3VSRA

Microbacterium saccharophilum k-1 beta-fructofuranosidase catalytic domain
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
493
structure length
493
Chain Sequence
LQDGPEPTIHTQQAYAPEDDFTAKWTRADARQLQRMSDPTAPSRENSMPASVTMPTVPQDFPDMSNEQVWVWDTWPLTDEDANQYSVNGWEIIFSLVADRNLGFDDRHVFAKIGYFYRPAGVPAAERPENGGWTYGGLVFKEGVTGQIFEDQSFSHQTQWSGSARVSKNGEIKLFFTDVAFYRNSDGTNIKPYDPRIALSVGKVKANKKGVTLTGFNKVTDLLQADGTYYQTGAQNEFFNFRDPFTFEDPAHPGETFMVFEGNSAMQRETATCNEADLGYRQGDPYAETVDDVNASGATYQIGNVGLAKAKNKQLTEWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFVGDGIRSDYQPLNGGSGLALGNPTNLNFLGGQPFAPDFNQHPGHFQAYSHYVMPGGLVQSFIDTIGTHDDFVRGGTLAPTVKMDIGVGGDPTKTAVDYSYGSEGLGGWADIPANKHLFTNGKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-fructofuranosidase
publication title Crystal structure of a lactosucrose-producing enzyme, Arthrobacter sp. K-1 beta-fructofuranosidase
pubmed doi rcsb
source organism Arthrobacter
total genus 133
structure length 493
sequence length 493
ec nomenclature ec 3.2.1.26: Beta-fructofuranosidase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02435 Glyco_hydro_68 Levansucrase/Invertase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vsrA00
3BYLA 3LFIA 4MLGA 3QEDA 4N2ZA 4O8OA 1Y4WA 2QQVA 4EQVA 5FKCA 3D60A 3LF7A 2X8SA 5FKBA 4UDIA 1VKDA 2ADDA 3C7EA 3PIJA 4FFIA 3D5ZA 3WN2A 3BYNA 5A8CA 3WN0A 1UV4A 3LEMA 3RWKX 1W2TA 3VSFA 1ST8A 5AYCA 3WAUA 5AYEA 2YFRA 1Y7BA 3AKFA 3C7OA 2YFSA 4ONZA 3QEFA 5JOWA 3TAWA 3VSSA 3C7HA 3AKIA 3R67A 5A7VA 1UYPA 3AKGA 4N1IA 3WPVA 3QZ4A 3LDKA 4KCBA 3K1UA 4KC7A 3BYKA 2XQRA 5ANNA 1OYGA 5GLKA 3ZXKA 3KF5A 1YRZA 3LIHA 1GYEB 3U14A 3WMYA 3WATA 4AK5A 5B6TA 2QQWA 4AK7A 5GLPA 4KC8A 1PT2A 4FFGA 4UDKA 5FLWA 3C2UA 3SC7X 3U75A 3CU9A 3KSTA 4NOVA 2AEYA 3WASA 5GLQA 4FFHA 3AKHA 3LIGA 5GLRA 4U6BA 3ZXLA 1YIFA 2EXIA 2EXHA 3ZXJA 5GLNA 5AYDA 4KCAA 1Y9GA 4COTA 3WMZA 4U6DA 2OXBA 3D61A 1W18A 5FMBA 3VT1A 5B6SA 2EXKA 5GLMA 5C0PA 2B4WA 5FMCA 5A8DA 3QC2A 2X8FA 4PVAA 5A7VB 5FK8A 3OM7A 5JOYA 4UDJA 5FIXA 4N2RA 3LDRA 4AK6A 4O8NA 3VT0A 3PIGA 5JOZA 2AEZA 3UGHA 3WN1A 3C7GA 4D47A 2QQUA 3P2NA 3NQHA 2EXJA 4O8PA 3VSRA 1WL7A 3D5YA 3VSZA 4QQSA 5GLLA 3OM5A 1GYDB 3WPZA 3WPUA 5GLOA 1YI7A 1GYHA 2YFTA 4UDGA 3UGGA 3C7FA 3WPYA 3BYJA 2AC1A 3R4ZA 5FMDA 3VT2A 2VDTA 2X8TA 2ADEA 4PVIA 4KMIA 3UGFA 3KF3A 5FK7A 1Y9MA 5AY9A 4FFFA 4N4BA 3R4YA 3OM4A 3OM6A 3LV4A 3QEEA 5JOXA 4UDKE 3OM2A
chains in the Genus database with same CATH superfamily
3BYLA 3LFIA 4MLGA 3QEDA 4N2ZA 4O8OA 1Y4WA 2QQVA 4EQVA 5FKCA 3D60A 3LF7A 2X8SA 5FKBA 4UDIA 1VKDA 2ADDA 3C7EA 3PIJA 4FFIA 3D5ZA 3WN2A 3BYNA 5A8CA 3WN0A 1UV4A 3LEMA 3RWKX 1W2TA 3VSFA 1ST8A 5AYCA 3WAUA 5AYEA 2YFRA 1Y7BA 3AKFA 3C7OA 2YFSA 4ONZA 3QEFA 5JOWA 3TAWA 3VSSA 3C7HA 3AKIA 3R67A 5A7VA 1UYPA 3AKGA 4N1IA 3WPVA 3QZ4A 3LDKA 4KCBA 3K1UA 4KC7A 3BYKA 2XQRA 5ANNA 1OYGA 5GLKA 3ZXKA 3KF5A 1YRZA 3LIHA 1GYEB 3U14A 3WMYA 3WATA 4AK5A 5B6TA 2QQWA 4AK7A 5GLPA 4KC8A 1PT2A 4FFGA 4UDKA 5FLWA 3C2UA 3SC7X 3U75A 3CU9A 3KSTA 4NOVA 2AEYA 3WASA 5GLQA 4FFHA 3AKHA 3LIGA 5GLRA 4U6BA 3ZXLA 1YIFA 2EXIA 2EXHA 3ZXJA 5GLNA 5AYDA 4KCAA 1Y9GA 4COTA 3WMZA 4U6DA 2OXBA 3D61A 1W18A 5FMBA 3VT1A 5B6SA 2EXKA 5GLMA 5C0PA 2B4WA 5FMCA 5A8DA 3QC2A 2X8FA 4PVAA 5A7VB 5FK8A 3OM7A 5JOYA 4UDJA 5FIXA 4N2RA 3LDRA 4AK6A 4O8NA 3VT0A 3PIGA 5JOZA 2AEZA 3UGHA 3WN1A 3C7GA 5C2MA 4D47A 2QQUA 3P2NA 3NQHA 2EXJA 4O8PA 3VSRA 1WL7A 3D5YA 3VSZA 4QQSA 5GLLA 3OM5A 1GYDB 3WPZA 1TL2A 3WPUA 5GLOA 1YI7A 1GYHA 2YFTA 4UDGA 3UGGA 3C7FA 3WPYA 3BYJA 2AC1A 3R4ZA 5FMDA 3VT2A 2VDTA 2X8TA 2ADEA 4PVIA 4KMIA 3UGFA 3KF3A 5FK7A 1Y9MA 5AY9A 4FFFA 4N4BA 3R4YA 3OM4A 3OM6A 3LV4A 3QEEA 5JOXA 4UDKE 3OM2A
chains in the Genus database with same CATH topology
3BYLA 3LFIA 4MLGA 3QEDA 4N2ZA 4O8OA 1Y4WA 2QQVA 4EQVA 5FKCA 3D60A 3LF7A 2X8SA 5FKBA 4UDIA 1VKDA 2ADDA 3C7EA 3PIJA 4FFIA 3D5ZA 3WN2A 3BYNA 5A8CA 3WN0A 1UV4A 3LEMA 3RWKX 1W2TA 3VSFA 1ST8A 5AYCA 3WAUA 5AYEA 2YFRA 1Y7BA 3AKFA 3C7OA 2YFSA 4ONZA 3QEFA 5JOWA 3TAWA 3VSSA 3C7HA 3AKIA 3R67A 5A7VA 1UYPA 3AKGA 4N1IA 3WPVA 3QZ4A 3LDKA 4KCBA 3K1UA 4KC7A 3BYKA 2XQRA 5ANNA 1OYGA 5GLKA 3ZXKA 3KF5A 1YRZA 3LIHA 1GYEB 3U14A 3WMYA 3WATA 4AK5A 5B6TA 2QQWA 4AK7A 5GLPA 4KC8A 1PT2A 4FFGA 4UDKA 5FLWA 3C2UA 3SC7X 3U75A 3CU9A 3KSTA 4NOVA 2AEYA 3WASA 5GLQA 4FFHA 3AKHA 3LIGA 5GLRA 4U6BA 3ZXLA 1YIFA 2EXIA 2EXHA 3ZXJA 5GLNA 5AYDA 4KCAA 1Y9GA 4COTA 3WMZA 4U6DA 2OXBA 3D61A 1W18A 5FMBA 3VT1A 5B6SA 2EXKA 5GLMA 5C0PA 2B4WA 5FMCA 5A8DA 3QC2A 2X8FA 4PVAA 5A7VB 5FK8A 3OM7A 5JOYA 4UDJA 5FIXA 4N2RA 3LDRA 4AK6A 4O8NA 3VT0A 3PIGA 5JOZA 2AEZA 3UGHA 3WN1A 3C7GA 4D47A 2QQUA 3P2NA 3NQHA 2EXJA 4O8PA 3VSRA 1WL7A 3D5YA 3VSZA 4QQSA 5GLLA 3OM5A 1GYDB 3WPZA 3WPUA 5GLOA 1YI7A 1GYHA 2YFTA 4UDGA 3UGGA 3C7FA 3WPYA 3BYJA 2AC1A 3R4ZA 5FMDA 3VT2A 2VDTA 2X8TA 2ADEA 4PVIA 4KMIA 3UGFA 3KF3A 5FK7A 1Y9MA 5AY9A 4FFFA 4N4BA 3R4YA 3OM4A 3OM6A 3LV4A 3QEEA 5JOXA 4UDKE 3OM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BYL A;  3LFI A;  4MLG A;  3QED A;  4N2Z A;  4O8O A;  1Y4W A;  2QQV A;  4EQV A;  5FKC A;  3D60 A;  3LF7 A;  2X8S A;  5FKB A;  4UDI A;  1VKD A;  2ADD A;  3C7E A;  3PIJ A;  4FFI A;  3D5Z A;  3WN2 A;  3BYN A;  5A8C A;  3WN0 A;  1UV4 A;  3LEM A;  3RWK X;  1W2T A;  3VSF A;  1ST8 A;  5AYC A;  3WAU A;  5AYE A;  2YFR A;  1Y7B A;  3AKF A;  3C7O A;  2YFS A;  4ONZ A;  3QEF A;  5JOW A;  3TAW A;  3VSS A;  3C7H A;  3AKI A;  3R67 A;  5A7V A;  1UYP A;  3AKG A;  4N1I A;  3WPV A;  3QZ4 A;  3LDK A;  4KCB A;  3K1U A;  4KC7 A;  3BYK A;  2XQR A;  5ANN A;  1OYG A;  5GLK A;  3ZXK A;  3KF5 A;  1YRZ A;  3LIH A;  1GYE B;  3U14 A;  3WMY A;  3WAT A;  4AK5 A;  5B6T A;  2QQW A;  4AK7 A;  5GLP A;  4KC8 A;  1PT2 A;  4FFG A;  4UDK A;  5FLW A;  3C2U A;  3SC7 X;  3U75 A;  3CU9 A;  3KST A;  4NOV A;  2AEY A;  3WAS A;  5GLQ A;  4FFH A;  3AKH A;  3LIG A;  5GLR A;  4U6B A;  3ZXL A;  1YIF A;  2EXI A;  2EXH A;  3ZXJ A;  5GLN A;  5AYD A;  4KCA A;  1Y9G A;  4COT A;  3WMZ A;  4U6D A;  2OXB A;  3D61 A;  1W18 A;  5FMB A;  3VT1 A;  5B6S A;  2EXK A;  5GLM A;  5C0P A;  2B4W A;  5FMC A;  5A8D A;  3QC2 A;  2X8F A;  4PVA A;  5A7V B;  5FK8 A;  3OM7 A;  5JOY A;  4UDJ A;  5FIX A;  4N2R A;  3LDR A;  4AK6 A;  4O8N A;  3VT0 A;  3PIG A;  5JOZ A;  2AEZ A;  3UGH A;  3WN1 A;  3C7G A;  4D47 A;  2QQU A;  3P2N A;  3NQH A;  2EXJ A;  4O8P A;  3VSR A;  1WL7 A;  3D5Y A;  3VSZ A;  4QQS A;  5GLL A;  3OM5 A;  1GYD B;  3WPZ A;  3WPU A;  5GLO A;  1YI7 A;  1GYH A;  2YFT A;  4UDG A;  3UGG A;  3C7F A;  3WPY A;  3BYJ A;  2AC1 A;  3R4Z A;  5FMD A;  3VT2 A;  2VDT A;  2X8T A;  2ADE A;  4PVI A;  4KMI A;  3UGF A;  3KF3 A;  5FK7 A;  1Y9M A;  5AY9 A;  4FFF A;  4N4B A;  3R4Y A;  3OM4 A;  3OM6 A;  3LV4 A;  3QEE A;  5JOX A;  4UDK E;  3OM2 A; 
#chains in the Genus database with same CATH topology
 3BYL A;  3LFI A;  4MLG A;  3QED A;  4N2Z A;  4O8O A;  1Y4W A;  2QQV A;  4EQV A;  5FKC A;  3D60 A;  3LF7 A;  2X8S A;  5FKB A;  4UDI A;  1VKD A;  2ADD A;  3C7E A;  3PIJ A;  4FFI A;  3D5Z A;  3WN2 A;  3BYN A;  5A8C A;  3WN0 A;  1UV4 A;  3LEM A;  3RWK X;  1W2T A;  3VSF A;  1ST8 A;  5AYC A;  3WAU A;  5AYE A;  2YFR A;  1Y7B A;  3AKF A;  3C7O A;  2YFS A;  4ONZ A;  3QEF A;  5JOW A;  3TAW A;  3VSS A;  3C7H A;  3AKI A;  3R67 A;  5A7V A;  1UYP A;  3AKG A;  4N1I A;  3WPV A;  3QZ4 A;  3LDK A;  4KCB A;  3K1U A;  4KC7 A;  3BYK A;  2XQR A;  5ANN A;  1OYG A;  5GLK A;  3ZXK A;  3KF5 A;  1YRZ A;  3LIH A;  1GYE B;  3U14 A;  3WMY A;  3WAT A;  4AK5 A;  5B6T A;  2QQW A;  4AK7 A;  5GLP A;  4KC8 A;  1PT2 A;  4FFG A;  4UDK A;  5FLW A;  3C2U A;  3SC7 X;  3U75 A;  3CU9 A;  3KST A;  4NOV A;  2AEY A;  3WAS A;  5GLQ A;  4FFH A;  3AKH A;  3LIG A;  5GLR A;  4U6B A;  3ZXL A;  1YIF A;  2EXI A;  2EXH A;  3ZXJ A;  5GLN A;  5AYD A;  4KCA A;  1Y9G A;  4COT A;  3WMZ A;  4U6D A;  2OXB A;  3D61 A;  1W18 A;  5FMB A;  3VT1 A;  5B6S A;  2EXK A;  5GLM A;  5C0P A;  2B4W A;  5FMC A;  5A8D A;  3QC2 A;  2X8F A;  4PVA A;  5A7V B;  5FK8 A;  3OM7 A;  5JOY A;  4UDJ A;  5FIX A;  4N2R A;  3LDR A;  4AK6 A;  4O8N A;  3VT0 A;  3PIG A;  5JOZ A;  2AEZ A;  3UGH A;  3WN1 A;  3C7G A;  5C2M A;  4D47 A;  2QQU A;  3P2N A;  3NQH A;  2EXJ A;  4O8P A;  3VSR A;  1WL7 A;  3D5Y A;  3VSZ A;  4QQS A;  5GLL A;  3OM5 A;  1GYD B;  3WPZ A;  1TL2 A;  3WPU A;  5GLO A;  1YI7 A;  1GYH A;  2YFT A;  4UDG A;  3UGG A;  3C7F A;  3WPY A;  3BYJ A;  2AC1 A;  3R4Z A;  5FMD A;  3VT2 A;  2VDT A;  2X8T A;  2ADE A;  4PVI A;  4KMI A;  3UGF A;  3KF3 A;  5FK7 A;  1Y9M A;  5AY9 A;  4FFF A;  4N4B A;  3R4Y A;  3OM4 A;  3OM6 A;  3LV4 A;  3QEE A;  5JOX A;  4UDK E;  3OM2 A; 
#chains in the Genus database with same CATH homology
 3BYL A;  3LFI A;  4MLG A;  3QED A;  4N2Z A;  4O8O A;  1Y4W A;  2QQV A;  4EQV A;  5FKC A;  3D60 A;  3LF7 A;  2X8S A;  5FKB A;  4UDI A;  1VKD A;  2ADD A;  3C7E A;  3PIJ A;  4FFI A;  3D5Z A;  3WN2 A;  3BYN A;  5A8C A;  3WN0 A;  1UV4 A;  3LEM A;  3RWK X;  1W2T A;  3VSF A;  1ST8 A;  5AYC A;  3WAU A;  5AYE A;  2YFR A;  1Y7B A;  3AKF A;  3C7O A;  2YFS A;  4ONZ A;  3QEF A;  5JOW A;  3TAW A;  3VSS A;  3C7H A;  3AKI A;  3R67 A;  5A7V A;  1UYP A;  3AKG A;  4N1I A;  3WPV A;  3QZ4 A;  3LDK A;  4KCB A;  3K1U A;  4KC7 A;  3BYK A;  2XQR A;  5ANN A;  1OYG A;  5GLK A;  3ZXK A;  3KF5 A;  1YRZ A;  3LIH A;  1GYE B;  3U14 A;  3WMY A;  3WAT A;  4AK5 A;  5B6T A;  2QQW A;  4AK7 A;  5GLP A;  4KC8 A;  1PT2 A;  4FFG A;  4UDK A;  5FLW A;  3C2U A;  3SC7 X;  3U75 A;  3CU9 A;  3KST A;  4NOV A;  2AEY A;  3WAS A;  5GLQ A;  4FFH A;  3AKH A;  3LIG A;  5GLR A;  4U6B A;  3ZXL A;  1YIF A;  2EXI A;  2EXH A;  3ZXJ A;  5GLN A;  5AYD A;  4KCA A;  1Y9G A;  4COT A;  3WMZ A;  4U6D A;  2OXB A;  3D61 A;  1W18 A;  5FMB A;  3VT1 A;  5B6S A;  2EXK A;  5GLM A;  5C0P A;  2B4W A;  5FMC A;  5A8D A;  3QC2 A;  2X8F A;  4PVA A;  5A7V B;  5FK8 A;  3OM7 A;  5JOY A;  4UDJ A;  5FIX A;  4N2R A;  3LDR A;  4AK6 A;  4O8N A;  3VT0 A;  3PIG A;  5JOZ A;  2AEZ A;  3UGH A;  3WN1 A;  3C7G A;  4D47 A;  2QQU A;  3P2N A;  3NQH A;  2EXJ A;  4O8P A;  3VSR A;  1WL7 A;  3D5Y A;  3VSZ A;  4QQS A;  5GLL A;  3OM5 A;  1GYD B;  3WPZ A;  3WPU A;  5GLO A;  1YI7 A;  1GYH A;  2YFT A;  4UDG A;  3UGG A;  3C7F A;  3WPY A;  3BYJ A;  2AC1 A;  3R4Z A;  5FMD A;  3VT2 A;  2VDT A;  2X8T A;  2ADE A;  4PVI A;  4KMI A;  3UGF A;  3KF3 A;  5FK7 A;  1Y9M A;  5AY9 A;  4FFF A;  4N4B A;  3R4Y A;  3OM4 A;  3OM6 A;  3LV4 A;  3QEE A;  5JOX A;  4UDK E;  3OM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...