1A 5JAXA 3C7FA 5FMOL 3AYCA 5D8AA 4N7UA 3LPFA 5A7VB 3SH4A 3N7KA 2JD4A 3UKNA 3WPVA 2D6LX 2VU9A 1SDDB 4P9IA 1YXWA 3WG1A 2X8FA 3HBKA 4OYUA 4D0QA 1JZ3A 4Q4X3 3OD0A 2WWUA 4NMIA 4XAAA 1PVC3 2C6SA 3MIGA 4IE0A 1CAUA 1GANA 2VAUA 4OUEA 2D3RA 4AVAA 5KXEA 4IEOA 5K8SA 1RMU1 1OURA 1D4M3 1UKRA 3FHQA 2XHNA 5HI0A 3VKFC 3AKGA 3VDAA 1E5HA 2NP0A 1OH3A 1KS5A 3R4SA 4PIXA 1IPJA 4JV4A 1O91A 4XCAA 3JQXA 2ZX2A 4GB31 5FZDA 3E5UA 5JI9A 1D7PM 1S0EA 4AI3A 4AI1A 5F32A 2PHTA 2J1SA 4ZU4A 3NV4A 1OMIA 2VNVA 4YPJA 5F5AA 1PM4A 5FLWA 4FPCA 2JG9B 3BI3A 4AHXA 4HK9A 3MPBA 1WW4A 4O9EA 1DQ5A 1LOAA 1UX6A 3JBG1 3LEGA 4QXKA 5FXZA 2D93A 5BPXA 3CQOA 2DU0A 2YYOA 4PLNA 4Q4W2 4QPGB 4ZY9A 4BE3A 5JDBA 1YCIA 3U4XA 3ZN6A 4CUAA 4ASLA 1FXZA 5B6SA 1OQEA 5L9BA 2VMFA 3CU9A 1KITA 1HV1A 3P3PA 4Z2WA 5L7OA 3VT1A 5FZ7A 1NA1C 1W06A 2W1SA 4COZA 1NCRC 1K5MA 1A3KA 2OT7A 1W05A 3ZVXA 1HB1A 1IPSA 1LODA 1N1TA 5FY0A 3I3BA 4W4ZA 2W5FA 3WINE 1KRIA 2PHXA 1BK1A 1TMF2 1F5FA 3AB0A 2JD9A 1LU2A 3MUZ1 3VZLA 2MPFA 2WS92 2D44A 1TZOA 3DUIA 4AQTA 1XNKA 4QXCA 1WZXA 4CDQB 4UW4A 2Q1ZB 5FK8A 1UKGA 2QQOA 3WN0A 1AYM3 1RIRA 2DBNA 4G4FA 2WA3A 4K40A 5I0SA 3VL8A 2VVDA 2XBO1 2YV8A 1Y7BA 1WMFA 2WABA 2YFSA 2VG9A 4L92A 1JN2P 5LW9A 3ALQA 4H3WA 1SBFA 4FBFA 4XBLA 5CKNA 2J1RA 1CIWA 3BOWA 2WLPA 4LBNA 4YFWA 4CVUA 3CU7A 4YZ3A 2JIJA 2OPWA 4EZ4A 2QQPA 2WNVA 1I5ZA 3W5NA 2PMWB 2J1TA 2CNAA 2WO3A 4A6OA 1VBE3 4W6XA 4ATEA 3O1RA 1I5PA 5FWJA 3WEZA 4DB5A 1SPPB 3VZJA 3ZXAC 3CMGA 2BYVE 4PBPA 3H8OA 5FR3A 2VZOA 3K3NA 5DZEA 4EWDA 3AL5A 3DKQA 5JLVA 1O3SA 1VBA2 1F4HA 3O1OA 2YHJA 1FMD3 3GCWA 4Q0UA 3ZLIA 4LT5A 3SEPA 1U5YA 3KB5A 5C8WA 1JYCA 3VZNA 1O4TA 4B7EA 3I59B 5FYVA 3VSZA 1COV1 4QB1A 4XE9A 3ILRA 2RMU2 2VM9A 4CDXC 4D7TA 3E6BA 4GWMA 4JQTA 4PF5A 4AEDC 3RZZA 2E32A 2J1VA 4KU7A 1ENRA 4RQPC 3QH7A 3AXEA 1OVPA 1OVSA 2EIEA 2JG8A 5LA9A 4BQ4A 3WVJA 3KT7A 4XF3A 2BOJA 2HEYF 2C1FA 2ES3A 4GULA 3TEXA 4Y1YA 5CFCC 5ANNA 1IGOA 1GICA 5A7VA 4JTOA 1PGSA 4WZCA 1UZ0A 1XOYA 3M8LA 3T30A 2YFRA 1MACA 5I91A 4FP2A 2F4PA 1OHFA 2B8MA 5FKBA 1S0BA 1NA1B 1PO23 3C7OA 5JXHA 1MS0A 1LHUA 3WN2A 1VBD2 4HVRA 1NCRB 1V6NA 2ZEXA 3HN3A 1Y9GA 5JOXA 5FZCA 5KWRA 3MYXA 1EAH1 2CAUA 4YM0A 1OLMA 2VNRA 1UMZA 2ZEYA 1SHWB 1WCQA 4WVVA 2WIIB 2AR6A 3K46A 2BZDA 2QQKA 3S6PA 4R9BA 4AK5A 1RUG1 2J1UA 3WG2A 4OI2A 4GALA 3B9IA 3JU9A 4QHBA 5GLTA 2A73B 1HDKA 1HJGA 1SCRA 2BVVA 3AP7A 2DUQA 3ZR5A 1JYVA 4GQ7A 2JG9A 5EXOA 5CBLA 5D21A 1H2MA 3CJIC 2VZVA 1HRV1 3ZPYA 1UN1A 1UPIA 1AX0A 3EBRA 1H9WA 2V4VA 3BTAA 1X9PA 2RS32 5BNNC 3V0AA 1NG0A 2GC2A 4QPGA 3OG2A 3R0RA 4COUA 5AC93 3N9NA 4XQWA 3HPNA 3WPYA 4IE4A 4N2ZA 1G9FA 4N53A 3EMRA 4LA3A 2XVGA 5DUVA 4AF9A 1TME1 2E7QA 3BYLA 2VVEA 4FQZA 3AYDA 4GMP0 4YYOA 2XH6A 3U78A 3WP3A 1IQDC 1VJ2A 2Y6KA 5F37A 2CY6A 3AM2A 3V0BB 1W2NA 1OOPC 2VMGA 1T6BX 4LBJA 3MEPA 4YW6A 4XUNA 3NSTA 4Q8LA 1PGL2 4XTMA 1KQRA 1REDA 5C3PA 3D82A 3M70A 4AAPA 1FATA 4AQ2A 3ES1A 4XFCA 1FPN3 2VO5A 4AW7A 2RM22 3DYPA 3NAPC 5FZAA 5DDJ2 4N90A 3TAWA 3KCXA 4FT8A 1R083 1YQ6A 3OEAA 1DQ1A 1OQ1A 1N1SA 3LF7A 3URFA 4YG6A 2OW4A 1NXMA 2ZAHA 4YGBA 4CDXB 1JYXA 2V72A 2R0FA 4W8JA 4AEDB 3M2MA 4RQPB 1XSRA 4RYDA 3ZYGA 3T0DA 2HWD3 2BNOA 1L7QA 3VHRA 1GNHA 3SC7X 2PXJA 1AR81 1XQNA 2GU9A 2Y34A 3ATGA 5FP8A 5CG8A 3WAUA 3S57A 1J1TA 4LUMA 2GSYA 4DEQA 5KXDA 5CFCB 4ZZ5A 4WV8A 3F95A 1RUE3 3KF3A 2J42A 3ABZA 4XILA 3ETQA 2C4XA 1SPPA 4G3YC 2ZGTA 1PNGA 1A78A 2RE9A 4UBHA 4L8QA 4HG6B 3OGSA 5KC6A 5L19A 4XFGA 5C4WB 4UDJA 2ZMNA 2B42B 2OQ7A 4O8NA 4Q1PA 1AX1A 4NPMA 1YQCA 4O9GA 5IVBA 2CL2A 1ZBE1 1D2SA 3MF9A 3I3DA 4PQ9A 3WUCA 4AZZA 1ZRFA 1RVF2 1XYOA 3I3EA 5GLPA 2OPKA 2FCUA 4LO4B 3ZO0B 3WP6A 3C8XA 1ZRIA 3H3ZA 3I59A 4JRLA 3WW3A 2AEYA 1FOD2 5DQ0A 4LO8A 4OZOA 2H6BA 1GYKA 4Y1VA 5G04L 2PYTA 1JUHA 5J48A 1J3QA 1ONAA 2AEZA 5GM0A 1JYNA 5LA0A 4QB6A 1BQPA 3H7YA 4BIFA 2VCAA 5FMDA 5CAZA 3WSOA 4FPEA 4KWLA 1ZBA2 5F9TA 2B7YA 3CJIB 2SLIA 4MVTA 4CRQA 3J8F1 4B1MA 3J26N 5BNNB 4XIKA 4WVMB 5IT6A 3U10A 3ZFGC 3JB8A 3WZ1A 1RUI2 2BEOA 3POSA 4HL0A 5EYYA 2ZS6B 1NA1A 3AKIA 3IT8A 2Q8CA 2G19A 2I45A 2DURA 1DZRA 1NCRA 2R1BA 2XXZA 2E7AA 3J7LA 3NJYA 3ACLA 3APBA 3POJA 2PHFA 3S30A 2VE1A 2DDUA 3ZX7A 4N8MA 2R073 4TLGA 2BWAA 2RS12 1US3A 3BVCA 4KWKA 1QJU2 2HBTA 3BCWA 3LDKA 1BEV2 5JIUA 4OHYA 3NWKA 2D6NA 1C3HA 5H9QA 1QJFA 1QJY3 2A75A 2QBXA 2JDYA 3KS7A 5A7PA 3DXUA 3LA2A 3NAPB 1ODMA 2DV9A 4JKMA 2N7GA 3T2QA 2EXJA 3THCA 4AAXA 4AVBA 5KHJA 4ONZA 3OTFA 3T1MA 4AFDA 5FO8B 4U6DA 1WD4A 2GAUA 3ZM8A 2GMEA 1TNFA 1JYWA 1A8DA 1GWLA 1BVP1 2WC2A 1UZYA 3ILNA 4OVEA 3VV1A 2OQ6A 5A3OA 3WNOA 3D0SA 5FYHA 4CCMA 3G7DA 2RS53 1UMIA 4GA9A 3N35A 3QC2A 5F39A 1VBB1 5IFTA 4CXYA 3NV3A 2WZR1 4XF9A 3VBUC 2IWGB 2R062 1WKYA 3AVRA 3VLBB 4LTAA 3I54A 1MS8A 1OA4A 1PIV2 1PO12 1QJX2 1DQ2A 1XBFA 2ARBA 3SNMA 1KEXA 2VOKA 1LECA 4MXVA 2DCYA 2VR4A 4I0BA 5HCFA 4AHZA 5LRSA 4UDGA 2E26A 2MEV2 2P4EA 3WNLA 1Q43A 3H50A 4UW6A 5H9PA 3I2KA 2OUHA 3BKZA 1DF0A 2AH2A 4NHMA 2BQPA 3LFMA 1MEC2 4HOOA 4K1YA 4KG0A 2BGOA 5FWEA 3IIAA 3CZUA 5FYMA 3O1SA 1HB2A 5H9RA 1Z0HA 5IATA 1QF3A 2MNGA 4MZUA 1AR93 1UU5A 4AEDA 2BGCA 4BLJA 2ZMLA 4XMAA 1NLSA 1V9U2 3H8RA 1VBC2 4IERA 5A3WA 1ND2A 3WASA 2GZWA 1CESA 3J7NA 3OBZA 5I8SA 5A1FA 1W8ZA 2JENA 1LB2A 2BPA2 2XG3A 5HV4A 2DCTA 4M3CE 5CFCA 3CJXA 4MLGA 1XNDA 3E1F1 4QU2A 1BLZA 1OLQA 3GF6A 3ZFGB 4EV0A 1VP6A 5GLVA 3MIDA 1VIWB 4RHV2 2ZACA 3MBWA 2ZABA 4AHYA 3H9AA 3OUHA 4COWA 1H6YA 2XUMA 3GYDA 2WYFA 1PX4A 4M4PA 4NUBA 5EHDA 5C4WA 4BM8A 2PAEA 4FPGA 1HX6A 1AZDA 1OSGA 2DTWA 2KXLA 5GLMA 5FP7A 5J09A 3IN9A 1RB8G 5FDBA 1UQXA 4NIAA 2P6CA 1MVQA 2QFEA 4ARXA 4QX3A 1Q8PA 1KFUL 4Q4W1 1VMFA 2D3SA 4JKKA 2LALA 1CX1A 1W9FA 4QX2A 1G6NA 3VD7A 1NLRA 3MDPA 2G1MA 3PVNA 2EXHA 3PUQA 3WV6A 5A8CA 5C33A 1DCSA 2I2SA 1LEMA 1POV3 3QOPA 3CJIA 1ZRCA 1PX3A 1AF9A 2WQZC 1U5ZA 2HH9A 5GKAC 1HKDA 3VBUB 4WVMA 2QQLA 1WD3A 4M3CB 2IXLA 4NRMA 1CAWB 1SBDA 1TMF1 5C0PA 2D7FA 2IXHA 1LOFC 3KVBA 2WS91 4ARYA 2FZ2A 4MGYE 5GZGA 2ET1A 3S5AA 3H0OA 3HQRA 2K0GA 4ZONA 4DRRA 3JXSA 3KV9A 1UX7A 2EAAA 2QQJA 5F3GA 1GLHA 2JDZA 4MLOA 2GP5A 1PMIA 1MZFA 1O5LA 1S55A 1WCUA 1XRUA 4FI9A 5J36A 1BKZA 3TB0A 1MS3A 3ENRA 3RRDA 4Z8BA 5LEKA 1YI9A 5FQ0B 1TVGA 2V09A 4AXOA 1CPMA 2PLV3 1OD5A 1S0CA 4JZRA 5FXVA 1OC1A 1W2AX 2ZGQA 4CE8A 1JUIA 4LORA 5LASA 3B9CA 4LOTA 4U36A 4ZXEA 3SLIA 1PVC2 3E5QA 4A41A 3RG0A 4Q26A 5C3QA 2Q30A 1DQ4A 5J96B 1D4M2 2QUOA 3R67A 4NIIA 1VBA1 3AP4A 2WKKA 4M00A 3KVAA 4PJYA 4ZZ8A 1CAXB 2DFBA 5D1IA 3U4SA 4F83A 1SLIA 3KT1A 3QEDA 2VQTA 3K51A 3UYJA
chains in the Genus database with same CATH topology
1DYOA 1O8SA 3I2GA 3K4DA 5AYDA 5GLLA 2QQNA 2X8SA 2XOMA 2EICA 2RVAA 5EJZB 2W1QA 3DYMA 3OM5A 2BBAA 3P1IA 3LPGA 3LIHA 3OEBA 5GLQA 1W2TA 5IJRA 4E8CA 4KMQA 1Y9MA 2ZEWA 2W46A 2VDTA 5AY9A 5C7GA 1K3IA 1OT5A 5LA2A 3VD9A 5HXMA 3C7EA 1GYHA 3C7FA 5DN2A 3VT0A 3LPFA 5B4XA 5A7VB 4DXTA 3WPVA 4MO3M 1SDDB 4UI9L 4BDVB 3A23A 2X8FA 4OYUA 4D0QA 1W8OA 3J7HA 1JZ3A 4FFGA 3WQBA 1XNTA 4JX0A 2OKXA 3OM2A 4OUEA 3LV4A 3CIHA 2JE8A 4KCBA 2ZEZA 3FHQA 2XHNA 3KF5A 3AKGA 4OMDA 3T0BA 3VDAA 2Y6LA 4AK6A 1DP0A 4O8PA 1GYEB 1D7PM 3WF4A 2J1SA 2Y6GA 3UGGA 2R7EB 1VKDA 4GZ9A 1ULOA 4YPJA 3FL7A 3AKFA 5FLWA 3CDZB 4D8MA 4MGSA 4XVHA 1JU4A 2AC1A 1W99A 1EUTA 3I97A 3LEGA 3R4ZA 3CQOA 4ZY9A 3BYNA 4DXRA 2X10A 2ORZA 4CUAA 1NKGA 5FMBA 2WAAA 5B6SA 3VT1A 2VMFA 4AG4A 3CU9A 2WN3A 2VC9A 2VL4A 2VZSA 5GLKA 4GWJA 3BGAA 2W1SA 3FHAA 4LHSA 1YIFA 4P02B 2B9VA 2XONA 4FFFA 3I3BA 4W4ZA 2W5FA 4JHZA 3T09A 5FMCA 4N1IA 4DUVA 5FIXA 2JD9A 3C7HA 3MUZ1 2OXBA 2VZQA 3WMZA 4PT6A 2Z4FA 4NOVA 4QDRA 4QAWA 2ZXQA 3VT2A 2VZRA 3D61A 3RWKX 5FK8A 2QQOA 3LEIA 3WN0A 2XQXA 1UY4A 1UY1A 1ULPA 2YFSA 3C2UA 4RN5A 3ACGA 2WABA 1Y7BA 4MGQA 4XUQA 1UY2A 1GU3A 3HNBM 2J1RA 4CVUA 3A21A 3ZXKA 5IYYA 1H6XA 2KD7A 3W5NA 2J1TA 2WO3A 4A6OA 4UDKA 1I5PA 1UXXX 3WEZA 3NNGA 1XC6A 3CMGA 2EXIA 3IDAA 2VZOA 5HPOA 2VMDA 1OH4A 4LQRA 2X8TA 1F4HA 5CYYA 3K4AA 3SEPA 3T2PA 2EIBA 1J84A 5FK7A 1PMJX 4JKLA 4N4BA 1K12A 3NRUA 3VSZA 4GWIA 4QB1A 3R4YA 2X05A 2W9XA 2VZ1A 2VM9A 1GUIA 2E32A 2J1VA 3PUHA 1OYGA 3A7QA 2EIEA 2VZUA 2CDPA 2YG0A 1CZVA 3WPUA 4QDSA 1NAEA 4DUXA 3I2JA 4BK4A 5ANNA 1O8PA 2YC4A 5A7VA 1UZ0A 2YFRA 4KMIA 2YFUA 4IUGA 2WYSA 1GYDB 2X09A 1JI6A 1UYXA 1GQPA 1CZSA 2EIDA 5FKBA 3C7OA 5JXHA 4QX0A 2WQ8A 4XZUG 3WN2A 4A4AA 3UGFA 3WPZA 2QQVA 2ZEXA 3HN3A 2W3JA 4QB2A 3QEEA 4DXSA 1Y9GA 5JOXA 4UAPA 3IIIA 2ORXA 3SKVA 1JZ8A 2ADDA 2ZEYA 1SHWB 1WCQA 2WAOA 3K46A 4CU7A 2BZDA 2QQKA 3I2IA 3VDCA 4AK5A 2J1UA 3UNPA 3AKHA 2DCJA 2PQSA 3HNMA 4FFIA 3K1UA 5GLRA 4QX1A 3U75A 2YFTA 1JYVA 5I0DA 4XURA 3GM8A 2WO1A 5C71A 2VZVA 3P2NA 3D5YA 2V4VA 3VSFA 2WUHA 3OG2A 4P5YA 3VDBA 2E33A 3UESA 3HPNA 4MOAA 3WPYA 2DCKA 2W1WA 1PT2A 2VTFA 4N2ZA 5A8DA 3BYLA 3OM4A 4XUPA 3HEIA 2W95A 1IQDC 2Y6KA 2JKXA 1GNYA 4XUNA 3QEFA 1W9WA 3WATA 3CZJA 2WZEA 5FKCA 3UGHA 3AC0A 2BERA 5B6TA 2C9KA 3MUY1 2VO5A 2YB7A 4A44A 3LDRA 4UDIA 3DYPA 3K75B 3TAWA 3OEAA 4P08A 4QDQA 1Y4WA 3VD5A 3NQHA 2Y8KA 3LF7A 5AYEA 3MV11 1JYXA 2V72A 5LA1A 4W8JA 3T0DA 4RYDA 3HOBA 2W87A 3U37A 2B4KA 1L7QA 5FUIA 1XPWA 4Z2AA 3SC7X 3SKJE 1L7RA 5JXIA 3WAUA 3VSRA 3WMYA 4A3ZA 4DEQA 4LKSA 2QQUA 4ZZ5A 3PIGA 1TG7A 4XUTA 3KF3A 2E31A 4PVAA 3ABZA 2W94A 3NJVA 4OMCA 1SG3A 2C4XA 3EB7A 1GOGA 4COTA 3D60A 4HG6B 3OGSA 3HNYM 3IAQA 1YRZA 2YC2A 4UDJA 4O8NA 5JXJA 1PMHX 4KC8A 2QQWA 2J1AA 3I3DA 1K45A 1OF3A 3I3EA 5GLPA 4QPWA 2VZTA 3C8XA 2J7MA 3WF1A 3ACFA 5JMOA 4L0PA 1UYPA 5DQ0A 2AEYA 3WN1A 4OZOA 4AK7A 3OGVA 3T0AA 3ZXLA 5G04L 1JYNA 2AEZA 5LA0A 4QB6A 1BHGA 4CU8A 2VCCA 4TTGA 2VCAA 5FMDA 3WSOA 4LPLA 2VOTA 3T08A 3P6BA 4EQVA 5CZKA 4CUCA 4PF1A 1NX9A 3THDA 2CDOA 1JZ4A 3U14A 1F4AA 1UWWA 2B4WA 5G05L 3AKIA 2W47A 4CU9A 2Y6JA 1WL7A 5JR2A 1UYYA 2VQUA 1DLCA 2DDUA 1UYZA 4PVIA 1US3A 2W91A 1XNAA 1UY0A 3LDKA 1O59A 1W18A 5LCWL 2WZ8A 2QBXA 3T2QA 4JKMA 1NUKA 4CU6A 3THCA 2EXJA 4AAXA 4ONZA 5GLOA 3OB8A 4U6DA 3ZM8A 1K42A 2L9LA 1JYWA 3KSTA 3WNOA 3WNMA 1UMIA 1JHJA 3QC2A 5IFTA 1WKYA 5AYCA 5DPNA 2QQIA 3ZXJA 4QQSA 1JZ5A 1KEXA 4BK5A 3WNPA 1MPXA 2RV9A 2VR4A 5IFPA 1ST8A 4UDGA 2E26A 3WNLA 3GDBA 4FFHA 3I2KA 4U6BA 1T2XA 4XUOA 1W0NA 5JOWA 2W92A 1J83A 3NJXA 2HYXA 2V5DA 5IHRA 3DYOA 3OM6A 2BGOA 1JZ2A 4KCAA 3LEMA 3CZUA 1W9TA 4N2RA 5JOZA 4D47A 1UV4A 3GXUA 1JZ6A 3PIJA 2JDAA 3VD4A 1GMMA 5A1AA 2VMEA 3WASA 4KC7A 4MLGA 3E1F1 3WF0A 3MBWA 2C26A 3WNNA 3A22A 4ET7A 1H6YA 3PUIA 5EJ1B 2LW8A 2QQMA 1YI7A 1PX4A 4M4PA 3VSSA 4KWUA 1YQ2A 3ECQA 1LNSA 2RJ2A 2VZPA 3WNKA 3F2ZA 1JZ7A 5GLMA 1GOHA 1UXZA 5J1XA 4BXSV 1CZTA 4W50A 4P00B 4UOJA 5B4NA 3BYJA 1HN1A 2Y6HA 3CKHA 4ARXA 4QX3A 1UMHA 3MO4A 4JKKA 1CX1A 2VCBA 3W5MA 4O8OA 3OBAA 2HLEA 3ACIA 1CIYA 4QX2A 3K4ZA 3VD7A 2W1UA 3LIGA 2VMCA 4M4RA 2EXHA 2J22A 5A8CA 2BGPA 3DECA 3FN9A 3K77A 5JOYA 4UDKE 1PX3A 3MV01 3OGRA 5JXGA 4BJ0A 2XQRA 3OM7A 3ACHA 2QQLA 4A45A 3D5ZA 4PQQA 5EIYB 1US2A 1W9SA 1R64A 5C0PA 1JU3A 1OD3A 1P8JA 3GGLA 4ARYA 2WO2A 5GLNA 3BYKA 3I2FA 3ETPA 3D3AA 1EUUA 1KGYA 3JXSA 3QZ4A 1UX7A 2QQJA 4E8DA 3LQCA 1GOFA 3WF2A 1RYYA 4FI9A 3BN6A 1UY3A 4KI5M 2WDBA 1TVGA 2ID4A 3IB3A 3SEEA 4DUWA 5JUVA 3IAPA 3HJRA 1OF4A 2VZ3A 2WN2A 3WF3A 3LE0A 5DMYA 3EYPA 4TXWA 4A42A 3UETA 4ZXEA 4A41A 4MADA 5C70A 2EXKA 2YFZA 3LFIA 2LS6A 2J1EA 2ADEA 4DEVA 3R67A 2VJXA 2Y64A 3C7GA 3VD3A 3T2OA 4ZZ8A 3I2HA 1W8NA 2WBKA 3LEKA 2VQTA 5F7UA 3QEDA 4CUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DYO A;  1O8S A;  3I2G A;  3K4D A;  5AYD A;  5GLL A;  2QQN A;  2X8S A;  2XOM A;  2EIC A;  2RVA A;  5EJZ B;  2W1Q A;  3DYM A;  3OM5 A;  2BBA A;  3P1I A;  3LPG A;  3LIH A;  3OEB A;  5GLQ A;  1W2T A;  5IJR A;  4E8C A;  4KMQ A;  1Y9M A;  2ZEW A;  2W46 A;  2VDT A;  5AY9 A;  5C7G A;  1K3I A;  1OT5 A;  5LA2 A;  3VD9 A;  5HXM A;  3C7E A;  1GYH A;  3C7F A;  5DN2 A;  3VT0 A;  3LPF A;  5B4X A;  5A7V B;  4DXT A;  3WPV A;  4MO3 M;  1SDD B;  4UI9 L;  4BDV B;  3A23 A;  2X8F A;  4OYU A;  4D0Q A;  1W8O A;  3J7H A;  1JZ3 A;  4FFG A;  3WQB A;  1XNT A;  4JX0 A;  2OKX A;  3OM2 A;  4OUE A;  3LV4 A;  3CIH A;  2JE8 A;  4KCB A;  2ZEZ A;  3FHQ A;  2XHN A;  3KF5 A;  3AKG A;  4OMD A;  3T0B A;  3VDA A;  2Y6L A;  4AK6 A;  1DP0 A;  4O8P A;  1GYE B;  1D7P M;  3WF4 A;  2J1S A;  2Y6G A;  3UGG A;  2R7E B;  1VKD A;  4GZ9 A;  1ULO A;  4YPJ A;  3FL7 A;  3AKF A;  5FLW A;  3CDZ B;  4D8M A;  4MGS A;  4XVH A;  1JU4 A;  2AC1 A;  1W99 A;  1EUT A;  3I97 A;  3LEG A;  3R4Z A;  3CQO A;  4ZY9 A;  3BYN A;  4DXR A;  2X10 A;  2ORZ A;  4CUA A;  1NKG A;  5FMB A;  2WAA A;  5B6S A;  3VT1 A;  2VMF A;  4AG4 A;  3CU9 A;  2WN3 A;  2VC9 A;  2VL4 A;  2VZS A;  5GLK A;  4GWJ A;  3BGA A;  2W1S A;  3FHA A;  4LHS A;  1YIF A;  4P02 B;  2B9V A;  2XON A;  4FFF A;  3I3B A;  4W4Z A;  2W5F A;  4JHZ A;  3T09 A;  5FMC A;  4N1I A;  4DUV A;  5FIX A;  2JD9 A;  3C7H A;  3MUZ 1;  2OXB A;  2VZQ A;  3WMZ A;  4PT6 A;  2Z4F A;  4NOV A;  4QDR A;  4QAW A;  2ZXQ A;  3VT2 A;  2VZR A;  3D61 A;  3RWK X;  5FK8 A;  2QQO A;  3LEI A;  3WN0 A;  2XQX A;  1UY4 A;  1UY1 A;  1ULP A;  2YFS A;  3C2U A;  4RN5 A;  3ACG A;  2WAB A;  1Y7B A;  4MGQ A;  4XUQ A;  1UY2 A;  1GU3 A;  3HNB M;  2J1R A;  4CVU A;  3A21 A;  3ZXK A;  5IYY A;  1H6X A;  2KD7 A;  3W5N A;  2J1T A;  2WO3 A;  4A6O A;  4UDK A;  1I5P A;  1UXX X;  3WEZ A;  3NNG A;  1XC6 A;  3CMG A;  2EXI A;  3IDA A;  2VZO A;  5HPO A;  2VMD A;  1OH4 A;  4LQR A;  2X8T A;  1F4H A;  5CYY A;  3K4A A;  3SEP A;  3T2P A;  2EIB A;  1J84 A;  5FK7 A;  1PMJ X;  4JKL A;  4N4B A;  1K12 A;  3NRU A;  3VSZ A;  4GWI A;  4QB1 A;  3R4Y A;  2X05 A;  2W9X A;  2VZ1 A;  2VM9 A;  1GUI A;  2E32 A;  2J1V A;  3PUH A;  1OYG A;  3A7Q A;  2EIE A;  2VZU A;  2CDP A;  2YG0 A;  1CZV A;  3WPU A;  4QDS A;  1NAE A;  4DUX A;  3I2J A;  4BK4 A;  5ANN A;  1O8P A;  2YC4 A;  5A7V A;  1UZ0 A;  2YFR A;  4KMI A;  2YFU A;  4IUG A;  2WYS A;  1GYD B;  2X09 A;  1JI6 A;  1UYX A;  1GQP A;  1CZS A;  2EID A;  5FKB A;  3C7O A;  5JXH A;  4QX0 A;  2WQ8 A;  4XZU G;  3WN2 A;  4A4A A;  3UGF A;  3WPZ A;  2QQV A;  2ZEX A;  3HN3 A;  2W3J A;  4QB2 A;  3QEE A;  4DXS A;  1Y9G A;  5JOX A;  4UAP A;  3III A;  2ORX A;  3SKV A;  1JZ8 A;  2ADD A;  2ZEY A;  1SHW B;  1WCQ A;  2WAO A;  3K46 A;  4CU7 A;  2BZD A;  2QQK A;  3I2I A;  3VDC A;  4AK5 A;  2J1U A;  3UNP A;  3AKH A;  2DCJ A;  2PQS A;  3HNM A;  4FFI A;  3K1U A;  5GLR A;  4QX1 A;  3U75 A;  2YFT A;  1JYV A;  5I0D A;  4XUR A;  3GM8 A;  2WO1 A;  5C71 A;  2VZV A;  3P2N A;  3D5Y A;  2V4V A;  3VSF A;  2WUH A;  3OG2 A;  4P5Y A;  3VDB A;  2E33 A;  3UES A;  3HPN A;  4MOA A;  3WPY A;  2DCK A;  2W1W A;  1PT2 A;  2VTF A;  4N2Z A;  5A8D A;  3BYL A;  3OM4 A;  4XUP A;  3HEI A;  2W95 A;  1IQD C;  2Y6K A;  2JKX A;  1GNY A;  4XUN A;  3QEF A;  1W9W A;  3WAT A;  3CZJ A;  2WZE A;  5FKC A;  3UGH A;  3AC0 A;  2BER A;  5B6T A;  2C9K A;  3MUY 1;  2VO5 A;  2YB7 A;  4A44 A;  3LDR A;  4UDI A;  3DYP A;  3K75 B;  3TAW A;  3OEA A;  4P08 A;  4QDQ A;  1Y4W A;  3VD5 A;  3NQH A;  2Y8K A;  3LF7 A;  5AYE A;  3MV1 1;  1JYX A;  2V72 A;  5LA1 A;  4W8J A;  3T0D A;  4RYD A;  3HOB A;  2W87 A;  3U37 A;  2B4K A;  1L7Q A;  5FUI A;  1XPW A;  4Z2A A;  3SC7 X;  3SKJ E;  1L7R A;  5JXI A;  3WAU A;  3VSR A;  3WMY A;  4A3Z A;  4DEQ A;  4LKS A;  2QQU A;  4ZZ5 A;  3PIG A;  1TG7 A;  4XUT A;  3KF3 A;  2E31 A;  4PVA A;  3ABZ A;  2W94 A;  3NJV A;  4OMC A;  1SG3 A;  2C4X A;  3EB7 A;  1GOG A;  4COT A;  3D60 A;  4HG6 B;  3OGS A;  3HNY M;  3IAQ A;  1YRZ A;  2YC2 A;  4UDJ A;  4O8N A;  5JXJ A;  1PMH X;  4KC8 A;  2QQW A;  2J1A A;  3I3D A;  1K45 A;  1OF3 A;  3I3E A;  5GLP A;  4QPW A;  2VZT A;  3C8X A;  2J7M A;  3WF1 A;  3ACF A;  5JMO A;  4L0P A;  1UYP A;  5DQ0 A;  2AEY A;  3WN1 A;  4OZO A;  4AK7 A;  3OGV A;  3T0A A;  3ZXL A;  5G04 L;  1JYN A;  2AEZ A;  5LA0 A;  4QB6 A;  1BHG A;  4CU8 A;  2VCC A;  4TTG A;  2VCA A;  5FMD A;  3WSO A;  4LPL A;  2VOT A;  3T08 A;  3P6B A;  4EQV A;  5CZK A;  4CUC A;  4PF1 A;  1NX9 A;  3THD A;  2CDO A;  1JZ4 A;  3U14 A;  1F4A A;  1UWW A;  2B4W A;  5G05 L;  3AKI A;  2W47 A;  4CU9 A;  2Y6J A;  1WL7 A;  5JR2 A;  1UYY A;  2VQU A;  1DLC A;  2DDU A;  1UYZ A;  4PVI A;  1US3 A;  2W91 A;  1XNA A;  1UY0 A;  3LDK A;  1O59 A;  1W18 A;  5LCW L;  2WZ8 A;  2QBX A;  3T2Q A;  4JKM A;  1NUK A;  4CU6 A;  3THC A;  2EXJ A;  4AAX A;  4ONZ A;  5GLO A;  3OB8 A;  4U6D A;  3ZM8 A;  1K42 A;  2L9L A;  1JYW A;  3KST A;  3WNO A;  3WNM A;  1UMI A;  1JHJ A;  3QC2 A;  5IFT A;  1WKY A;  5AYC A;  5DPN A;  2QQI A;  3ZXJ A;  4QQS A;  1JZ5 A;  1KEX A;  4BK5 A;  3WNP A;  1MPX A;  2RV9 A;  2VR4 A;  5IFP A;  1ST8 A;  4UDG A;  2E26 A;  3WNL A;  3GDB A;  4FFH A;  3I2K A;  4U6B A;  1T2X A;  4XUO A;  1W0N A;  5JOW A;  2W92 A;  1J83 A;  3NJX A;  2HYX A;  2V5D A;  5IHR A;  3DYO A;  3OM6 A;  2BGO A;  1JZ2 A;  4KCA A;  3LEM A;  3CZU A;  1W9T A;  4N2R A;  5JOZ A;  4D47 A;  1UV4 A;  3GXU A;  1JZ6 A;  3PIJ A;  2JDA A;  3VD4 A;  1GMM A;  5A1A A;  2VME A;  3WAS A;  4KC7 A;  4MLG A;  3E1F 1;  3WF0 A;  3MBW A;  2C26 A;  3WNN A;  3A22 A;  4ET7 A;  1H6Y A;  3PUI A;  5EJ1 B;  2LW8 A;  2QQM A;  1YI7 A;  1PX4 A;  4M4P A;  3VSS A;  4KWU A;  1YQ2 A;  3ECQ A;  1LNS A;  2RJ2 A;  2VZP A;  3WNK A;  3F2Z A;  1JZ7 A;  5GLM A;  1GOH A;  1UXZ A;  5J1X A;  4BXS V;  1CZT A;  4W50 A;  4P00 B;  4UOJ A;  5B4N A;  3BYJ A;  1HN1 A;  2Y6H A;  3CKH A;  4ARX A;  4QX3 A;  1UMH A;  3MO4 A;  4JKK A;  1CX1 A;  2VCB A;  3W5M A;  4O8O A;  3OBA A;  2HLE A;  3ACI A;  1CIY A;  4QX2 A;  3K4Z A;  3VD7 A;  2W1U A;  3LIG A;  2VMC A;  4M4R A;  2EXH A;  2J22 A;  5A8C A;  2BGP A;  3DEC A;  3FN9 A;  3K77 A;  5JOY A;  4UDK E;  1PX3 A;  3MV0 1;  3OGR A;  5JXG A;  4BJ0 A;  2XQR A;  3OM7 A;  3ACH A;  2QQL A;  4A45 A;  3D5Z A;  4PQQ A;  5EIY B;  1US2 A;  1W9S A;  1R64 A;  5C0P A;  1JU3 A;  1OD3 A;  1P8J A;  3GGL A;  4ARY A;  2WO2 A;  5GLN A;  3BYK A;  3I2F A;  3ETP A;  3D3A A;  1EUU A;  1KGY A;  3JXS A;  3QZ4 A;  1UX7 A;  2QQJ A;  4E8D A;  3LQC A;  1GOF A;  3WF2 A;  1RYY A;  4FI9 A;  3BN6 A;  1UY3 A;  4KI5 M;  2WDB A;  1TVG A;  2ID4 A;  3IB3 A;  3SEE A;  4DUW A;  5JUV A;  3IAP A;  3HJR A;  1OF4 A;  2VZ3 A;  2WN2 A;  3WF3 A;  3LE0 A;  5DMY A;  3EYP A;  4TXW A;  4A42 A;  3UET A;  4ZXE A;  4A41 A;  4MAD A;  5C70 A;  2EXK A;  2YFZ A;  3LFI A;  2LS6 A;  2J1E A;  2ADE A;  4DEV A;  3R67 A;  2VJX A;  2Y64 A;  3C7G A;  3VD3 A;  3T2O A;  4ZZ8 A;  3I2H A;  1W8N A;  2WBK A;  3LEK A;  2VQT A;  5F7U A;  3QED A;  4CUB A; 
#chains in the Genus database with same CATH topology
 3ZSE A;  3AVS A;  2FDF A;  1ZA7 A;  1QJZ A;  3K4D A;  2TNF A;  4RFT 0;  2K46 A;  2ZGS A;  2WT2 A;  1CJD A;  5LY1 A;  2RMU 1;  2X8S A;  3MZH A;  3H7J A;  3WHT A;  2W1Q A;  2VOV A;  2WR9 A;  4JRA A;  2BTV C;  2CAV A;  5HCA A;  5GLQ A;  5BUV A;  3OEB A;  4D94 A;  1W2T A;  4RR3 C;  3AZX A;  4NPL A;  4CXW A;  1W0O A;  5KHK A;  1BJQ A;  1K5M C;  1Y9M A;  3O1U A;  1G9C A;  1RUF 3;  1KJR A;  5HBA A;  3UJO A;  4QKD A;  4NHL A;  1OT5 A;  1ACC A;  1HQW A;  2RR1 3;  1WUV A;  1YLL A;  2DVG A;  4K6B A;  4NO4 A;  5LA2 A;  3VD9 A;  1QOT A;  3C7E A;  1CQ9 A;  2BNN A;  5FZB A;  1VBD 1;  3SH3 A;  3MFC A;  3MLK A;  4LNV A;  2KA3 A;  4UI9 L;  1O3Q A;  1J1L A;  1TQ5 A;  3A23 A;  3J7H A;  5ACA 2;  5CG9 A;  4FFG A;  3ZFG A;  4GH4 A;  1XNT A;  1HXS 3;  2R49 A;  1IS4 A;  1UOG A;  2F6B A;  2D5H A;  3WT3 A;  3UT0 A;  5KXB A;  2LRO A;  2HEW F;  2VOW A;  3CIH A;  3L2H A;  3RZK A;  1SMV A;  1AYM 2;  1UZZ A;  2ZEZ A;  4QQL A;  2YPJ A;  3ITQ A;  4XW3 A;  3X29 B;  5T55 A;  4OMD A;  4H7L A;  3T0B A;  3ZDS A;  3ZXG A;  4O8P A;  1Q8O A;  1YIP A;  4AI9 A;  1QXJ A;  4IE7 A;  2VH9 A;  3WF4 A;  4OHW A;  3EJK A;  1BVV A;  3UGG A;  1UPS A;  2RS3 1;  4UXA A;  2Q8E A;  4URA A;  1ULO A;  3AKS A;  1VBE 2;  1DBN A;  4YSF A;  3AKF A;  5KC5 A;  3BOD A;  4D8M A;  5KHI A;  4AI0 A;  3WDV A;  1JU4 A;  2AZ5 A;  2I74 A;  2AC1 A;  5AFB A;  4LE4 A;  3I97 A;  5EV7 A;  2VMI A;  4V2W A;  4ES9 A;  1H30 A;  4K3U A;  4MHU A;  1CR7 A;  4D7Y A;  4XCB A;  5FZ0 A;  4DXR A;  2X10 A;  1WW6 A;  2ORZ A;  4XHX A;  5FMB A;  2WAA A;  5LAT A;  1SDW A;  4UW5 A;  4PIZ A;  3KT4 A;  3VBU A;  5IVY A;  2WN3 A;  1PGL 1;  2VL4 A;  1PHM A;  4IEW A;  4M3C A;  4GWJ A;  4ASK A;  4CCJ A;  1CAW A;  2JG8 C;  3VBR C;  2XJQ A;  5FRE A;  4FO9 A;  4IE6 A;  1Y9Q A;  1YQ8 A;  2RM2 1;  4P02 B;  5FV3 A;  1I1E A;  5DDJ 1;  2WT0 A;  4FP3 A;  1WCD J;  2B9V A;  1AX2 A;  1W0P A;  3FZ3 A;  4FFF A;  1AR6 3;  3T09 A;  3RYK A;  4Q4V 2;  3I4I A;  4GIQ A;  1RUO A;  2O1Q A;  3SH5 A;  1QNY A;  4N1I A;  5K9Y A;  5BNO C;  1UAI A;  4HFS A;  3C7H A;  3NNL A;  5KR7 A;  1D4V B;  1RMU 3;  1ZZB A;  4NAM A;  4PT6 A;  2Z4F A;  1VAM A;  1YUD A;  2I07 B;  5FZI A;  3M3E A;  4RR3 B;  4P9W A;  2VZR A;  4YGD A;  2XJR A;  3IWZ A;  4X6R B;  4CXX A;  5JPM B;  3O1M A;  3HT1 A;  5FLI A;  4RS5 C;  3FWE A;  5FQ0 A;  3R05 A;  1F35 A;  2PQQ A;  4RN5 A;  3ACG A;  1ODN A;  1J58 A;  4MGQ A;  2YDE A;  3ON7 A;  3HN1 A;  1QMJ A;  2HWE 3;  2Q0A A;  2VUC A;  4FPL A;  4YWA A;  3RVH A;  4A2U A;  1AR7 3;  3KQ4 B;  2IFW A;  3HNB M;  4XJA A;  3ZXK A;  4E4S A;  4HSL A;  1H6X A;  2H6C A;  4K9S A;  3K48 A;  4AE2 A;  3HVD A;  3LA7 A;  1CAX A;  4YZ5 A;  1RVF 1;  1YWK A;  4FPY A;  4XF0 A;  2ZX4 A;  2JX9 A;  1X82 A;  2EXI A;  3INA A;  2ZJC A;  2E7T A;  1BBT 3;  4HET A;  3ZYH A;  3KHC A;  2UWC A;  1FOD 1;  4BYY A;  4ZKT B;  1RGS A;  2C0Z A;  2XL7 A;  3E97 A;  1SAC A;  2W68 A;  3K4A A;  4QPG C;  3T2P A;  1QDC A;  2UYB A;  1V70 A;  1HV0 A;  5T3N A;  3RJR A;  4CEY A;  4N53 C;  3NRU A;  3ZSL A;  1O7F A;  3OBR A;  4UFM A;  1STM A;  4OI4 A;  4J1X A;  1ZBA 1;  2LM3 A;  2VZ1 A;  4UFL A;  1H8T C;  3NL1 A;  3RI8 A;  1REF A;  3PUH A;  1ULE A;  2GH2 A;  3A7Q A;  2ZZJ A;  4CUG A;  1OLM E;  4A7Z A;  5FYC A;  1RUI 1;  1W8F A;  3ZSJ A;  1NAE A;  1VRH 3;  2FDJ A;  3LB9 A;  3POI A;  3WX5 A;  4EE2 A;  1N1V A;  4MSV A;  1AJO A;  2XBO 3;  3I2J A;  3AZW A;  3VZM A;  1OFS A;  5FYI A;  4BQY A;  5HCH A;  4HZF A;  3N7M A;  2PEL A;  1LHV A;  4IUG A;  2K9Z A;  1QXR A;  1VB2 A;  2RS1 1;  1GYD B;  1JI6 A;  3DPR C;  3VHN A;  1CZS A;  1FPN 2;  1QJU 1;  4P9Y A;  5C9A C;  1BEV 1;  1WLT A;  5ERL A;  2NN8 A;  2JG8 B;  4LKE A;  4XZU G;  1R08 2;  3UGF A;  3VBR B;  3HQU A;  3W20 A;  4A4A A;  2QQV A;  1LOF A;  3BPZ A;  4LHL A;  4OZX A;  1ULD A;  1KDM A;  4QB2 A;  4DXS A;  4ONU A;  1GR3 A;  2SBA A;  2PHW A;  3I8T A;  4LLO A;  4UAP A;  2ORX A;  3SKV A;  1JZ8 A;  5A3M A;  1W6N B;  2VBB A;  1PGW 2;  3W58 A;  4XQ4 A;  5BNO B;  4CU7 A;  2WNO A;  2DF7 A;  3VDC A;  3RZG A;  1V6O A;  4RSU A;  5DUW A;  2PQS A;  1H4H A;  2GMM A;  4FFI A;  3AZY A;  3Q8C A;  3SCG A;  2GAL A;  1W03 A;  2EAK A;  2R06 1;  4RS5 B;  1RUE 2;  4LUK A;  4HN1 A;  1WCS A;  1JYT A;  1PIV 1;  1PO1 1;  1QJX 1;  5C71 A;  2IVJ A;  2IXC A;  3FFZ A;  1SLB A;  3QH6 A;  5BV6 A;  5LZ6 A;  5FMO S;  4KWJ A;  1LOC A;  2MEV 1;  4R52 A;  2QE3 A;  3VDB A;  1QH6 A;  1OFN A;  1QU0 A;  2BU9 A;  1RUC 3;  2E33 A;  3UES A;  3B01 A;  3D4K A;  1DDL A;  2DCK A;  1PT2 A;  5A8D A;  3NNF A;  2P3Y A;  1MEC 1;  5EJ1 B;  3FBM A;  3S0M A;  3OM4 A;  5L36 A;  3KZ4 C;  2W95 A;  2QCS B;  1SFP A;  2VVF A;  4FOW A;  4W6W A;  1GNY A;  3OPZ A;  2CHH A;  4CP9 B;  1W9Y A;  2R0H A;  4LIU A;  4NHX A;  2QKD A;  1F8V A;  2ZHK A;  1W9W A;  5T5J A;  3WQ7 A;  3V0A B;  3QEF A;  3WAT A;  5FKC A;  4LBM A;  2C9A A;  3CNA A;  2JDU A;  5BY5 A;  2XJV A;  5IAX A;  5B6T A;  2C9K A;  5AVA A;  2P2K A;  4A44 A;  2BUK A;  3LDR A;  4N53 B;  5I93 A;  3K75 B;  4L99 A;  1V9U 1;  4UDI A;  1GZW B;  1QDO A;  1VBC 1;  5EPA A;  3IDC B;  1DLL A;  4P08 A;  4QDQ A;  4RR3 A;  1Y4W A;  3VD5 A;  1ASJ 3;  2Y8K A;  1H8T B;  3ZYF A;  2OII A;  5IVV A;  3P3N A;  3CEW A;  5IVC A;  1LRH A;  3LAG A;  3NKG A;  1CJP A;  3AMM A;  4F3J A;  3O1P A;  2RDN A;  4G9S B;  3U37 A;  2B4K A;  1LOB A;  4RHV 1;  3Q8A A;  4Z2A A;  3JD7 2;  5FOJ B;  4OQ9 A;  3WMY A;  2X53 S;  3VSR A;  2ET7 A;  1H0B A;  5HXV A;  4YZ1 A;  4LKS A;  1MS9 A;  2R07 2;  3PIG A;  4E4D X;  3GJA A;  4E2Q A;  1RUH 3;  4QU1 A;  1QWR A;  2E31 A;  3IMM A;  5LBC A;  4PVA A;  2W94 A;  4OMC A;  2NMN A;  3DPR B;  3OJB A;  5C9A B;  4COT A;  2XUE A;  2DVA A;  1R09 3;  5E89 A;  5LBB A;  5CIR A;  5JI7 A;  4DRV A;  1ZA4 A;  1TME 3;  3A0N A;  1WGP A;  4BWO A;  2QQW A;  5IK5 A;  2RJL A;  3KCC A;  3ZIW A;  5F3C A;  5M0T A;  2RS5 2;  2J7M A;  2JE9 A;  2P5B A;  1B09 A;  3BU7 A;  2BNM A;  3MW2 A;  3POG A;  5FYB A;  4H14 A;  3WN1 A;  4YM1 A;  3J4U H;  1X9T A;  3T0A A;  3MIB A;  3MLJ A;  5FBJ A;  4DIN B;  3UJQ A;  2VCC A;  2VQ0 A;  3M4F A;  4L9B A;  3OOX A;  1RUJ 2;  2IVI B;  4FOV A;  4LPL A;  1NLQ A;  5FZ1 A;  2DFC A;  3AJZ A;  2V4A A;  3HT2 A;  4O7X A;  3T08 A;  4EQV A;  2GP3 A;  2R32 A;  4ISQ A;  4CUC A;  4WZF A;  4PI2 A;  4YVW C;  1EV1 3;  3WDU A;  5FZ9 A;  3BTZ A;  2ARA A;  1OKO A;  4KL1 A;  1AR8 3;  4BOW A;  3U11 A;  1JZ4 A;  3E6D A;  4BU2 A;  2QNK A;  2VW1 A;  1LED A;  5CU1 A;  5FLH A;  3U14 A;  2IXK A;  4AWD A;  1IQA A;  1SEF A;  3VBR A;  2P3J A;  2W47 A;  3ZN4 A;  5F1R A;  3JQW A;  1ND2 C;  1UYY A;  1X50 A;  4CCK A;  3GBW A;  2ZKN A;  4LLF A;  3WDX A;  4PVI A;  3PL0 A;  4QX8 A;  1XNA A;  2FD8 A;  4XJW A;  5FYY A;  3BPS A;  1RUD 2;  1W6N A;  4LR4 A;  3ZIX A;  2WZ8 A;  5BNO A;  4QXH A;  1PVC 1;  3AP9 A;  4JDN A;  4PLM A;  4XDQ A;  3MF6 A;  3L2Y A;  2D40 A;  2A6W A;  1IKQ A;  2WNU A;  1VR3 A;  4OUL A;  1D4M 1;  5J7M A;  5A33 B;  1V6L A;  5C4W C;  1URX A;  2XJS A;  3FC0 A;  4Y5S A;  5A70 A;  1J3R A;  1QQP 3;  3AZZ A;  4RS5 A;  4UT5 A;  4QT6 A;  1HB4 A;  2YBS A;  5IK8 A;  4YVS C;  4A7K A;  4CCL A;  1JOB A;  4FTS A;  2VUL A;  3HAG A;  3Q9O A;  4HKL A;  4C0B A;  5A7O A;  4DOU A;  2D6M A;  4LO7 A;  4YM2 A;  3RDI A;  2W0X A;  5FJK A;  3KV6 A;  5BNQ A;  2A5Z A;  3RI9 A;  1KD7 A;  3POY A;  2WZP P;  4QQS A;  4Z1V A;  3H42 B;  4NHK A;  4KU8 A;  4L11 A;  4C1X A;  1JZ5 A;  2VCM A;  3WDW A;  3RZM A;  2ILM A;  4IXL A;  4CP9 A;  5GLU A;  1YJK A;  3GZT B;  1T2X A;  1UO9 A;  4YW1 A;  4AFM A;  5IWF A;  4NRO A;  2ARC A;  1ZRR A;  2W92 A;  2Y0I A;  4COY A;  3NJX A;  1WBF A;  3RFR A;  4Q4Y 3;  1BZW A;  5EP9 A;  2HYX A;  2V5D A;  4EZH A;  4YAR A;  5FYZ A;  3VB9 A;  3IBM A;  1CN1 A;  5DAB A;  5LWB A;  2HWC 3;  1GZW A;  4XOG A;  3AKQ A;  5F3I A;  2NPI A;  3WDT A;  2Y38 A;  5F3E A;  1H8T A;  4NR1 A;  1UV4 A;  2DVD A;  4D47 A;  4XQD A;  3PIJ A;  3FLR A;  3ZDV A;  1SFN A;  3R4U A;  5ACA 1;  4IEQ A;  3K3O A;  3POB A;  4XF1 A;  1H2N A;  2A6V A;  4TN7 A;  4JGY C;  1ENS A;  2ETE A;  1MS5 A;  2GMP A;  3AXD A;  1AYM 1;  1YFW A;  2PN5 A;  3UKV A;  1I6X A;  4YVW B;  4QM9 A;  3JZV A;  4ZHN A;  3WF0 A;  1VBB 3;  3OF1 A;  2DUP A;  2WIN B;  3DPR A;  1UU4 A;  1UIK A;  5C9A A;  2QQM A;  1JW6 A;  2EF6 A;  3OYW B;  4M0H A;  2ZPX A;  4RFR B;  4I09 A;  3I3Q A;  1ULF A;  1ND2 B;  2TEP A;  4KWU A;  4YZ2 A;  1VBE 1;  1X8M A;  2JDP A;  1LNS A;  4V2V A;  5DZF A;  5FPA A;  1JZ7 A;  4XET A;  1UXZ A;  2R04 2;  3RSJ A;  3T4V A;  4BXS V;  5IK4 A;  4P00 B;  4UOJ A;  5I0R A;  3BYJ A;  3NV2 A;  4FSJ A;  2Y6H A;  1ZZ7 A;  3CKH A;  3AMN A;  1R1A 3;  4GMP 1;  1CD3 G;  3R6S A;  2HWB 3;  3KM5 A;  4YM3 A;  5APA A;  4O8O A;  1RJ8 A;  1SLC A;  2XLG A;  2HLE A;  1ZZ6 A;  1CIY A;  3ILF A;  3OBA A;  4I2O A;  1C8M 3;  1NQD A;  2OYZ A;  5FUP A;  5FY4 A;  4M4R A;  1W6Q B;  2XML A;  2J22 A;  1LGN A;  5T5L A;  1C4R A;  2GDF A;  2BGP A;  3FN9 A;  3KV4 A;  5JOY A;  3EXU A;  3VBO A;  5LBF A;  3NVC A;  1PZ8 A;  4YVS B;  3VBF C;  3MV0 1;  5A6X A;  4UDK E;  2PHD A;  2UY8 A;  5JXG A;  4BJ0 A;  1H1M A;  4Q4V 1;  4A45 A;  4IEX A;  4B4Q A;  4PQQ A;  5F5I A;  4BQ5 A;  1P8J A;  1LOE A;  3GGL A;  2V5Y A;  2WO2 A;  1HLC A;  1WW7 A;  3LKJ A;  4OFG A;  2YUE A;  3H1W A;  5CKM A;  3SHR A;  3WOG A;  4N43 C;  3BYK A;  3I2F A;  5FY5 A;  1EUU A;  2QJV A;  4BIS A;  2BJS A;  3MIF A;  2E53 A;  2OS2 A;  4B3N A;  1GOF A;  1WLC A;  1PO2 1;  4GH4 C;  1JXN A;  4AFC A;  4CA9 A;  4NIG A;  5L9R A;  5T5O A;  4YZ4 A;  1W6P B;  2B5H A;  4M0N A;  2ID4 A;  3IB3 A;  3SEE A;  3T3Y A;  1W6M B;  2ZGK A;  1V00 A;  5A33 A;  4OUS A;  3TN9 2;  4QKN A;  3LE0 A;  3P5B A;  1HXS 2;  3UET A;  4KG8 A;  1T6G C;  2DVF A;  2F17 A;  3LFI A;  4JGY B;  1AL2 3;  2J1E A;  4NN0 A;  5F5C A;  1GQG A;  3KD4 A;  1Q5O A;  2RG4 A;  3C7G A;  4Y20 A;  2LRP A;  5FYU A;  4S2G A;  3I2H A;  5FZF A;  1WLD A;  2ERF A;  2WBK A;  3LEK A;  4R9C A;  4CCN A;  3D5O A;  4DNY A;  4BLI A;  4R9A A;  1WME A;  4IDZ A;  1O4Y A;  4QGM A;  3ZN5 A;  2JJ6 A;  1IS3 A;  1E57 A;  4Z82 A;  1UL9 A;  3AZV A;  1TMF 3;  4AGV A;  5FPU A;  4XIO A;  3PUA A;  4WM8 C;  3AMP A;  2PHL A;  2W2I A;  4U2A A;  3OM5 A;  1U0A A;  2YZ4 A;  3P1I A;  3Q8E A;  4TLF A;  3LIH A;  4YRD A;  2A3X A;  3I7D A;  1KXG A;  1ZZ8 A;  4CPB D;  5KBF A;  1OUX A;  2P3I A;  3ZKY A;  3RMY A;  4E8C A;  3EHK A;  1V0A A;  2TUN A;  1YHF A;  2ZEW A;  4XAE A;  1JBC A;  5C7G A;  1KDK A;  1XB9 A;  3AMQ A;  2GND A;  1IOA A;  5HXM A;  3ZMO A;  3LOI A;  1FPN 1;  3ZYP A;  1GV9 A;  5AVP A;  1GZC A;  1YFY A;  3PMS A;  2WFP A;  1NT0 A;  5JSO A;  3VT0 A;  1R08 1;  1MQT C;  5B4X A;  1AR6 2;  3VN4 A;  3FLP A;  4DXT A;  1TNR A;  2W52 A;  3VBF B;  2IZW A;  1AYN 3;  1NCQ C;  4QQ2 A;  1LKN A;  4YVW A;  2O8O A;  3WQB A;  1PGW 1;  2FCV A;  1VBA 3;  3AJY A;  3ZFE C;  4JX0 A;  3N9M A;  4MH0 E;  3IM0 A;  5BYN A;  4R4Z A;  3FBY A;  4MXW A;  3OYW A;  5GZD A;  4QQH A;  3RZH A;  4LBL A;  5FPZ A;  4N43 B;  4I02 A;  3KHB A;  3OY8 B;  3RQ0 A;  3DN7 A;  4AK6 A;  1H8V A;  2Y6L A;  3AKT A;  1RUE 1;  3BAL A;  4GAZ A;  5IAV A;  4QHO A;  2HWE 2;  1U5I A;  2JEC A;  1AR7 2;  1JH5 A;  1M4W A;  2RDR A;  2DBI A;  4LBQ D;  1CVN A;  3IDE A;  1O6U A;  4GH4 B;  1DGL A;  2Y6G A;  2HWF 3;  5KHG A;  1NZI A;  2BVB A;  4Y22 A;  1VB4 A;  2H0B A;  4HON A;  3FLT A;  3UL2 A;  5ISL A;  2P6H A;  2UWA A;  1AXZ A;  4FPH A;  4XVH A;  1LR5 A;  3HWJ A;  1W99 A;  4KBB A;  3JB4 C;  1EUT A;  4CEY C;  1HB3 A;  1W6Q A;  1BBT 2;  3R4Z A;  2WO7 A;  4EYU A;  4F8A A;  5ABJ B;  4BQ1 A;  4YVS A;  4GJZ A;  4HBN A;  1UNB A;  2VGD A;  2XPJ A;  1DYK A;  3GBF A;  4AG4 A;  4LOS A;  1UIJ A;  2VY0 A;  1VBD 3;  4HPK B;  5GLK A;  5C6C A;  3ZYR A;  2ARX A;  3FHA A;  4LHS A;  5CVR A;  1ZRE A;  1ZM1 A;  4IES A;  2PAM A;  1LHO A;  2D3P A;  2XON A;  5FMC A;  4JHZ A;  1ULG A;  1FV3 A;  3W21 A;  2CU5 A;  2CGP A;  1QKQ A;  3O0X A;  4E2G A;  4WM8 B;  5FXW A;  2D5F A;  4MGT A;  1NOV A;  2WFF 2;  2OXB A;  1VRH 2;  3A0K A;  3CHX A;  1G7Y A;  1H9P A;  4WBB A;  4NOV A;  1WLW A;  3WD5 A;  3JD7 1;  4K21 A;  4QAW A;  2ZXQ A;  4QM8 A;  3PVE A;  5FZO A;  3D61 A;  1HRI 3;  1W6P A;  3RWK X;  5FAX A;  1DGW X;  4PIY A;  3H8X A;  5LRR A;  2R07 1;  1ULP A;  2DVB A;  1W6M A;  3C2U A;  3O7O A;  1XYN A;  2WLQ A;  5C3S A;  1NXD 1;  1IG3 A;  5JWP A;  5C3R A;  1ND3 C;  1UZW A;  2BFU L;  3N9Q A;  3FX3 A;  3TRS B;  3POF A;  3A21 A;  3WQ1 A;  2G9F A;  2UYA A;  5IYY A;  4JGY A;  3MLL A;  1MQT B;  4IEP A;  3CBN A;  5CKQ A;  4DXZ A;  1Q56 A;  3KV5 A;  4J6G A;  4UDK A;  2QTW B;  1QXP A;  5A6Z A;  1NCQ B;  4CDU C;  4HSJ A;  1DU3 D;  3NNG A;  1XC6 A;  4HVO A;  4K1Z A;  4NRQ A;  3TNQ A;  1O3R A;  1AUY A;  4ATF A;  4CCD A;  1CWP A;  1C5H A;  3IDA A;  2RS5 1;  4Q4X 2;  3ZFE B;  2FHR A;  1OH4 A;  2OX0 A;  2WJS A;  3S5Q A;  1RHI 3;  3WUD A;  5A7W A;  4LQR A;  1QHD A;  3RYR A;  4IV1 A;  5CYY A;  4CP0 A;  2EIB A;  5DDJ 3;  1J84 A;  4AFB A;  1F5J A;  3ZKU A;  4N4B A;  4JKL A;  1IHM A;  1X7N A;  1K12 A;  2FMD A;  2UWB A;  2XHK A;  4UFJ A;  4KGG A;  2ARE A;  2GNM A;  5CNA A;  4GWI A;  5T54 A;  3R4Y A;  1RUJ 1;  2W9X A;  3S7I A;  2G9G A;  3GHM A;  1Z7S 3;  2D98 A;  1GUI A;  1RUC 2;  4Q0S A;  4B29 A;  4Y5T A;  4FOY A;  5F2W A;  3I49 A;  1LOG A;  4AVT A;  1F15 A;  1UZV A;  2VZU A;  2YG0 A;  1YFU A;  3IDB B;  3VKN A;  5SV8 A;  5A32 B;  1D0H A;  2BDR A;  4OQ8 A;  4CEY B;  3T2T A;  5DAX A;  4EN6 B;  4BQX A;  4DUX A;  4LK6 A;  5J3U A;  4Y3O A;  3QBQ A;  2YC4 A;  2ZX1 A;  3OGG A;  4LK7 A;  4I0W B;  3VBF A;  2YFU A;  5IVF A;  4K7J A;  2WYS A;  3O0V A;  5FPB A;  3H3U A;  5T50 A;  4FXK B;  2VPV A;  1UYX A;  1GQP A;  3IPV B;  4BHP A;  5A80 A;  1RUD 1;  4UFK A;  1QOS A;  3OD4 A;  1Q8S A;  3LCP A;  2WQ8 A;  3IKW A;  4YG3 A;  3WPZ A;  1POV 0;  4LKD A;  2VW2 A;  2GN3 A;  4JGZ B;  1ASJ 2;  4NVP A;  2O0O A;  1YNA A;  2R30 A;  4S2F A;  5FJH A;  1LEN A;  2V73 A;  4QMA A;  3QEE A;  4N43 A;  1S1A A;  2ZTN A;  3OY8 A;  1XXN A;  3B94 A;  1UOF A;  1WBL A;  1FOD 3;  3TBD A;  1C28 A;  2RDQ A;  4O61 A;  2A6Z A;  3DGT A;  2FDG A;  4Y1Z A;  2OUJ A;  1ZX5 A;  2FDI A;  3HMY A;  1QJE A;  3M7A A;  3DXT A;  4Q2F A;  4C91 A;  4AVS A;  3K1U A;  4QX5 A;  5BXX A;  4NHY A;  4CDW C;  1RUH 2;  2YFT A;  5I0D A;  3USS A;  3JCI A;  2XB6 C;  3GM8 A;  5F6K A;  5A3N A;  2A3W A;  1R09 2;  4QQO A;  1ND3 B;  3ZFF C;  3D0J A;  3VSF A;  2Q8D A;  4HK8 A;  1CON A;  3B5L B;  5ABJ A;  2WUH A;  4PHZ A;  1RUI 3;  1OKQ A;  1PVX A;  4BMB A;  4DY3 A;  3PLQ A;  2VTF A;  5FY9 A;  1IS5 A;  3B00 A;  4HPK A;  4I0A A;  4CDU B;  1DGW A;  3E6C C;  1M06 G;  3OSD A;  4E27 A;  3HEI A;  3AKP A;  3QAC A;  1POV 1;  3VBS C;  4QD2 A;  4TWT A;  2C5D A;  5FZ8 A;  2RS1 3;  2Y0O A;  4GKX A;  4WM7 A;  5K4L A;  3CZJ A;  2FCT A;  1O4Z A;  4LMF A;  3Q8F A;  1FMD 2;  4WM8 A;  1GZ9 A;  3M1H A;  3ROU A;  2YU2 A;  1W04 A;  1J59 A;  1MVE A;  2OVU A;  3QD6 A;  2PHR A;  1EV1 2;  3NQH A;  1ZVF A;  1QH7 A;  5AYE A;  1PK6 C;  3MV1 1;  4XJU A;  5H9S A;  5LA1 A;  1CPN A;  5FUI A;  4WVW A;  4ERO A;  2D6K A;  2R06 3;  4Q0V A;  1REE A;  4A3Z A;  2HYK A;  3BOP A;  1QJX 3;  2CV6 A;  1MQT A;  4LKF A;  2JB8 A;  2WNU C;  3GZE A;  1LES A;  1OXC A;  3LGR A;  4AQS A;  4CZS A;  1LGB A;  1EPZ A;  5IW0 A;  1NCQ A;  1WA4 A;  3NJV A;  4QXB A;  1D2Q A;  4GB3 3;  2P3K A;  1G8W A;  3THP A;  3TEW A;  2R04 1;  1GBG A;  3WR0 A;  3HNY M;  3ZFE A;  3OPT A;  4QKF A;  1PO2 2;  1W39 A;  4ZPI A;  5IUQ A;  1H1I A;  5JXJ A;  3DKW A;  5FYT A;  4KC8 A;  3NW4 A;  1QQP 2;  3TAY A;  3PNA A;  2J1A A;  4MHR A;  5ANQ A;  1K45 A;  2PA7 A;  2VNG A;  1MS4 A;  4UWD A;  5CAD A;  5FO9 B;  2WWS A;  5JSP A;  3JBG 3;  1EY2 A;  2VW0 A;  4LO5 B;  1CGP A;  1WMD A;  3ACF A;  4SBV A;  5IVE A;  1UYP A;  3PUR A;  4M01 A;  1QEX A;  5JMO A;  1YEW A;  4YFZ A;  1W90 A;  3R4D B;  1V9U 3;  2MHF A;  4W65 A;  5AFE A;  4CDW B;  2BW8 A;  5FY8 A;  1SQ4 A;  4CU8 A;  2LUW A;  1GP6 A;  4XDO A;  5A32 A;  4XBQ A;  4TSV A;  1MZ5 A;  2JKB A;  4DS0 A;  2VBP A;  3ZMN A;  3P6B A;  5GJ6 A;  2FZ1 A;  3ZFF B;  3GZU C;  4AVV A;  4PF1 A;  3THD A;  1UW8 A;  2NZ9 A;  5FZG A;  5DAP A;  4RGG A;  1UOB A;  2B39 A;  4Q4Y 2;  1ZNP A;  2QZ2 A;  4TYS A;  5AC9 2;  4ITC A;  1F4A A;  3WY6 A;  2ZBJ A;  1UWW A;  3IPV A;  1DFQ A;  4IV3 C;  5JZG C;  5G05 L;  2B4W A;  2CGO A;  1DZT A;  2HWC 2;  3BB6 A;  5FTT C;  5FUN A;  3VHO A;  2P34 A;  4NPR A;  2Y6J A;  5EFU A;  4Q5O A;  3VBS B;  4CU9 A;  3GZA A;  2VQU A;  1SFY A;  1DLC A;  1OBN A;  4JGZ A;  4DIQ A;  5FZE A;  1C57 A;  1MZE A;  4IGO A;  2FMY A;  4BA6 A;  3TN9 1;  4FOQ A;  5FP3 A;  3HQX A;  2D6P A;  1W8H A;  5LCW L;  1HXS 1;  2D43 A;  5F5Q A;  4DY5 A;  1S2K A;  3AK0 A;  1EP0 A;  4FQ4 A;  2CWS A;  1W2U A;  5GLO A;  1LHN A;  3OB8 A;  4AI2 A;  5D2A A;  3BIE A;  4B4R A;  2L9L A;  5A6Y A;  1K42 A;  3KST A;  1PK6 B;  2D97 A;  4Q27 A;  1LJ7 A;  3WDY A;  3ZXE A;  1BCX A;  2IXI A;  3WNM A;  4I01 A;  2HWD 2;  4MG2 A;  1ND3 A;  1KS4 A;  3VZO A;  2YC0 A;  2FBE A;  3AL6 A;  4K8F A;  4LJH A;  3ST7 A;  2P17 A;  1O3T A;  3EO6 A;  3HR9 A;  4X6Q B;  2WNU B;  4XFH A;  1LCL A;  4AVC A;  2QQI A;  3BTY A;  4S2D A;  3ZXJ A;  1GP5 A;  4AR2 A;  3MHZ A;  1MPX A;  2RV9 A;  3WNP A;  4CDU A;  1COV 3;  1I9R A;  1ST8 A;  5FP9 A;  3T4H B;  1SLL A;  1N3Q A;  1MZ6 A;  1W8W A;  1R1A 2;  3I3M A;  2HWB 2;  3GDB A;  2NLR A;  3NNM A;  5FP4 A;  4FFH A;  4KH9 A;  3NNJ A;  4XFA A;  3VBO C;  3B02 A;  3VZK A;  4BQW A;  4U6B A;  1C8M 2;  1QY4 A;  4XUO A;  5JOW A;  1DZQ A;  4P5H A;  1GWK A;  3ZPO A;  4B4P A;  3O12 A;  1JOJ A;  3DYO A;  1JZ2 A;  4CTE A;  5TSW A;  3LEM A;  1S2E A;  2VD7 A;  3MW3 A;  1JHN A;  3N36 A;  3VL9 A;  1AR6 1;  2E51 A;  5KHH A;  1W9T A;  1XNB A;  1V6M A;  3GXU A;  4OHZ A;  3RNS A;  1KFX L;  2JDA A;  2BWC A;  4HKO A;  5DAV A;  3IZO A;  2XWJ B;  4PLO A;  2HKX A;  3WXP A;  3ZYB A;  2DWR A;  4COV A;  2A1X A;  2YU1 A;  5A1A A;  2VME A;  3OUJ A;  3BU0 A;  3USU B;  1F2N A;  2WA4 A;  3BUC A;  3NV1 A;  1LAJ A;  4A3X A;  4ES8 A;  3KMH A;  1EAH 3;  2PHU A;  5C3O A;  4JAA A;  2IXJ A;  4CCE A;  1VAV A;  2JDN A;  3D8C A;  1Q8Q A;  1F9K A;  2NMO A;  2ZGP A;  2HWE 1;  3ES4 A;  2YBK A;  3FMG A;  4LE3 A;  2JIC A;  3WNN A;  1AR7 1;  1RUG 3;  1S0J A;  2BOI A;  2IFR A;  2LW8 A;  1GWM A;  3GNE A;  3L9J T;  1YI7 A;  3LZZ A;  4IV3 B;  1VPH A;  4MET A;  4OUM A;  4XAB A;  3VSS A;  5CFD C;  2OA2 A;  1LUL A;  2Y60 A;  1A34 A;  2XKO A;  1RXG A;  1YQ2 A;  3O1T A;  3ECQ A;  3MIE A;  5LK5 A;  5IK7 A;  1HQL A;  2QDR A;  3WNK A;  4ORF A;  3F2Z A;  2E9Q A;  3THT A;  3VGI A;  1VE0 A;  1HRV 3;  4XPV A;  2ATF A;  1BBT 1;  1OA3 A;  2EAL A;  1AL2 2;  1HN1 A;  1W3X A;  4SLI A;  4Z92 B;  1UMH A;  4XZP A;  1QJY 2;  3HBZ A;  1XE7 A;  4D69 A;  3GBG A;  2CTV A;  3LIG A;  5CEH A;  4CDW A;  3DEC A;  4XTP A;  4D6R A;  1B35 A;  4LA2 A;  3N3H A;  1HW5 A;  2B9U A;  2XWB B;  4QX7 A;  3K2O A;  4XDP A;  1ZZ9 A;  5ACA 3;  3T1L A;  3FFQ A;  3ZFF A;  2NM1 A;  4BME A;  2XQR A;  3ACH A;  4Q1R A;  3D5Z A;  1US2 A;  5HCB A;  2WFF 1;  2XR4 A;  1VRH 1;  1JU3 A;  3PU3 A;  4JDM A;  3WG4 A;  1V6I A;  5GLN A;  3PU8 A;  4IQP A;  2EVX A;  3MFA A;  1RIT A;  5DAW A;  3D3A A;  3VBS A;  4CP2 A;  1JYI A;  3SIS A;  1KGY A;  1EYB A;  5LEJ A;  1ENQ A;  3VBO B;  3G6J B;  3QZ4 A;  4D6S A;  3HD8 B;  2GC3 A;  2WSU A;  3LQC A;  4E8D A;  4RGK A;  1G9B A;  5BNP C;  2QZ3 A;  3VKO A;  1YFX A;  3RMX A;  2PAK A;  3BN6 A;  4KI5 M;  3KWV A;  1DIW A;  4P9L A;  4BQ2 A;  1AYN 2;  5DXD A;  1V6K A;  5JUV A;  3IAP A;  2WWJ A;  2X8K A;  4K8R B;  5JR7 B;  2EIG A;  4IEU A;  2WN2 A;  5E16 A;  2WL1 A;  3VDD C;  1PK6 A;  3EYP A;  4NWV A;  3WF3 A;  1OPM A;  4GMP 3;  4DZG A;  2ZGU A;  4A42 A;  1AR9 2;  4E4H A;  4Q0P A;  2YFZ A;  3ASI A;  4Q4X 1;  4XFB A;  1S0D A;  3RPQ A;  1YC6 1;  1XU2 A;  4ASM B;  5EWS A;  4AGR A;  1SCS A;  1ZBE 3;  2VJX A;  2Y64 A;  2YGL A;  3IMN A;  1DQ0 A;  3T2O A;  3VD3 A;  3TEZ A;  4OI0 A;  1W8N A;  3AFK A;  5E1R A;  2BRT A;  5CA6 A;  2R1D A;  2GH8 A;  1DYO A;  5A3P A;  4GJY A;  1O8S A;  1FI2 A;  4Q4V 3;  2HWF 2;  1W3V A;  2JEM A;  2VNO A;  4URT A;  5FZ3 A;  4FTE A;  1N47 A;  1RUC 1;  2XOM A;  2G9Z A;  2OZJ A;  3KSC A;  3ELN A;  1GZT A;  4PBO A;  4RA0 A;  4LUL A;  5CFD B;  1H2K A;  3U0Z A;  5FZM A;  5C5T A;  5JIA A;  3LPG A;  2DYC A;  4Y20 B;  4P14 A;  1KJL A;  1L3J A;  5LB6 A;  4KMQ A;  4ZS2 A;  3LSE A;  2CWM A;  2JWP A;  3JUU A;  3NMB A;  1R1Z A;  1U5X A;  3J8F 3;  1AHS A;  4L97 A;  3ZSM A;  3RZJ A;  2VDT A;  3DF0 A;  5AY9 A;  4X8P A;  4IEZ A;  5F6L B;  4N9I A;  5FZH A;  1OUS A;  4FAG A;  2Q4S A;  2W08 A;  1SBE A;  4HKW A;  2X29 A;  1GYH A;  5DN2 A;  3PVO A;  3AYE A;  2A6X A;  1GKB A;  4RD7 A;  4MO3 M;  3USU A;  2JDK A;  1ASJ 1;  3WCR A;  4DO0 A;  5FPV A;  1JOP A;  4BDV B;  1ZRD A;  3LDB A;  1UF2 C;  4FVV A;  3O1V A;  1W6O B;  1V6J A;  1W8O A;  4OLL A;  1FX5 A;  1FV2 A;  5KXC A;  1OLR A;  3LA3 A;  4GD4 A;  2OKX A;  3LSD A;  4AFA A;  4AI8 A;  4P9X A;  5FXX A;  3OM2 A;  5JZG A;  3LV4 A;  1HRI 2;  4IV3 A;  2JE8 A;  4ZS3 A;  4KCB A;  2WT1 A;  2HEV F;  2AAC A;  1H4G A;  3KF5 A;  4ISR A;  2Z79 A;  5K0U C;  3VHP A;  1IZ3 A;  5GZE A;  1RUH 1;  1DP0 A;  5JMC A;  1GYE B;  4AYU A;  1RXF A;  2ZHN A;  4FPF A;  4NJ4 A;  5BNP B;  4XJZ A;  1QIQ A;  3W9A A;  2KR2 A;  1R09 1;  3FUQ A;  2QVS B;  3ZYI B;  3WCS A;  3SIT A;  2R7E B;  2WZR 3;  1VKD A;  4GZ9 A;  2QDN A;  3CLP A;  3PTR B;  3FL7 A;  3RJ2 X;  3VKL A;  4NWW A;  2RDS A;  4IV1 C;  4MXW B;  3CDZ B;  4EWA A;  4MGS A;  1NYW A;  3A4U A;  4E4Z A;  2PFW A;  2Y6F A;  2PLV 2;  2FDH A;  1A6C A;  3VDD B;  4H2A A;  3TEY A;  1X33 A;  5FZ6 A;  1E5I A;  1RHI 2;  1UOJ A;  3SMH A;  3BYN A;  2UUR A;  4JHT A;  2O8Q A;  1NKG A;  4B1L A;  2PTM A;  3ZXD A;  1ZYB A;  4J1W A;  2VC9 A;  2VZS A;  3PTY A;  4Y22 B;  2YMZ A;  1S4C A;  5DG1 A;  1K5J A;  3BGA A;  3VBH C;  4B7K A;  1FMD 1;  4CDQ A;  4I3G A;  1WW5 A;  4NOT A;  5EQU A;  1YIF A;  2XL9 A;  4YNI A;  2UU8 A;  4IEY A;  4BIO A;  4N7I A;  1JTZ X;  4HXC A;  1Z7S 2;  4PCR A;  4RL7 A;  4YGC A;  4QGL A;  5FPX A;  1EV1 1;  2XGX A;  2WSV A;  2FDK A;  4BZ4 A;  1BMV 2;  4YW2 A;  2Q8O A;  4DUV A;  2A6Y A;  5FIX A;  3LOB A;  2VZQ A;  3WMZ A;  4M3C F;  4Y4Y A;  4JC1 A;  5LBE A;  4QDR A;  1GQH A;  3VT2 A;  1FAY A;  1EPW A;  1S0G A;  3B3Q E;  3LEI A;  4UFI A;  2XQX A;  3HIF A;  3N9O A;  1UY4 A;  5I0T A;  1UY1 A;  5DUU A;  3AFG A;  1RUF 2;  4XUQ A;  1UY2 A;  1GU3 A;  2RR1 2;  1QNW A;  1NZC A;  2F4L A;  2IC1 A;  5LY2 A;  4C8D A;  4QWN A;  5A3U A;  1G9D A;  2TBV A;  2ZOE B;  3BYW A;  4AK3 A;  1C8N A;  2KD7 A;  1L7L A;  4CCO A;  1HIX A;  5FZO B;  1RC6 A;  1XYP A;  2ZGM A;  1UXX X;  2Q1F A;  1QQP 1;  5FY1 A;  3PUS A;  5FRA A;  3AP5 A;  2GN7 A;  2YBP A;  3PJQ A;  4BPZ A;  5HPO A;  1XJA A;  1E5R A;  2B45 X;  2VMD A;  4A6S A;  1TL2 A;  1W8U A;  4AEK A;  4Q4W 3;  4MGK E;  3SQO A;  2X8T A;  4EN8 B;  3SXW A;  5ABJ C;  2P1B A;  4Q0Q A;  5CFD A;  5E88 A;  5K0U B;  5FK7 A;  1PMJ X;  4OCT A;  5JZG B;  4CEW C;  1DQ6 A;  2NQY A;  4N9H A;  1UD1 A;  4YW5 A;  4PDW C;  1NQJ A;  4YW7 A;  2X05 A;  4EJR A;  2X5I C;  1VMJ A;  4WM7 C;  1XE8 A;  2XLF A;  4NID A;  5A7W B;  1OYG A;  5DAQ A;  1FNY A;  3JD7 3;  4IV1 B;  2CDP A;  3WPU A;  1CZV A;  4OHV A;  5F8P A;  4Q4Y 1;  4QDS A;  5AC9 1;  3VUO A;  1OOP B;  1TEI A;  4XXA A;  4ZXK A;  2WS9 3;  3M3I A;  4Y5Z 0;  4FPO B;  5FPL A;  1AL0 G;  2HWC 1;  3QCW A;  1NY7 2;  3V64 A;  1O8P A;  1Y3T A;  4BK4 A;  4KGQ A;  2D6O X;  3DL3 A;  2Y33 A;  4HMZ A;  1DYP A;  1S0I A;  3MIC A;  4LHN A;  4Q8K A;  4KMI A;  4HT1 T;  1C1L A;  1W6O A;  2X09 A;  2VMH A;  2EID A;  4PI0 A;  4DFS A;  3SCH A;  4GXL A;  4H7M A;  4NAO A;  4QX0 A;  4XJ9 A;  3VBH B;  1YJL A;  3M3Q A;  5FYS A;  1MS1 A;  2YPD A;  2W3J A;  2GC1 A;  3D6E A;  4XC9 A;  5FZ4 A;  4Y26 A;  2VTX J;  1VAL A;  4LBO A;  3III A;  4EN0 A;  4XFI A;  2GC0 A;  2ADD A;  5JSR A;  2YXS A;  1X8E A;  1PZ7 A;  1N3O A;  2WAO A;  2ZMK A;  5SV5 A;  5BNP A;  3I2I A;  1XSQ A;  4XYX A;  1D0G A;  5FBZ A;  5C8C C;  3UNP A;  3AKH A;  2DCJ A;  2HWD 1;  1RMU 2;  3HNM A;  1DG6 A;  5DUX A;  2BBV A;  5GLR A;  4QX1 A;  3U75 A;  3H1Y A;  4IW3 A;  4O65 A;  2KM2 A;  2ZAA A;  1RUJ 3;  4XMI A;  4XUR A;  1ENX A;  2CGN A;  3H1M A;  4GB3 2;  1HN0 A;  2Y26 A;  4UFH A;  3V0B A;  2WO1 A;  5FZK A;  3RS6 A;  3VDD A;  3P2N A;  4AL9 A;  1GSL A;  2XKP A;  3CO2 A;  3D5Y A;  4DMI A;  5T5P A;  3H3L A;  1R1A 1;  4J25 A;  2RMU 3;  4P5Y A;  2HWB 1;  1ULC A;  3H8U A;  4MOA A;  1Z78 A;  1RL3 A;  1I3H A;  2W1W A;  1VLN A;  1C8M 1;  3N9L A;  1IPK A;  1POQ A;  3NO8 A;  4Y33 A;  4DQA A;  3DCQ A;  3JBG 2;  3RYP A;  4XUP A;  4I3P A;  2UY9 A;  4MX3 A;  2H0V A;  2JKX A;  4CDX A;  1J3P A;  1W28 A;  4RQP A;  1AJK A;  1RUD 3;  4XFF A;  4HLT A;  5FLJ A;  2WZE A;  5I8T A;  3I2D A;  3B93 A;  1JS9 A;  2WRA A;  2BER A;  2JDH A;  3AC0 A;  4XHB A;  2YRO A;  3TNP B;  3UGH A;  3WW1 A;  3RZL A;  3MUY 1;  4QPI C;  3J9S A;  2YB7 A;  4EN9 B;  1WMX A;  4CEW B;  4UF0 B;  3PJY A;  4LBQ B;  1A8M A;  1VMH A;  4PDW B;  1Y43 B;  4IL7 A;  4OI1 A;  1GFF 2;  3MGU A;  2X5I B;  4JGZ C;  2ENR A;  1OPO A;  2ZZQ A;  4WM7 B;  2BP6 A;  1RIN A;  4MV2 A;  3HOB A;  2W87 A;  2ZGO A;  3O0W A;  2Z2S B;  1Q8V A;  3PME A;  3I2O A;  4FAH A;  1QGL A;  1XPW A;  4P9J A;  3SKJ E;  1L7R A;  5JXI A;  2GNB A;  4XBN A;  3U07 A;  4CSW A;  3UK9 A;  2QQU A;  1BYH A;  3OCP A;  1TG7 A;  2XBO 2;  3O5S A;  4Z07 A;  2Z5W A;  4EWE A;  1AXY A;  4XUT A;  3M3O A;  4NE9 A;  3ZR6 A;  1RUN A;  1SG3 A;  3EB7 A;  1GOG A;  2VQA A;  4H55 A;  2B46 X;  2A3Y A;  2K2S A;  3CF6 E;  4F7Z A;  3D60 A;  2VUJ A;  1PZ9 A;  2VBD A;  1YRZ A;  1W2O A;  3IAQ A;  3AMH A;  2RS3 3;  2YC2 A;  1OI6 A;  1AL2 1;  3O14 A;  4HN0 A;  2WQ4 A;  1TE1 B;  1PMH X;  1QJY 1;  4LIT A;  5FOB B;  1OF3 A;  3MI8 A;  4D3W A;  5K0U A;  4QPW A;  2VZT A;  2ZA9 A;  5DZG A;  5BNN A;  1FYU A;  3N7J A;  3VKM A;  3DEM A;  3WF1 A;  4L0P A;  5C5U A;  5GZC A;  1ZZC A;  4C1W A;  2AEN A;  4AK7 A;  5IVJ A;  4GKY A;  5C8C B;  3OGV A;  4MGZ E;  4W6Y A;  2Q1M A;  2Z42 A;  1AXK A;  4IGP A;  3ZXL A;  4KBZ A;  3WQ0 A;  4AQ6 A;  1BHG A;  3UKT A;  4TTG A;  2ZGR A;  3KLS A;  5D8A C;  3E5X A;  3TYJ A;  1COV 2;  3BIW E;  1XU1 A;  1OOP A;  2BFU S;  2RM2 3;  2VOT A;  4YW3 A;  5A3T A;  2DCZ A;  5CZK A;  3GAL A;  3KQR A;  2O14 A;  1G9A A;  1NX9 A;  1MR5 A;  4I30 A;  2CDO A;  3QLQ A;  5JVV A;  1C5I A;  3AYA A;  3NAP A;  4FPJ A;  4YGE A;  4E2S A;  1JMU B;  3POW A;  2JDM A;  3Q8B A;  4IGQ A;  1OQD A;  3VBH A;  1NE4 A;  5EJ3 A;  2AUY A;  2C24 A;  2ZGN A;  1WL7 A;  2R6Q A;  4UYB A;  5B2G B;  1GP4 A;  4Y1X A;  5JR2 A;  4IE5 A;  4P9G A;  1AYN 1;  3RGB A;  3LD8 A;  2R04 3;  4AEJ A;  1UYZ A;  1FT9 A;  4QQP A;  2W91 A;  1ALY A;  1UU6 A;  1UY0 A;  2A7A A;  2W39 A;  1O59 A;  3NJZ A;  5T52 A;  1W18 A;  5EZW A;  4QPI B;  4ZU5 A;  1AR9 1;  1CAV B;  2NYY A;  3TOJ A;  1NUK A;  4CPB A;  2DTY A;  3GHN A;  4CU6 A;  5FCC A;  3AP6 A;  2AGS A;  1EAH 2;  3V56 A;  4LEJ A;  4LHK A;  2VUD A;  1RVF 3;  4LBK A;  1RUG 2;  1SLA A;  2ZKL A;  2EA7 A;  1FNZ A;  3C3V A;  4UBG A;  4NIH A;  1JHJ A;  2P37 A;  1U12 A;  4JQR A;  2VXR A;  1PM7 A;  1YYN A;  2HWF 1;  1C1F A;  4YW4 A;  5GAL A;  5L7O C;  4FXG B;  2GNT A;  5AYC A;  3N7L A;  5DPN A;  1Q3E A;  3WP4 A;  3WP5 A;  2LTN A;  5F2S A;  2FQP A;  1HRV 2;  3FE5 A;  5HV0 A;  4BK5 A;  5JPN B;  4UW3 A;  5A6Q A;  3OBT A;  5IFP A;  5E6H A;  5C2M A;  1ZBA 3;  3FHI B;  2A71 A;  4XJ8 A;  1B35 C;  2HJI A;  4BCU A;  2VOX A;  4L2N A;  3PHM A;  1W0N A;  1TME 2;  1S2B A;  1J83 A;  1LHW A;  3WHU A;  5IHR A;  1YO8 A;  3OM6 A;  4D7S A;  1RTV A;  3MW4 A;  4AGG A;  4KCA A;  4CEW A;  1VRB A;  3DV8 A;  3TWI A;  1W8T A;  4UF0 A;  1XNC A;  4XAC A;  4LBQ A;  4PDW A;  4OHX A;  3TN9 3;  5DG2 A;  4N2R A;  5JOZ A;  2XVK A;  3J7M A;  2X5I A;  3PVB B;  1JZ6 A;  2DU1 A;  4R4X A;  2R16 A;  3VD4 A;  1IS6 A;  1WWY A;  1QJU 3;  1BEV 3;  2OZ6 A;  1IKP A;  1GMM A;  2XJP A;  1OA2 A;  4HVQ A;  4S2H A;  5D8A B;  2WNV C;  1H1A A;  4X8N A;  4R9D A;  5A3L A;  1HRI 1;  4KQ7 A;  4YG0 A;  5GLZ A;  4AEM A;  5A7Q A;  1VAK A;  3MPP G;  2JB4 A;  2VUA A;  4KC7 A;  1WA6 X;  1X36 A;  2VTX A;  4FCA A;  2CYF A;  4LO6 B;  3U1X A;  1DGR A;  1XE0 A;  4QPY A;  5CIS A;  5E8A A;  4R8H A;  1AR8 2;  1SZB A;  2C26 A;  4K20 A;  3A22 A;  4TZD A;  4ET7 A;  1CAU B;  2E6V A;  1H2L A;  1SLT A;  2ZHL A;  3M3C A;  2ZX0 A;  1G86 A;  3PUI A;  3AX4 A;  4KNC A;  4RGA A;  1JOD A;  4NRP A;  5A7N A;  1HQN A;  3S7E A;  1WCK A;  3AKR A;  4LIV A;  3WLU A;  1E5S A;  1GNZ A;  4V1P A;  3MIH A;  2RJ2 A;  2VZP A;  2VEC A;  1PIV 3;  1PO1 3;  4AHW A;  1GOH A;  2PLV 1;  5J1X A;  2Z69 A;  1CZT A;  1AVB A;  4W50 A;  5B4N A;  4BQ3 A;  5L73 A;  2MEV 3;  2Q5T A;  1RHI 1;  4XF4 A;  3MO4 A;  1LU1 A;  5C8C A;  2XDV A;  4IET A;  1ZBE 2;  2VCB A;  3W5M A;  3ACI A;  3K4Z A;  2JIG A;  2W1U A;  3OGJ A;  4XXP A;  4IND A;  4JCK A;  2VMC A;  1MEC 3;  3WNX A;  4Y24 A;  2ZCW A;  1N3P A;  3K77 A;  3ZYJ B;  3ZN6 B;  3N9P A;  2CSG A;  4QGN A;  1Z7S 1;  4EN7 B;  1BK0 A;  3B69 A;  3OGR A;  3UV9 A;  1N1Y A;  5L7O B;  3OM7 A;  5EYX A;  4B8E A;  5J98 B;  4MGI E;  4Q29 A;  1BMV 1;  3OUI A;  5L9V A;  5EIY B;  1YQ5 A;  4IEV A;  1W9S A;  1R64 A;  3KGL A;  2A70 A;  1K5M B;  3KCY A;  3WG3 A;  1OD3 A;  1VBC 3;  4JVA A;  2RHP A;  1UCX A;  2RJK A;  3J8F 2;  3ETP A;  4C90 A;  4CCC A;  4FPK A;  1B35 B;  4WVZ A;  1APN A;  1QOO A;  2IUW A;  1BXH A;  2XJU A;  2ZHM A;  2WNE A;  3ME2 A;  1RUF 1;  3W59 A;  2HBU A;  2YY1 A;  3WF2 A;  4RHV 3;  5GZF A;  4BH9 A;  5JCT A;  4MUV A;  2JXA A;  1RYY A;  5J37 A;  4QPI A;  3WW2 A;  2RR1 1;  1CAV A;  1UY3 A;  2WDB A;  3V65 A;  3ZXF A;  4BXF A;  4Y1U A;  4JDO A;  4DUW A;  3ZOI A;  2E63 A;  2JG9 C;  3HJR A;  1OF4 A;  2VZ3 A;  2XLA A;  3EQE A;  1LTE A;  1CX4 A;  5DMY A;  2ZGL A;  5GLW A;  3NKT A;  4MYE A;  4TXW A;  1NE6 A;  4C0H A;  1O5U A;  4XEZ A;  4MAD A;  3ZSK A;  5A1L A;  5C70 A;  2EXK A;  3WW4 A;  4Y4R A;  2WNV B;  2LS6 A;  5CB7 A;  4A7Y A;  2ADE A;  4DEV A;  1LGC A;  3FJS A;  4HAN A;  4D6Q A;  4CUB A;  4E9K A;  2YGM A;  1IG0 A;  5F7U A;  2VXJ A;  3GJB A;  1HJF A;  3I2G A;  3B7M A;  1VBB 2;  1F31 A;  3LWC A;  5K7P A;  3FUO A;  3ORJ A;  2WZR 2;  5A7S A;  5AYD A;  5GLL A;  1RJ7 A;  2QQN A;  2WFF 3;  4AOC A;  3RWN A;  5EJZ B;  2EIC A;  2RVA A;  4ZU7 A;  3BTX A;  4FTB A;  5FZL A;  5FO7 B;  3DYM A;  2BBA A;  4QHZ A;  3KGZ A;  5IJR A;  4LXL A;  2ZX3 A;  4CDQ C;  3OPW A;  3N4M A;  3GCX A;  2JE7 A;  2XVL A;  3POE A;  4CP1 A;  4DPN A;  1DGR N;  1NY7 1;  2W46 A;  3PDQ A;  4JTN A;  2G4I A;  4YLZ A;  3SCF A;  1PNF A;  2BV4 A;  4QKB A;  1K3I A;  4BB3 A;  4CYD A;  5LK7 B;  1DHK B;  5FFO C;  1S0F A;  5I8Y A;  2DUO A;  2AYH A;  4GWN A;  2XJT A;  5FY7 A;  5I0U A;  3CL1 A;  5JAX A;  3C7F A;  5FMO L;  3AYC A;  5D8A A;  4N7U A;  3LPF A;  5A7V B;  3SH4 A;  3N7K A;  2JD4 A;  3UKN A;  3WPV A;  2D6L X;  2VU9 A;  1SDD B;  4P9I A;  1YXW A;  3WG1 A;  2X8F A;  3HBK A;  4OYU A;  4D0Q A;  1JZ3 A;  4Q4X 3;  3OD0 A;  2WWU A;  4NMI A;  4XAA A;  1PVC 3;  2C6S A;  3MIG A;  4IE0 A;  1CAU A;  1GAN A;  2VAU A;  4OUE A;  2D3R A;  4AVA A;  5KXE A;  4IEO A;  5K8S A;  1RMU 1;  1OUR A;  1D4M 3;  1UKR A;  3FHQ A;  2XHN A;  5HI0 A;  3VKF C;  3AKG A;  3VDA A;  1E5H A;  2NP0 A;  1OH3 A;  1KS5 A;  3R4S A;  4PIX A;  1IPJ A;  4JV4 A;  1O91 A;  4XCA A;  3JQX A;  2ZX2 A;  4GB3 1;  5FZD A;  3E5U A;  5JI9 A;  1D7P M;  1S0E A;  4AI3 A;  4AI1 A;  5F32 A;  2PHT A;  2J1S A;  4ZU4 A;  3NV4 A;  1OMI A;  2VNV A;  4YPJ A;  5F5A A;  1PM4 A;  5FLW A;  4FPC A;  2JG9 B;  3BI3 A;  4AHX A;  4HK9 A;  3MPB A;  1WW4 A;  4O9E A;  1DQ5 A;  1LOA A;  1UX6 A;  3JBG 1;  3LEG A;  4QXK A;  5FXZ A;  2D93 A;  5BPX A;  3CQO A;  2DU0 A;  2YYO A;  4PLN A;  4Q4W 2;  4QPG B;  4ZY9 A;  4BE3 A;  5JDB A;  1YCI A;  3U4X A;  3ZN6 A;  4CUA A;  4ASL A;  1FXZ A;  5B6S A;  1OQE A;  5L9B A;  2VMF A;  3CU9 A;  1KIT A;  1HV1 A;  3P3P A;  4Z2W A;  5L7O A;  3VT1 A;  5FZ7 A;  1NA1 C;  1W06 A;  2W1S A;  4COZ A;  1NCR C;  1K5M A;  1A3K A;  2OT7 A;  1W05 A;  3ZVX A;  1HB1 A;  1IPS A;  1LOD A;  1N1T A;  5FY0 A;  3I3B A;  4W4Z A;  2W5F A;  3WIN E;  1KRI A;  2PHX A;  1BK1 A;  1TMF 2;  1F5F A;  3AB0 A;  2JD9 A;  1LU2 A;  3MUZ 1;  3VZL A;  2MPF A;  2WS9 2;  2D44 A;  1TZO A;  3DUI A;  4AQT A;  1XNK A;  4QXC A;  1WZX A;  4CDQ B;  4UW4 A;  2Q1Z B;  5FK8 A;  1UKG A;  2QQO A;  3WN0 A;  1AYM 3;  1RIR A;  2DBN A;  4G4F A;  2WA3 A;  4K40 A;  5I0S A;  3VL8 A;  2VVD A;  2XBO 1;  2YV8 A;  1Y7B A;  1WMF A;  2WAB A;  2YFS A;  2VG9 A;  4L92 A;  1JN2 P;  5LW9 A;  3ALQ A;  4H3W A;  1SBF A;  4FBF A;  4XBL A;  5CKN A;  2J1R A;  1CIW A;  3BOW A;  2WLP A;  4LBN A;  4YFW A;  4CVU A;  3CU7 A;  4YZ3 A;  2JIJ A;  2OPW A;  4EZ4 A;  2QQP A;  2WNV A;  1I5Z A;  3W5N A;  2PMW B;  2J1T A;  2CNA A;  2WO3 A;  4A6O A;  1VBE 3;  4W6X A;  4ATE A;  3O1R A;  1I5P A;  5FWJ A;  3WEZ A;  4DB5 A;  1SPP B;  3VZJ A;  3ZXA C;  3CMG A;  2BYV E;  4PBP A;  3H8O A;  5FR3 A;  2VZO A;  3K3N A;  5DZE A;  4EWD A;  3AL5 A;  3DKQ A;  5JLV A;  1O3S A;  1VBA 2;  1F4H A;  3O1O A;  2YHJ A;  1FMD 3;  3GCW A;  4Q0U A;  3ZLI A;  4LT5 A;  3SEP A;  1U5Y A;  3KB5 A;  5C8W A;  1JYC A;  3VZN A;  1O4T A;  4B7E A;  3I59 B;  5FYV A;  3VSZ A;  1COV 1;  4QB1 A;  4XE9 A;  3ILR A;  2RMU 2;  2VM9 A;  4CDX C;  4D7T A;  3E6B A;  4GWM A;  4JQT A;  4PF5 A;  4AED C;  3RZZ A;  2E32 A;  2J1V A;  4KU7 A;  1ENR A;  4RQP C;  3QH7 A;  3AXE A;  1OVP A;  1OVS A;  2EIE A;  2JG8 A;  5LA9 A;  4BQ4 A;  3WVJ A;  3KT7 A;  4XF3 A;  2BOJ A;  2HEY F;  2C1F A;  2ES3 A;  4GUL A;  3TEX A;  4Y1Y A;  5CFC C;  5ANN A;  1IGO A;  1GIC A;  5A7V A;  4JTO A;  1PGS A;  4WZC A;  1UZ0 A;  1XOY A;  3M8L A;  3T30 A;  2YFR A;  1MAC A;  5I91 A;  4FP2 A;  2F4P A;  1OHF A;  2B8M A;  5FKB A;  1S0B A;  1NA1 B;  1PO2 3;  3C7O A;  5JXH A;  1MS0 A;  1LHU A;  3WN2 A;  1VBD 2;  4HVR A;  1NCR B;  1V6N A;  2ZEX A;  3HN3 A;  1Y9G A;  5JOX A;  5FZC A;  5KWR A;  3MYX A;  1EAH 1;  2CAU A;  4YM0 A;  1OLM A;  2VNR A;  1UMZ A;  2ZEY A;  1SHW B;  1WCQ A;  4WVV A;  2WII B;  2AR6 A;  3K46 A;  2BZD A;  2QQK A;  3S6P A;  4R9B A;  4AK5 A;  1RUG 1;  2J1U A;  3WG2 A;  4OI2 A;  4GAL A;  3B9I A;  3JU9 A;  4QHB A;  5GLT A;  2A73 B;  1HDK A;  1HJG A;  1SCR A;  2BVV A;  3AP7 A;  2DUQ A;  3ZR5 A;  1JYV A;  4GQ7 A;  2JG9 A;  5EXO A;  5CBL A;  5D21 A;  1H2M A;  3CJI C;  2VZV A;  1HRV 1;  3ZPY A;  1UN1 A;  1UPI A;  1AX0 A;  3EBR A;  1H9W A;  2V4V A;  3BTA A;  1X9P A;  2RS3 2;  5BNN C;  3V0A A;  1NG0 A;  2GC2 A;  4QPG A;  3OG2 A;  3R0R A;  4COU A;  5AC9 3;  3N9N A;  4XQW A;  3HPN A;  3WPY A;  4IE4 A;  4N2Z A;  1G9F A;  4N53 A;  3EMR A;  4LA3 A;  2XVG A;  5DUV A;  4AF9 A;  1TME 1;  2E7Q A;  3BYL A;  2VVE A;  4FQZ A;  3AYD A;  4GMP 0;  4YYO A;  2XH6 A;  3U78 A;  3WP3 A;  1IQD C;  1VJ2 A;  2Y6K A;  5F37 A;  2CY6 A;  3AM2 A;  3V0B B;  1W2N A;  1OOP C;  2VMG A;  1T6B X;  4LBJ A;  3MEP A;  4YW6 A;  4XUN A;  3NST A;  4Q8L A;  1PGL 2;  4XTM A;  1KQR A;  1RED A;  5C3P A;  3D82 A;  3M70 A;  4AAP A;  1FAT A;  4AQ2 A;  3ES1 A;  4XFC A;  1FPN 3;  2VO5 A;  4AW7 A;  2RM2 2;  3DYP A;  3NAP C;  5FZA A;  5DDJ 2;  4N90 A;  3TAW A;  3KCX A;  4FT8 A;  1R08 3;  1YQ6 A;  3OEA A;  1DQ1 A;  1OQ1 A;  1N1S A;  3LF7 A;  3URF A;  4YG6 A;  2OW4 A;  1NXM A;  2ZAH A;  4YGB A;  4CDX B;  1JYX A;  2V72 A;  2R0F A;  4W8J A;  4AED B;  3M2M A;  4RQP B;  1XSR A;  4RYD A;  3ZYG A;  3T0D A;  2HWD 3;  2BNO A;  1L7Q A;  3VHR A;  1GNH A;  3SC7 X;  2PXJ A;  1AR8 1;  1XQN A;  2GU9 A;  2Y34 A;  3ATG A;  5FP8 A;  5CG8 A;  3WAU A;  3S57 A;  1J1T A;  4LUM A;  2GSY A;  4DEQ A;  5KXD A;  5CFC B;  4ZZ5 A;  4WV8 A;  3F95 A;  1RUE 3;  3KF3 A;  2J42 A;  3ABZ A;  4XIL A;  3ETQ A;  2C4X A;  1SPP A;  4G3Y C;  2ZGT A;  1PNG A;  1A78 A;  2RE9 A;  4UBH A;  4L8Q A;  4HG6 B;  3OGS A;  5KC6 A;  5L19 A;  4XFG A;  5C4W B;  4UDJ A;  2ZMN A;  2B42 B;  2OQ7 A;  4O8N A;  4Q1P A;  1AX1 A;  4NPM A;  1YQC A;  4O9G A;  5IVB A;  2CL2 A;  1ZBE 1;  1D2S A;  3MF9 A;  3I3D A;  4PQ9 A;  3WUC A;  4AZZ A;  1ZRF A;  1RVF 2;  1XYO A;  3I3E A;  5GLP A;  2OPK A;  2FCU A;  4LO4 B;  3ZO0 B;  3WP6 A;  3C8X A;  1ZRI A;  3H3Z A;  3I59 A;  4JRL A;  3WW3 A;  2AEY A;  1FOD 2;  5DQ0 A;  4LO8 A;  4OZO A;  2H6B A;  1GYK A;  4Y1V A;  5G04 L;  2PYT A;  1JUH A;  5J48 A;  1J3Q A;  1ONA A;  2AEZ A;  5GM0 A;  1JYN A;  5LA0 A;  4QB6 A;  1BQP A;  3H7Y A;  4BIF A;  2VCA A;  5FMD A;  5CAZ A;  3WSO A;  4FPE A;  4KWL A;  1ZBA 2;  5F9T A;  2B7Y A;  3CJI B;  2SLI A;  4MVT A;  4CRQ A;  3J8F 1;  4B1M A;  3J26 N;  5BNN B;  4XIK A;  4WVM B;  5IT6 A;  3U10 A;  3ZFG C;  3JB8 A;  3WZ1 A;  1RUI 2;  2BEO A;  3POS A;  4HL0 A;  5EYY A;  2ZS6 B;  1NA1 A;  3AKI A;  3IT8 A;  2Q8C A;  2G19 A;  2I45 A;  2DUR A;  1DZR A;  1NCR A;  2R1B A;  2XXZ A;  2E7A A;  3J7L A;  3NJY A;  3ACL A;  3APB A;  3POJ A;  2PHF A;  3S30 A;  2VE1 A;  2DDU A;  3ZX7 A;  4N8M A;  2R07 3;  4TLG A;  2BWA A;  2RS1 2;  1US3 A;  3BVC A;  4KWK A;  1QJU 2;  2HBT A;  3BCW A;  3LDK A;  1BEV 2;  5JIU A;  4OHY A;  3NWK A;  2D6N A;  1C3H A;  5H9Q A;  1QJF A;  1QJY 3;  2A75 A;  2QBX A;  2JDY A;  3KS7 A;  5A7P A;  3DXU A;  3LA2 A;  3NAP B;  1ODM A;  2DV9 A;  4JKM A;  2N7G A;  3T2Q A;  2EXJ A;  3THC A;  4AAX A;  4AVB A;  5KHJ A;  4ONZ A;  3OTF A;  3T1M A;  4AFD A;  5FO8 B;  4U6D A;  1WD4 A;  2GAU A;  3ZM8 A;  2GME A;  1TNF A;  1JYW A;  1A8D A;  1GWL A;  1BVP 1;  2WC2 A;  1UZY A;  3ILN A;  4OVE A;  3VV1 A;  2OQ6 A;  5A3O A;  3WNO A;  3D0S A;  5FYH A;  4CCM A;  3G7D A;  2RS5 3;  1UMI A;  4GA9 A;  3N35 A;  3QC2 A;  5F39 A;  1VBB 1;  5IFT A;  4CXY A;  3NV3 A;  2WZR 1;  4XF9 A;  3VBU C;  2IWG B;  2R06 2;  1WKY A;  3AVR A;  3VLB B;  4LTA A;  3I54 A;  1MS8 A;  1OA4 A;  1PIV 2;  1PO1 2;  1QJX 2;  1DQ2 A;  1XBF A;  2ARB A;  3SNM A;  1KEX A;  2VOK A;  1LEC A;  4MXV A;  2DCY A;  2VR4 A;  4I0B A;  5HCF A;  4AHZ A;  5LRS A;  4UDG A;  2E26 A;  2MEV 2;  2P4E A;  3WNL A;  1Q43 A;  3H50 A;  4UW6 A;  5H9P A;  3I2K A;  2OUH A;  3BKZ A;  1DF0 A;  2AH2 A;  4NHM A;  2BQP A;  3LFM A;  1MEC 2;  4HOO A;  4K1Y A;  4KG0 A;  2BGO A;  5FWE A;  3IIA A;  3CZU A;  5FYM A;  3O1S A;  1HB2 A;  5H9R A;  1Z0H A;  5IAT A;  1QF3 A;  2MNG A;  4MZU A;  1AR9 3;  1UU5 A;  4AED A;  2BGC A;  4BLJ A;  2ZML A;  4XMA A;  1NLS A;  1V9U 2;  3H8R A;  1VBC 2;  4IER A;  5A3W A;  1ND2 A;  3WAS A;  2GZW A;  1CES A;  3J7N A;  3OBZ A;  5I8S A;  5A1F A;  1W8Z A;  2JEN A;  1LB2 A;  2BPA 2;  2XG3 A;  5HV4 A;  2DCT A;  4M3C E;  5CFC A;  3CJX A;  4MLG A;  1XND A;  3E1F 1;  4QU2 A;  1BLZ A;  1OLQ A;  3GF6 A;  3ZFG B;  4EV0 A;  1VP6 A;  5GLV A;  3MID A;  1VIW B;  4RHV 2;  2ZAC A;  3MBW A;  2ZAB A;  4AHY A;  3H9A A;  3OUH A;  4COW A;  1H6Y A;  2XUM A;  3GYD A;  2WYF A;  1PX4 A;  4M4P A;  4NUB A;  5EHD A;  5C4W A;  4BM8 A;  2PAE A;  4FPG A;  1HX6 A;  1AZD A;  1OSG A;  2DTW A;  2KXL A;  5GLM A;  5FP7 A;  5J09 A;  3IN9 A;  1RB8 G;  5FDB A;  1UQX A;  4NIA A;  2P6C A;  1MVQ A;  2QFE A;  4ARX A;  4QX3 A;  1Q8P A;  1KFU L;  4Q4W 1;  1VMF A;  2D3S A;  4JKK A;  2LAL A;  1CX1 A;  1W9F A;  4QX2 A;  1G6N A;  3VD7 A;  1NLR A;  3MDP A;  2G1M A;  3PVN A;  2EXH A;  3PUQ A;  3WV6 A;  5A8C A;  5C33 A;  1DCS A;  2I2S A;  1LEM A;  1POV 3;  3QOP A;  3CJI A;  1ZRC A;  1PX3 A;  1AF9 A;  2WQZ C;  1U5Z A;  2HH9 A;  5GKA C;  1HKD A;  3VBU B;  4WVM A;  2QQL A;  1WD3 A;  4M3C B;  2IXL A;  4NRM A;  1CAW B;  1SBD A;  1TMF 1;  5C0P A;  2D7F A;  2IXH A;  1LOF C;  3KVB A;  2WS9 1;  4ARY A;  2FZ2 A;  4MGY E;  5GZG A;  2ET1 A;  3S5A A;  3H0O A;  3HQR A;  2K0G A;  4ZON A;  4DRR A;  3JXS A;  3KV9 A;  1UX7 A;  2EAA A;  2QQJ A;  5F3G A;  1GLH A;  2JDZ A;  4MLO A;  2GP5 A;  1PMI A;  1MZF A;  1O5L A;  1S55 A;  1WCU A;  1XRU A;  4FI9 A;  5J36 A;  1BKZ A;  3TB0 A;  1MS3 A;  3ENR A;  3RRD A;  4Z8B A;  5LEK A;  1YI9 A;  5FQ0 B;  1TVG A;  2V09 A;  4AXO A;  1CPM A;  2PLV 3;  1OD5 A;  1S0C A;  4JZR A;  5FXV A;  1OC1 A;  1W2A X;  2ZGQ A;  4CE8 A;  1JUI A;  4LOR A;  5LAS A;  3B9C A;  4LOT A;  4U36 A;  4ZXE A;  3SLI A;  1PVC 2;  3E5Q A;  4A41 A;  3RG0 A;  4Q26 A;  5C3Q A;  2Q30 A;  1DQ4 A;  5J96 B;  1D4M 2;  2QUO A;  3R67 A;  4NII A;  1VBA 1;  3AP4 A;  2WKK A;  4M00 A;  3KVA A;  4PJY A;  4ZZ8 A;  1CAX B;  2DFB A;  5D1I A;  3U4S A;  4F83 A;  1SLI A;  3KT1 A;  3QED A;  2VQT A;  3K51 A;  3UYJ A; 
#chains in the Genus database with same CATH homology
 1DYO A;  1O8S A;  3I2G A;  3K4D A;  5AYD A;  5GLL A;  2QQN A;  2X8S A;  2XOM A;  2EIC A;  2RVA A;  5EJZ B;  2W1Q A;  3DYM A;  3OM5 A;  2BBA A;  3P1I A;  3LPG A;  3LIH A;  3OEB A;  5GLQ A;  1W2T A;  5IJR A;  4E8C A;  4KMQ A;  1Y9M A;  2ZEW A;  2W46 A;  2VDT A;  5AY9 A;  5C7G A;  1K3I A;  1OT5 A;  5LA2 A;  3VD9 A;  5HXM A;  3C7E A;  1GYH A;  3C7F A;  5DN2 A;  3VT0 A;  3LPF A;  5B4X A;  5A7V B;  4DXT A;  3WPV A;  4MO3 M;  1SDD B;  4UI9 L;  4BDV B;  3A23 A;  2X8F A;  4OYU A;  4D0Q A;  1W8O A;  3J7H A;  1JZ3 A;  4FFG A;  3WQB A;  1XNT A;  4JX0 A;  2OKX A;  3OM2 A;  4OUE A;  3LV4 A;  3CIH A;  2JE8 A;  4KCB A;  2ZEZ A;  3FHQ A;  2XHN A;  3KF5 A;  3AKG A;  4OMD A;  3T0B A;  3VDA A;  2Y6L A;  4AK6 A;  1DP0 A;  4O8P A;  1GYE B;  1D7P M;  3WF4 A;  2J1S A;  2Y6G A;  3UGG A;  2R7E B;  1VKD A;  4GZ9 A;  1ULO A;  4YPJ A;  3FL7 A;  3AKF A;  5FLW A;  3CDZ B;  4D8M A;  4MGS A;  4XVH A;  1JU4 A;  2AC1 A;  1W99 A;  1EUT A;  3I97 A;  3LEG A;  3R4Z A;  3CQO A;  4ZY9 A;  3BYN A;  4DXR A;  2X10 A;  2ORZ A;  4CUA A;  1NKG A;  5FMB A;  2WAA A;  5B6S A;  3VT1 A;  2VMF A;  4AG4 A;  3CU9 A;  2WN3 A;  2VC9 A;  2VL4 A;  2VZS A;  5GLK A;  4GWJ A;  3BGA A;  2W1S A;  3FHA A;  4LHS A;  1YIF A;  4P02 B;  2B9V A;  2XON A;  4FFF A;  3I3B A;  4W4Z A;  2W5F A;  4JHZ A;  3T09 A;  5FMC A;  4N1I A;  4DUV A;  5FIX A;  2JD9 A;  3C7H A;  3MUZ 1;  2OXB A;  2VZQ A;  3WMZ A;  4PT6 A;  2Z4F A;  4NOV A;  4QDR A;  4QAW A;  2ZXQ A;  3VT2 A;  2VZR A;  3D61 A;  3RWK X;  5FK8 A;  2QQO A;  3LEI A;  3WN0 A;  2XQX A;  1UY4 A;  1UY1 A;  1ULP A;  2YFS A;  3C2U A;  4RN5 A;  3ACG A;  2WAB A;  1Y7B A;  4MGQ A;  4XUQ A;  1UY2 A;  1GU3 A;  3HNB M;  2J1R A;  4CVU A;  3A21 A;  3ZXK A;  5IYY A;  1H6X A;  2KD7 A;  3W5N A;  2J1T A;  2WO3 A;  4A6O A;  4UDK A;  1I5P A;  1UXX X;  3WEZ A;  3NNG A;  1XC6 A;  3CMG A;  2EXI A;  3IDA A;  2VZO A;  5HPO A;  2VMD A;  1OH4 A;  4LQR A;  2X8T A;  1F4H A;  5CYY A;  3K4A A;  3SEP A;  3T2P A;  2EIB A;  1J84 A;  5FK7 A;  1PMJ X;  4JKL A;  4N4B A;  1K12 A;  3NRU A;  3VSZ A;  4GWI A;  4QB1 A;  3R4Y A;  2X05 A;  2W9X A;  2VZ1 A;  2VM9 A;  1GUI A;  2E32 A;  2J1V A;  3PUH A;  1OYG A;  3A7Q A;  2EIE A;  2VZU A;  2CDP A;  2YG0 A;  1CZV A;  3WPU A;  4QDS A;  1NAE A;  4DUX A;  3I2J A;  4BK4 A;  5ANN A;  1O8P A;  2YC4 A;  5A7V A;  1UZ0 A;  2YFR A;  4KMI A;  2YFU A;  4IUG A;  2WYS A;  1GYD B;  2X09 A;  1JI6 A;  1UYX A;  1GQP A;  1CZS A;  2EID A;  5FKB A;  3C7O A;  5JXH A;  4QX0 A;  2WQ8 A;  4XZU G;  3WN2 A;  4A4A A;  3UGF A;  3WPZ A;  2QQV A;  2ZEX A;  3HN3 A;  2W3J A;  4QB2 A;  3QEE A;  4DXS A;  1Y9G A;  5JOX A;  4UAP A;  3III A;  2ORX A;  3SKV A;  1JZ8 A;  2ADD A;  2ZEY A;  1SHW B;  1WCQ A;  2WAO A;  3K46 A;  4CU7 A;  2BZD A;  2QQK A;  3I2I A;  3VDC A;  4AK5 A;  2J1U A;  3UNP A;  3AKH A;  2DCJ A;  2PQS A;  3HNM A;  4FFI A;  3K1U A;  5GLR A;  4QX1 A;  3U75 A;  2YFT A;  1JYV A;  5I0D A;  4XUR A;  3GM8 A;  2WO1 A;  5C71 A;  2VZV A;  3P2N A;  3D5Y A;  2V4V A;  3VSF A;  2WUH A;  3OG2 A;  4P5Y A;  3VDB A;  2E33 A;  3UES A;  3HPN A;  4MOA A;  3WPY A;  2DCK A;  2W1W A;  1PT2 A;  2VTF A;  4N2Z A;  5A8D A;  3BYL A;  3OM4 A;  4XUP A;  3HEI A;  2W95 A;  1IQD C;  2Y6K A;  2JKX A;  1GNY A;  4XUN A;  3QEF A;  1W9W A;  3WAT A;  3CZJ A;  2WZE A;  5FKC A;  3UGH A;  3AC0 A;  2BER A;  5B6T A;  2C9K A;  3MUY 1;  2VO5 A;  2YB7 A;  4A44 A;  3LDR A;  4UDI A;  3DYP A;  3K75 B;  3TAW A;  3OEA A;  4P08 A;  4QDQ A;  1Y4W A;  3VD5 A;  3NQH A;  2Y8K A;  3LF7 A;  5AYE A;  3MV1 1;  1JYX A;  2V72 A;  5LA1 A;  4W8J A;  3T0D A;  4RYD A;  3HOB A;  2W87 A;  3U37 A;  2B4K A;  1L7Q A;  5FUI A;  1XPW A;  4Z2A A;  3SC7 X;  3SKJ E;  1L7R A;  5JXI A;  3WAU A;  3VSR A;  3WMY A;  4A3Z A;  4DEQ A;  4LKS A;  2QQU A;  4ZZ5 A;  3PIG A;  1TG7 A;  4XUT A;  3KF3 A;  2E31 A;  4PVA A;  3ABZ A;  2W94 A;  3NJV A;  4OMC A;  1SG3 A;  2C4X A;  3EB7 A;  1GOG A;  4COT A;  3D60 A;  4HG6 B;  3OGS A;  3HNY M;  3IAQ A;  1YRZ A;  2YC2 A;  4UDJ A;  4O8N A;  5JXJ A;  1PMH X;  4KC8 A;  2QQW A;  2J1A A;  3I3D A;  1K45 A;  1OF3 A;  3I3E A;  5GLP A;  4QPW A;  2VZT A;  3C8X A;  2J7M A;  3WF1 A;  3ACF A;  5JMO A;  4L0P A;  1UYP A;  5DQ0 A;  2AEY A;  3WN1 A;  4OZO A;  4AK7 A;  3OGV A;  3T0A A;  3ZXL A;  5G04 L;  1JYN A;  2AEZ A;  5LA0 A;  4QB6 A;  1BHG A;  4CU8 A;  2VCC A;  4TTG A;  2VCA A;  5FMD A;  3WSO A;  4LPL A;  2VOT A;  3T08 A;  3P6B A;  4EQV A;  5CZK A;  4CUC A;  4PF1 A;  1NX9 A;  3THD A;  2CDO A;  1JZ4 A;  3U14 A;  1F4A A;  1UWW A;  2B4W A;  5G05 L;  3AKI A;  2W47 A;  4CU9 A;  2Y6J A;  1WL7 A;  5JR2 A;  1UYY A;  2VQU A;  1DLC A;  2DDU A;  1UYZ A;  4PVI A;  1US3 A;  2W91 A;  1XNA A;  1UY0 A;  3LDK A;  1O59 A;  1W18 A;  5LCW L;  2WZ8 A;  2QBX A;  3T2Q A;  4JKM A;  1NUK A;  4CU6 A;  3THC A;  2EXJ A;  4AAX A;  4ONZ A;  5GLO A;  3OB8 A;  4U6D A;  3ZM8 A;  1K42 A;  2L9L A;  1JYW A;  3KST A;  3WNO A;  3WNM A;  1UMI A;  1JHJ A;  3QC2 A;  5IFT A;  1WKY A;  5AYC A;  5DPN A;  2QQI A;  3ZXJ A;  4QQS A;  1JZ5 A;  1KEX A;  4BK5 A;  3WNP A;  1MPX A;  2RV9 A;  2VR4 A;  5IFP A;  1ST8 A;  4UDG A;  2E26 A;  3WNL A;  3GDB A;  4FFH A;  3I2K A;  4U6B A;  1T2X A;  4XUO A;  1W0N A;  5JOW A;  2W92 A;  1J83 A;  3NJX A;  2HYX A;  2V5D A;  5IHR A;  3DYO A;  3OM6 A;  2BGO A;  1JZ2 A;  4KCA A;  3LEM A;  3CZU A;  1W9T A;  4N2R A;  5JOZ A;  4D47 A;  1UV4 A;  3GXU A;  1JZ6 A;  3PIJ A;  2JDA A;  3VD4 A;  1GMM A;  5A1A A;  2VME A;  3WAS A;  4KC7 A;  4MLG A;  3E1F 1;  3WF0 A;  3MBW A;  2C26 A;  3WNN A;  3A22 A;  4ET7 A;  1H6Y A;  3PUI A;  5EJ1 B;  2LW8 A;  2QQM A;  1YI7 A;  1PX4 A;  4M4P A;  3VSS A;  4KWU A;  1YQ2 A;  3ECQ A;  1LNS A;  2RJ2 A;  2VZP A;  3WNK A;  3F2Z A;  1JZ7 A;  5GLM A;  1GOH A;  1UXZ A;  5J1X A;  4BXS V;  1CZT A;  4W50 A;  4P00 B;  4UOJ A;  5B4N A;  3BYJ A;  1HN1 A;  2Y6H A;  3CKH A;  4ARX A;  4QX3 A;  1UMH A;  3MO4 A;  4JKK A;  1CX1 A;  2VCB A;  3W5M A;  4O8O A;  3OBA A;  2HLE A;  3ACI A;  1CIY A;  4QX2 A;  3K4Z A;  3VD7 A;  2W1U A;  3LIG A;  2VMC A;  4M4R A;  2EXH A;  2J22 A;  5A8C A;  2BGP A;  3DEC A;  3FN9 A;  3K77 A;  5JOY A;  4UDK E;  1PX3 A;  3MV0 1;  3OGR A;  5JXG A;  4BJ0 A;  2XQR A;  3OM7 A;  3ACH A;  2QQL A;  4A45 A;  3D5Z A;  4PQQ A;  5EIY B;  1US2 A;  1W9S A;  1R64 A;  5C0P A;  1JU3 A;  1OD3 A;  1P8J A;  3GGL A;  4ARY A;  2WO2 A;  5GLN A;  3BYK A;  3I2F A;  3ETP A;  3D3A A;  1EUU A;  1KGY A;  3JXS A;  3QZ4 A;  1UX7 A;  2QQJ A;  4E8D A;  3LQC A;  1GOF A;  3WF2 A;  1RYY A;  4FI9 A;  3BN6 A;  1UY3 A;  4KI5 M;  2WDB A;  1TVG A;  2ID4 A;  3IB3 A;  3SEE A;  4DUW A;  5JUV A;  3IAP A;  3HJR A;  1OF4 A;  2VZ3 A;  2WN2 A;  3WF3 A;  3LE0 A;  5DMY A;  3EYP A;  4TXW A;  4A42 A;  3UET A;  4ZXE A;  4A41 A;  4MAD A;  5C70 A;  2EXK A;  2YFZ A;  3LFI A;  2LS6 A;  2J1E A;  2ADE A;  4DEV A;  3R67 A;  2VJX A;  2Y64 A;  3C7G A;  3VD3 A;  3T2O A;  4ZZ8 A;  3I2H A;  1W8N A;  2WBK A;  3LEK A;  2VQT A;  5F7U A;  3QED A;  4CUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...