3VSSA

Microbacterium saccharophilum k-1 beta-fructofuranosidase catalytic domain complexed with fructose
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
494
structure length
494
Chain Sequence
GLQDGPEPTIHTQQAYAPEDDFTAKWTRADARQLQRMSDPTAPSRENSMPASVTMPTVPQDFPDMSNEQVWVWDTWPLTDEDANQYSVNGWEIIFSLVADRNLGFDDRHVFAKIGYFYRPAGVPAAERPENGGWTYGGLVFKEGVTGQIFEDQSFSHQTQWSGSARVSKNGEIKLFFTDVAFYRNSDGTNIKPYDPRIALSVGKVKANKKGVTLTGFNKVTDLLQADGTYYQTGAQNEFFNFRDPFTFEDPAHPGETFMVFEGNSAMQRETATCNEADLGYRQGDPYAETVDDVNASGATYQIGNVGLAKAKNKQLTEWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFVGDGIRSDYQPLNGGSGLALGNPTNLNFLGGQPFAPDFNQHPGHFQAYSHYVMPGGLVQSFIDTIGTHDDFVRGGTLAPTVKMDIGVGGDPTKTAVDYSYGSEGLGGWADIPANKHLFTNGKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-fructofuranosidase
publication title Crystal structure of a lactosucrose-producing enzyme, Arthrobacter sp. K-1 beta-fructofuranosidase
pubmed doi rcsb
source organism Arthrobacter
total genus 132
structure length 494
sequence length 494
ec nomenclature ec 3.2.1.26: Beta-fructofuranosidase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02435 Glyco_hydro_68 Levansucrase/Invertase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vssA00
3QEDA 3AKGA 4KCBA 3VSSA 3C7FA 5JOYA 5GLRA 4D47A 4PVAA 1ST8A 1Y4WA 3D5ZA 3C7EA 5GLNA 2QQWA 3KF3A 3P2NA 3VSRA 5FMBA 5A8DA 3NQHA 1WL7A 2YFSA 4UDKA 3UGHA 2ADEA 1UYPA 4MLGA 3BYJA 1W2TA 4N4BA 3WPZA 4KC7A 5A7VA 2YFRA 5GLLA 3OM6A 1VKDA 4UDGA 5JOXA 3PIJA 4KCAA 5B6SA 2EXHA 2QQUA 5FK7A 5FMCA 2VDTA 5ANNA 3ZXKA 5FIXA 4O8OA 2EXIA 4FFIA 3KF5A 4FFHA 3RWKX 3K1UA 3WMYA 3R67A 3LF7A 5GLPA 3C7GA 2YFTA 3AKFA 1GYHA 4N2RA 3WN2A 1YRZA 3D61A 3QEEA 2EXKA 1YIFA 5AYCA 3WN0A 3D60A 3QC2A 4U6DA 3WAUA 3OM2A 3WATA 5FKCA 4AK7A 3U75A 1Y9GA 4O8PA 1GYDB 3LIHA 1OYGA 5GLKA 2XQRA 3UGFA 3BYNA 2B4WA 3UGGA 2QQVA 3WASA 1GYEB 4ONZA 4FFGA 4COTA 5JOWA 3LEMA 3LFIA 3R4ZA 5FLWA 4QQSA 5FK8A 2EXJA 3SC7X 4N2ZA 3TAWA 3VSZA 4O8NA 3OM5A 3R4YA 5FKBA 1YI7A 2OXBA 2X8TA 5A7VB 5C0PA 3VSFA 3WPYA 3QEFA 5A8CA 4NOVA 2X8FA 3BYLA 5B6TA 3CU9A 4UDKE 3D5YA 1Y7BA 4FFFA 2X8SA 4KC8A 4KMIA 3QZ4A 3LDRA 5AYDA 1Y9MA 5GLQA 2AEZA 4PVIA 3AKHA 4UDIA 3C2UA 3PIGA 5JOZA 3WPUA 3BYKA 2AC1A 2AEYA 5AYEA 3VT2A 3WPVA 5GLOA 3WN1A 3ZXLA 1PT2A 3OM4A 3U14A 3VT0A 4AK5A 4AK6A 1UV4A 3LIGA 4N1IA 5AY9A 5GLMA 3LDKA 3ZXJA 5FMDA 3LV4A 2ADDA 4EQVA 3WMZA 3OM7A 3VT1A 4U6BA 3KSTA 3C7HA 3C7OA 4UDJA 3AKIA 1W18A
chains in the Genus database with same CATH superfamily
3QEDA 3AKGA 4KCBA 3VSSA 3C7FA 5JOYA 5GLRA 4D47A 4PVAA 1ST8A 1Y4WA 3D5ZA 3C7EA 5GLNA 2QQWA 3KF3A 3P2NA 3VSRA 5FMBA 5A8DA 3NQHA 1WL7A 2YFSA 4UDKA 3UGHA 2ADEA 1UYPA 4MLGA 3BYJA 1W2TA 4N4BA 3WPZA 4KC7A 5A7VA 2YFRA 5GLLA 3OM6A 1VKDA 4UDGA 5JOXA 3PIJA 4KCAA 5B6SA 2EXHA 2QQUA 5FK7A 5FMCA 2VDTA 5ANNA 3ZXKA 5FIXA 4O8OA 2EXIA 4FFIA 3KF5A 4FFHA 3RWKX 3K1UA 3WMYA 3R67A 3LF7A 5GLPA 3C7GA 2YFTA 3AKFA 1GYHA 4N2RA 3WN2A 1YRZA 3D61A 3QEEA 2EXKA 1YIFA 5AYCA 3WN0A 3D60A 3QC2A 4U6DA 3WAUA 3OM2A 3WATA 5FKCA 4AK7A 3U75A 1Y9GA 4O8PA 1GYDB 3LIHA 1OYGA 5GLKA 2XQRA 3UGFA 3BYNA 2B4WA 3UGGA 2QQVA 3WASA 1GYEB 4ONZA 4FFGA 4COTA 5JOWA 3LEMA 3LFIA 3R4ZA 5FLWA 4QQSA 5FK8A 2EXJA 3SC7X 4N2ZA 3TAWA 3VSZA 4O8NA 3OM5A 3R4YA 5FKBA 1YI7A 2OXBA 2X8TA 5A7VB 5C0PA 3VSFA 3WPYA 3QEFA 5A8CA 4NOVA 2X8FA 3BYLA 5B6TA 3CU9A 4UDKE 3D5YA 1Y7BA 4FFFA 2X8SA 4KC8A 4KMIA 3QZ4A 3LDRA 5AYDA 1Y9MA 5GLQA 2AEZA 4PVIA 3AKHA 4UDIA 3C2UA 3PIGA 5JOZA 3WPUA 3BYKA 2AC1A 2AEYA 5AYEA 3VT2A 3WPVA 5GLOA 3WN1A 3ZXLA 1PT2A 3OM4A 3U14A 3VT0A 4AK5A 4AK6A 1UV4A 3LIGA 4N1IA 1TL2A 5AY9A 5GLMA 3LDKA 3ZXJA 5C2MA 5FMDA 3LV4A 2ADDA 4EQVA 3WMZA 3OM7A 3VT1A 4U6BA 3KSTA 3C7HA 3C7OA 4UDJA 3AKIA 1W18A
chains in the Genus database with same CATH topology
3QEDA 3AKGA 4KCBA 3VSSA 3C7FA 5JOYA 5GLRA 4D47A 4PVAA 1ST8A 1Y4WA 3D5ZA 3C7EA 5GLNA 2QQWA 3KF3A 3P2NA 3VSRA 5FMBA 5A8DA 3NQHA 1WL7A 2YFSA 4UDKA 3UGHA 2ADEA 1UYPA 4MLGA 3BYJA 1W2TA 4N4BA 3WPZA 4KC7A 5A7VA 2YFRA 5GLLA 3OM6A 1VKDA 4UDGA 5JOXA 3PIJA 4KCAA 5B6SA 2EXHA 2QQUA 5FK7A 5FMCA 2VDTA 5ANNA 3ZXKA 5FIXA 4O8OA 2EXIA 4FFIA 3KF5A 4FFHA 3RWKX 3K1UA 3WMYA 3R67A 3LF7A 5GLPA 3C7GA 2YFTA 3AKFA 1GYHA 4N2RA 3WN2A 1YRZA 3D61A 3QEEA 2EXKA 1YIFA 5AYCA 3WN0A 3D60A 3QC2A 4U6DA 3WAUA 3OM2A 3WATA 5FKCA 4AK7A 3U75A 1Y9GA 4O8PA 1GYDB 3LIHA 1OYGA 5GLKA 2XQRA 3UGFA 3BYNA 2B4WA 3UGGA 2QQVA 3WASA 1GYEB 4ONZA 4FFGA 4COTA 5JOWA 3LEMA 3LFIA 3R4ZA 5FLWA 4QQSA 5FK8A 2EXJA 3SC7X 4N2ZA 3TAWA 3VSZA 4O8NA 3OM5A 3R4YA 5FKBA 1YI7A 2OXBA 2X8TA 5A7VB 5C0PA 3VSFA 3WPYA 3QEFA 5A8CA 4NOVA 2X8FA 3BYLA 5B6TA 3CU9A 4UDKE 3D5YA 1Y7BA 4FFFA 2X8SA 4KC8A 4KMIA 3QZ4A 3LDRA 5AYDA 1Y9MA 5GLQA 2AEZA 4PVIA 3AKHA 4UDIA 3C2UA 3PIGA 5JOZA 3WPUA 3BYKA 2AC1A 2AEYA 5AYEA 3VT2A 3WPVA 5GLOA 3WN1A 3ZXLA 1PT2A 3OM4A 3U14A 3VT0A 4AK5A 4AK6A 1UV4A 3LIGA 4N1IA 5AY9A 5GLMA 3LDKA 3ZXJA 5FMDA 3LV4A 2ADDA 4EQVA 3WMZA 3OM7A 3VT1A 4U6BA 3KSTA 3C7HA 3C7OA 4UDJA 3AKIA 1W18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QED A;  3AKG A;  4KCB A;  3VSS A;  3C7F A;  5JOY A;  5GLR A;  4D47 A;  4PVA A;  1ST8 A;  1Y4W A;  3D5Z A;  3C7E A;  5GLN A;  2QQW A;  3KF3 A;  3P2N A;  3VSR A;  5FMB A;  5A8D A;  3NQH A;  1WL7 A;  2YFS A;  4UDK A;  3UGH A;  2ADE A;  1UYP A;  4MLG A;  3BYJ A;  1W2T A;  4N4B A;  3WPZ A;  4KC7 A;  5A7V A;  2YFR A;  5GLL A;  3OM6 A;  1VKD A;  4UDG A;  5JOX A;  3PIJ A;  4KCA A;  5B6S A;  2EXH A;  2QQU A;  5FK7 A;  5FMC A;  2VDT A;  5ANN A;  3ZXK A;  5FIX A;  4O8O A;  2EXI A;  4FFI A;  3KF5 A;  4FFH A;  3RWK X;  3K1U A;  3WMY A;  3R67 A;  3LF7 A;  5GLP A;  3C7G A;  2YFT A;  3AKF A;  1GYH A;  4N2R A;  3WN2 A;  1YRZ A;  3D61 A;  3QEE A;  2EXK A;  1YIF A;  5AYC A;  3WN0 A;  3D60 A;  3QC2 A;  4U6D A;  3WAU A;  3OM2 A;  3WAT A;  5FKC A;  4AK7 A;  3U75 A;  1Y9G A;  4O8P A;  1GYD B;  3LIH A;  1OYG A;  5GLK A;  2XQR A;  3UGF A;  3BYN A;  2B4W A;  3UGG A;  2QQV A;  3WAS A;  1GYE B;  4ONZ A;  4FFG A;  4COT A;  5JOW A;  3LEM A;  3LFI A;  3R4Z A;  5FLW A;  4QQS A;  5FK8 A;  2EXJ A;  3SC7 X;  4N2Z A;  3TAW A;  3VSZ A;  4O8N A;  3OM5 A;  3R4Y A;  5FKB A;  1YI7 A;  2OXB A;  2X8T A;  5A7V B;  5C0P A;  3VSF A;  3WPY A;  3QEF A;  5A8C A;  4NOV A;  2X8F A;  3BYL A;  5B6T A;  3CU9 A;  4UDK E;  3D5Y A;  1Y7B A;  4FFF A;  2X8S A;  4KC8 A;  4KMI A;  3QZ4 A;  3LDR A;  5AYD A;  1Y9M A;  5GLQ A;  2AEZ A;  4PVI A;  3AKH A;  4UDI A;  3C2U A;  3PIG A;  5JOZ A;  3WPU A;  3BYK A;  2AC1 A;  2AEY A;  5AYE A;  3VT2 A;  3WPV A;  5GLO A;  3WN1 A;  3ZXL A;  1PT2 A;  3OM4 A;  3U14 A;  3VT0 A;  4AK5 A;  4AK6 A;  1UV4 A;  3LIG A;  4N1I A;  5AY9 A;  5GLM A;  3LDK A;  3ZXJ A;  5FMD A;  3LV4 A;  2ADD A;  4EQV A;  3WMZ A;  3OM7 A;  3VT1 A;  4U6B A;  3KST A;  3C7H A;  3C7O A;  4UDJ A;  3AKI A;  1W18 A; 
#chains in the Genus database with same CATH topology
 3QED A;  3AKG A;  4KCB A;  3VSS A;  3C7F A;  5JOY A;  5GLR A;  4D47 A;  4PVA A;  1ST8 A;  1Y4W A;  3D5Z A;  3C7E A;  5GLN A;  2QQW A;  3KF3 A;  3P2N A;  3VSR A;  5FMB A;  5A8D A;  3NQH A;  1WL7 A;  2YFS A;  4UDK A;  3UGH A;  2ADE A;  1UYP A;  4MLG A;  3BYJ A;  1W2T A;  4N4B A;  3WPZ A;  4KC7 A;  5A7V A;  2YFR A;  5GLL A;  3OM6 A;  1VKD A;  4UDG A;  5JOX A;  3PIJ A;  4KCA A;  5B6S A;  2EXH A;  2QQU A;  5FK7 A;  5FMC A;  2VDT A;  5ANN A;  3ZXK A;  5FIX A;  4O8O A;  2EXI A;  4FFI A;  3KF5 A;  4FFH A;  3RWK X;  3K1U A;  3WMY A;  3R67 A;  3LF7 A;  5GLP A;  3C7G A;  2YFT A;  3AKF A;  1GYH A;  4N2R A;  3WN2 A;  1YRZ A;  3D61 A;  3QEE A;  2EXK A;  1YIF A;  5AYC A;  3WN0 A;  3D60 A;  3QC2 A;  4U6D A;  3WAU A;  3OM2 A;  3WAT A;  5FKC A;  4AK7 A;  3U75 A;  1Y9G A;  4O8P A;  1GYD B;  3LIH A;  1OYG A;  5GLK A;  2XQR A;  3UGF A;  3BYN A;  2B4W A;  3UGG A;  2QQV A;  3WAS A;  1GYE B;  4ONZ A;  4FFG A;  4COT A;  5JOW A;  3LEM A;  3LFI A;  3R4Z A;  5FLW A;  4QQS A;  5FK8 A;  2EXJ A;  3SC7 X;  4N2Z A;  3TAW A;  3VSZ A;  4O8N A;  3OM5 A;  3R4Y A;  5FKB A;  1YI7 A;  2OXB A;  2X8T A;  5A7V B;  5C0P A;  3VSF A;  3WPY A;  3QEF A;  5A8C A;  4NOV A;  2X8F A;  3BYL A;  5B6T A;  3CU9 A;  4UDK E;  3D5Y A;  1Y7B A;  4FFF A;  2X8S A;  4KC8 A;  4KMI A;  3QZ4 A;  3LDR A;  5AYD A;  1Y9M A;  5GLQ A;  2AEZ A;  4PVI A;  3AKH A;  4UDI A;  3C2U A;  3PIG A;  5JOZ A;  3WPU A;  3BYK A;  2AC1 A;  2AEY A;  5AYE A;  3VT2 A;  3WPV A;  5GLO A;  3WN1 A;  3ZXL A;  1PT2 A;  3OM4 A;  3U14 A;  3VT0 A;  4AK5 A;  4AK6 A;  1UV4 A;  3LIG A;  4N1I A;  1TL2 A;  5AY9 A;  5GLM A;  3LDK A;  3ZXJ A;  5C2M A;  5FMD A;  3LV4 A;  2ADD A;  4EQV A;  3WMZ A;  3OM7 A;  3VT1 A;  4U6B A;  3KST A;  3C7H A;  3C7O A;  4UDJ A;  3AKI A;  1W18 A; 
#chains in the Genus database with same CATH homology
 3QED A;  3AKG A;  4KCB A;  3VSS A;  3C7F A;  5JOY A;  5GLR A;  4D47 A;  4PVA A;  1ST8 A;  1Y4W A;  3D5Z A;  3C7E A;  5GLN A;  2QQW A;  3KF3 A;  3P2N A;  3VSR A;  5FMB A;  5A8D A;  3NQH A;  1WL7 A;  2YFS A;  4UDK A;  3UGH A;  2ADE A;  1UYP A;  4MLG A;  3BYJ A;  1W2T A;  4N4B A;  3WPZ A;  4KC7 A;  5A7V A;  2YFR A;  5GLL A;  3OM6 A;  1VKD A;  4UDG A;  5JOX A;  3PIJ A;  4KCA A;  5B6S A;  2EXH A;  2QQU A;  5FK7 A;  5FMC A;  2VDT A;  5ANN A;  3ZXK A;  5FIX A;  4O8O A;  2EXI A;  4FFI A;  3KF5 A;  4FFH A;  3RWK X;  3K1U A;  3WMY A;  3R67 A;  3LF7 A;  5GLP A;  3C7G A;  2YFT A;  3AKF A;  1GYH A;  4N2R A;  3WN2 A;  1YRZ A;  3D61 A;  3QEE A;  2EXK A;  1YIF A;  5AYC A;  3WN0 A;  3D60 A;  3QC2 A;  4U6D A;  3WAU A;  3OM2 A;  3WAT A;  5FKC A;  4AK7 A;  3U75 A;  1Y9G A;  4O8P A;  1GYD B;  3LIH A;  1OYG A;  5GLK A;  2XQR A;  3UGF A;  3BYN A;  2B4W A;  3UGG A;  2QQV A;  3WAS A;  1GYE B;  4ONZ A;  4FFG A;  4COT A;  5JOW A;  3LEM A;  3LFI A;  3R4Z A;  5FLW A;  4QQS A;  5FK8 A;  2EXJ A;  3SC7 X;  4N2Z A;  3TAW A;  3VSZ A;  4O8N A;  3OM5 A;  3R4Y A;  5FKB A;  1YI7 A;  2OXB A;  2X8T A;  5A7V B;  5C0P A;  3VSF A;  3WPY A;  3QEF A;  5A8C A;  4NOV A;  2X8F A;  3BYL A;  5B6T A;  3CU9 A;  4UDK E;  3D5Y A;  1Y7B A;  4FFF A;  2X8S A;  4KC8 A;  4KMI A;  3QZ4 A;  3LDR A;  5AYD A;  1Y9M A;  5GLQ A;  2AEZ A;  4PVI A;  3AKH A;  4UDI A;  3C2U A;  3PIG A;  5JOZ A;  3WPU A;  3BYK A;  2AC1 A;  2AEY A;  5AYE A;  3VT2 A;  3WPV A;  5GLO A;  3WN1 A;  3ZXL A;  1PT2 A;  3OM4 A;  3U14 A;  3VT0 A;  4AK5 A;  4AK6 A;  1UV4 A;  3LIG A;  4N1I A;  5AY9 A;  5GLM A;  3LDK A;  3ZXJ A;  5FMD A;  3LV4 A;  2ADD A;  4EQV A;  3WMZ A;  3OM7 A;  3VT1 A;  4U6B A;  3KST A;  3C7H A;  3C7O A;  4UDJ A;  3AKI A;  1W18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...