3WMYA

Crystal structure of streptomyces coelicolor alpha-l-arabinofuranosidase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
302
structure length
302
Chain Sequence
GTCALPSTYRWSSTGVLAQPKSGWVALKDFTTVTHNGRHLVYGSTSSGSSYGSMVFSPFTNWSDMASAGQNAMNQAAVAPTLFYFAPKNIWVLAYQWGSWPFIYRTSSDPTDPNGWSAPQPLFTGSISGSDTGPIDQTLIADGQNMYLFFAGDNGKIYRASMPIGNFPGNFGSSYTTIMSDTKANLFEGVQVYKVQGQNQYLMIVEAMGANGRYFRSFTASSLSGSWTPQAASEGNPFAGKANSGATWTNDISHGDLVRDNPDQTMTVDPCNLQFLYQGKSPNAGGDYNSLPWRPGVLTLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Extracellular exo-alpha-L-arabinofuranosidase
publication title Crystal structure and characterization of the glycoside hydrolase family 62 alpha-L-arabinofuranosidase from Streptomyces coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 72
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2013-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
A PF03664 Glyco_hydro_62 Glycosyl hydrolase family 62
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3wmyA00
2EXKA 3VSFA 3BYLA 3AKHA 5FKCA 2ADEA 1GYEB 5A7VB 4FFIA 3WN0A 5FMCA 3WPUA 3WAUA 1Y9MA 3D61A 3U14A 2EXIA 3WMYA 4D47A 5A8CA 3KSTA 3OM2A 5FMBA 2X8SA 5JOYA 4COTA 3BYJA 4AK5A 3C7GA 5AYCA 5AY9A 3VT0A 3QC2A 5GLRA 2OXBA 4KC7A 1W18A 2YFSA 1UV4A 3UGFA 3ZXJA 3LEMA 1VKDA 4O8OA 1OYGA 3AKIA 3RWKX 3WATA 1UYPA 3VSSA 3C7FA 5GLMA 2QQWA 3LDKA 2AEYA 4O8NA 2EXJA 4KCBA 3PIGA 4UDIA 3UGHA 3NQHA 2B4WA 4FFGA 3OM7A 1GYDB 5FLWA 4AK7A 3C2UA 4O8PA 5FK8A 3TAWA 3LFIA 1WL7A 3LIHA 3LDRA 3LV4A 3R4YA 3ZXLA 2X8TA 3R4ZA 4KC8A 1YI7A 3P2NA 1GYHA 3VSRA 2EXHA 3OM5A 3WN2A 5C0PA 3VSZA 4EQVA 4UDGA 4FFHA 3QEFA 4U6BA 3R67A 3D60A 4UDKA 4FFFA 2QQUA 2AEZA 3SC7X 3WPYA 5FKBA 2YFTA 1YRZA 5FK7A 5GLOA 4N2RA 3WPZA 4MLGA 3OM6A 3QZ4A 3LIGA 4U6DA 3K1UA 5GLKA 1YIFA 5GLNA 3AKFA 3AKGA 4PVIA 5AYEA 5A7VA 5A8DA 4UDKE 1W2TA 3BYNA 4KMIA 5JOXA 3KF5A 3ZXKA 5B6SA 5GLLA 3WASA 5B6TA 1ST8A 4QQSA 2AC1A 5FIXA 5GLQA 3VT2A 3LF7A 3U75A 2ADDA 2VDTA 3C7HA 3QEDA 4N1IA 2XQRA 5FMDA 1Y7BA 2QQVA 3C7OA 3WMZA 3D5YA 1PT2A 2X8FA 3QEEA 4PVAA 3WN1A 3C7EA 3UGGA 4AK6A 5JOZA 3PIJA 3VT1A 3CU9A 1Y9GA 5GLPA 3BYKA 4N4BA 4UDJA 1Y4WA 4ONZA 3OM4A 4KCAA 3WPVA 4N2ZA 2YFRA 5ANNA 5AYDA 4NOVA 5JOWA 3KF3A 3D5ZA
chains in the Genus database with same CATH superfamily
2EXKA 3VSFA 3BYLA 3AKHA 5FKCA 2ADEA 1GYEB 5A7VB 4FFIA 3WN0A 5FMCA 3WPUA 3WAUA 1Y9MA 3D61A 3U14A 2EXIA 3WMYA 4D47A 5A8CA 3KSTA 3OM2A 5FMBA 2X8SA 5JOYA 4COTA 3BYJA 4AK5A 3C7GA 5AYCA 5AY9A 3VT0A 3QC2A 5GLRA 2OXBA 4KC7A 1W18A 2YFSA 1UV4A 3UGFA 3ZXJA 3LEMA 1VKDA 4O8OA 1OYGA 3AKIA 3RWKX 3WATA 1UYPA 3VSSA 3C7FA 5GLMA 2QQWA 3LDKA 2AEYA 4O8NA 2EXJA 4KCBA 3PIGA 4UDIA 3UGHA 3NQHA 2B4WA 4FFGA 3OM7A 1GYDB 5FLWA 4AK7A 3C2UA 4O8PA 5FK8A 3TAWA 3LFIA 1WL7A 3LIHA 3LDRA 3LV4A 3R4YA 3ZXLA 2X8TA 3R4ZA 4KC8A 1TL2A 1YI7A 3P2NA 1GYHA 3VSRA 2EXHA 3OM5A 3WN2A 5C0PA 3VSZA 4EQVA 4UDGA 4FFHA 3QEFA 4U6BA 3R67A 3D60A 4UDKA 4FFFA 2QQUA 2AEZA 3SC7X 3WPYA 5FKBA 2YFTA 1YRZA 5FK7A 5GLOA 4N2RA 3WPZA 4MLGA 3OM6A 3QZ4A 3LIGA 4U6DA 3K1UA 5GLKA 1YIFA 5GLNA 3AKFA 5C2MA 3AKGA 4PVIA 5AYEA 5A7VA 5A8DA 4UDKE 1W2TA 3BYNA 4KMIA 5JOXA 3KF5A 3ZXKA 5B6SA 5GLLA 3WASA 5B6TA 1ST8A 4QQSA 2AC1A 5FIXA 5GLQA 3VT2A 3LF7A 3U75A 2ADDA 2VDTA 3C7HA 3QEDA 4N1IA 2XQRA 5FMDA 1Y7BA 2QQVA 3C7OA 3WMZA 3D5YA 1PT2A 2X8FA 3QEEA 4PVAA 3WN1A 3C7EA 3UGGA 4AK6A 5JOZA 3PIJA 3VT1A 3CU9A 1Y9GA 5GLPA 3BYKA 4N4BA 4UDJA 1Y4WA 4ONZA 3OM4A 4KCAA 3WPVA 4N2ZA 2YFRA 5ANNA 5AYDA 4NOVA 5JOWA 3KF3A 3D5ZA
chains in the Genus database with same CATH topology
2EXKA 3VSFA 3BYLA 3AKHA 5FKCA 2ADEA 1GYEB 5A7VB 4FFIA 3WN0A 5FMCA 3WPUA 3WAUA 1Y9MA 3D61A 3U14A 2EXIA 3WMYA 4D47A 5A8CA 3KSTA 3OM2A 5FMBA 2X8SA 5JOYA 4COTA 3BYJA 4AK5A 3C7GA 5AYCA 5AY9A 3VT0A 3QC2A 5GLRA 2OXBA 4KC7A 1W18A 2YFSA 1UV4A 3UGFA 3ZXJA 3LEMA 1VKDA 4O8OA 1OYGA 3AKIA 3RWKX 3WATA 1UYPA 3VSSA 3C7FA 5GLMA 2QQWA 3LDKA 2AEYA 4O8NA 2EXJA 4KCBA 3PIGA 4UDIA 3UGHA 3NQHA 2B4WA 4FFGA 3OM7A 1GYDB 5FLWA 4AK7A 3C2UA 4O8PA 5FK8A 3TAWA 3LFIA 1WL7A 3LIHA 3LDRA 3LV4A 3R4YA 3ZXLA 2X8TA 3R4ZA 4KC8A 1YI7A 3P2NA 1GYHA 3VSRA 2EXHA 3OM5A 3WN2A 5C0PA 3VSZA 4EQVA 4UDGA 4FFHA 3QEFA 4U6BA 3R67A 3D60A 4UDKA 4FFFA 2QQUA 2AEZA 3SC7X 3WPYA 5FKBA 2YFTA 1YRZA 5FK7A 5GLOA 4N2RA 3WPZA 4MLGA 3OM6A 3QZ4A 3LIGA 4U6DA 3K1UA 5GLKA 1YIFA 5GLNA 3AKFA 3AKGA 4PVIA 5AYEA 5A7VA 5A8DA 4UDKE 1W2TA 3BYNA 4KMIA 5JOXA 3KF5A 3ZXKA 5B6SA 5GLLA 3WASA 5B6TA 1ST8A 4QQSA 2AC1A 5FIXA 5GLQA 3VT2A 3LF7A 3U75A 2ADDA 2VDTA 3C7HA 3QEDA 4N1IA 2XQRA 5FMDA 1Y7BA 2QQVA 3C7OA 3WMZA 3D5YA 1PT2A 2X8FA 3QEEA 4PVAA 3WN1A 3C7EA 3UGGA 4AK6A 5JOZA 3PIJA 3VT1A 3CU9A 1Y9GA 5GLPA 3BYKA 4N4BA 4UDJA 1Y4WA 4ONZA 3OM4A 4KCAA 3WPVA 4N2ZA 2YFRA 5ANNA 5AYDA 4NOVA 5JOWA 3KF3A 3D5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXK A;  3VSF A;  3BYL A;  3AKH A;  5FKC A;  2ADE A;  1GYE B;  5A7V B;  4FFI A;  3WN0 A;  5FMC A;  3WPU A;  3WAU A;  1Y9M A;  3D61 A;  3U14 A;  2EXI A;  3WMY A;  4D47 A;  5A8C A;  3KST A;  3OM2 A;  5FMB A;  2X8S A;  5JOY A;  4COT A;  3BYJ A;  4AK5 A;  3C7G A;  5AYC A;  5AY9 A;  3VT0 A;  3QC2 A;  5GLR A;  2OXB A;  4KC7 A;  1W18 A;  2YFS A;  1UV4 A;  3UGF A;  3ZXJ A;  3LEM A;  1VKD A;  4O8O A;  1OYG A;  3AKI A;  3RWK X;  3WAT A;  1UYP A;  3VSS A;  3C7F A;  5GLM A;  2QQW A;  3LDK A;  2AEY A;  4O8N A;  2EXJ A;  4KCB A;  3PIG A;  4UDI A;  3UGH A;  3NQH A;  2B4W A;  4FFG A;  3OM7 A;  1GYD B;  5FLW A;  4AK7 A;  3C2U A;  4O8P A;  5FK8 A;  3TAW A;  3LFI A;  1WL7 A;  3LIH A;  3LDR A;  3LV4 A;  3R4Y A;  3ZXL A;  2X8T A;  3R4Z A;  4KC8 A;  1YI7 A;  3P2N A;  1GYH A;  3VSR A;  2EXH A;  3OM5 A;  3WN2 A;  5C0P A;  3VSZ A;  4EQV A;  4UDG A;  4FFH A;  3QEF A;  4U6B A;  3R67 A;  3D60 A;  4UDK A;  4FFF A;  2QQU A;  2AEZ A;  3SC7 X;  3WPY A;  5FKB A;  2YFT A;  1YRZ A;  5FK7 A;  5GLO A;  4N2R A;  3WPZ A;  4MLG A;  3OM6 A;  3QZ4 A;  3LIG A;  4U6D A;  3K1U A;  5GLK A;  1YIF A;  5GLN A;  3AKF A;  3AKG A;  4PVI A;  5AYE A;  5A7V A;  5A8D A;  4UDK E;  1W2T A;  3BYN A;  4KMI A;  5JOX A;  3KF5 A;  3ZXK A;  5B6S A;  5GLL A;  3WAS A;  5B6T A;  1ST8 A;  4QQS A;  2AC1 A;  5FIX A;  5GLQ A;  3VT2 A;  3LF7 A;  3U75 A;  2ADD A;  2VDT A;  3C7H A;  3QED A;  4N1I A;  2XQR A;  5FMD A;  1Y7B A;  2QQV A;  3C7O A;  3WMZ A;  3D5Y A;  1PT2 A;  2X8F A;  3QEE A;  4PVA A;  3WN1 A;  3C7E A;  3UGG A;  4AK6 A;  5JOZ A;  3PIJ A;  3VT1 A;  3CU9 A;  1Y9G A;  5GLP A;  3BYK A;  4N4B A;  4UDJ A;  1Y4W A;  4ONZ A;  3OM4 A;  4KCA A;  3WPV A;  4N2Z A;  2YFR A;  5ANN A;  5AYD A;  4NOV A;  5JOW A;  3KF3 A;  3D5Z A; 
#chains in the Genus database with same CATH topology
 2EXK A;  3VSF A;  3BYL A;  3AKH A;  5FKC A;  2ADE A;  1GYE B;  5A7V B;  4FFI A;  3WN0 A;  5FMC A;  3WPU A;  3WAU A;  1Y9M A;  3D61 A;  3U14 A;  2EXI A;  3WMY A;  4D47 A;  5A8C A;  3KST A;  3OM2 A;  5FMB A;  2X8S A;  5JOY A;  4COT A;  3BYJ A;  4AK5 A;  3C7G A;  5AYC A;  5AY9 A;  3VT0 A;  3QC2 A;  5GLR A;  2OXB A;  4KC7 A;  1W18 A;  2YFS A;  1UV4 A;  3UGF A;  3ZXJ A;  3LEM A;  1VKD A;  4O8O A;  1OYG A;  3AKI A;  3RWK X;  3WAT A;  1UYP A;  3VSS A;  3C7F A;  5GLM A;  2QQW A;  3LDK A;  2AEY A;  4O8N A;  2EXJ A;  4KCB A;  3PIG A;  4UDI A;  3UGH A;  3NQH A;  2B4W A;  4FFG A;  3OM7 A;  1GYD B;  5FLW A;  4AK7 A;  3C2U A;  4O8P A;  5FK8 A;  3TAW A;  3LFI A;  1WL7 A;  3LIH A;  3LDR A;  3LV4 A;  3R4Y A;  3ZXL A;  2X8T A;  3R4Z A;  4KC8 A;  1TL2 A;  1YI7 A;  3P2N A;  1GYH A;  3VSR A;  2EXH A;  3OM5 A;  3WN2 A;  5C0P A;  3VSZ A;  4EQV A;  4UDG A;  4FFH A;  3QEF A;  4U6B A;  3R67 A;  3D60 A;  4UDK A;  4FFF A;  2QQU A;  2AEZ A;  3SC7 X;  3WPY A;  5FKB A;  2YFT A;  1YRZ A;  5FK7 A;  5GLO A;  4N2R A;  3WPZ A;  4MLG A;  3OM6 A;  3QZ4 A;  3LIG A;  4U6D A;  3K1U A;  5GLK A;  1YIF A;  5GLN A;  3AKF A;  5C2M A;  3AKG A;  4PVI A;  5AYE A;  5A7V A;  5A8D A;  4UDK E;  1W2T A;  3BYN A;  4KMI A;  5JOX A;  3KF5 A;  3ZXK A;  5B6S A;  5GLL A;  3WAS A;  5B6T A;  1ST8 A;  4QQS A;  2AC1 A;  5FIX A;  5GLQ A;  3VT2 A;  3LF7 A;  3U75 A;  2ADD A;  2VDT A;  3C7H A;  3QED A;  4N1I A;  2XQR A;  5FMD A;  1Y7B A;  2QQV A;  3C7O A;  3WMZ A;  3D5Y A;  1PT2 A;  2X8F A;  3QEE A;  4PVA A;  3WN1 A;  3C7E A;  3UGG A;  4AK6 A;  5JOZ A;  3PIJ A;  3VT1 A;  3CU9 A;  1Y9G A;  5GLP A;  3BYK A;  4N4B A;  4UDJ A;  1Y4W A;  4ONZ A;  3OM4 A;  4KCA A;  3WPV A;  4N2Z A;  2YFR A;  5ANN A;  5AYD A;  4NOV A;  5JOW A;  3KF3 A;  3D5Z A; 
#chains in the Genus database with same CATH homology
 2EXK A;  3VSF A;  3BYL A;  3AKH A;  5FKC A;  2ADE A;  1GYE B;  5A7V B;  4FFI A;  3WN0 A;  5FMC A;  3WPU A;  3WAU A;  1Y9M A;  3D61 A;  3U14 A;  2EXI A;  3WMY A;  4D47 A;  5A8C A;  3KST A;  3OM2 A;  5FMB A;  2X8S A;  5JOY A;  4COT A;  3BYJ A;  4AK5 A;  3C7G A;  5AYC A;  5AY9 A;  3VT0 A;  3QC2 A;  5GLR A;  2OXB A;  4KC7 A;  1W18 A;  2YFS A;  1UV4 A;  3UGF A;  3ZXJ A;  3LEM A;  1VKD A;  4O8O A;  1OYG A;  3AKI A;  3RWK X;  3WAT A;  1UYP A;  3VSS A;  3C7F A;  5GLM A;  2QQW A;  3LDK A;  2AEY A;  4O8N A;  2EXJ A;  4KCB A;  3PIG A;  4UDI A;  3UGH A;  3NQH A;  2B4W A;  4FFG A;  3OM7 A;  1GYD B;  5FLW A;  4AK7 A;  3C2U A;  4O8P A;  5FK8 A;  3TAW A;  3LFI A;  1WL7 A;  3LIH A;  3LDR A;  3LV4 A;  3R4Y A;  3ZXL A;  2X8T A;  3R4Z A;  4KC8 A;  1YI7 A;  3P2N A;  1GYH A;  3VSR A;  2EXH A;  3OM5 A;  3WN2 A;  5C0P A;  3VSZ A;  4EQV A;  4UDG A;  4FFH A;  3QEF A;  4U6B A;  3R67 A;  3D60 A;  4UDK A;  4FFF A;  2QQU A;  2AEZ A;  3SC7 X;  3WPY A;  5FKB A;  2YFT A;  1YRZ A;  5FK7 A;  5GLO A;  4N2R A;  3WPZ A;  4MLG A;  3OM6 A;  3QZ4 A;  3LIG A;  4U6D A;  3K1U A;  5GLK A;  1YIF A;  5GLN A;  3AKF A;  3AKG A;  4PVI A;  5AYE A;  5A7V A;  5A8D A;  4UDK E;  1W2T A;  3BYN A;  4KMI A;  5JOX A;  3KF5 A;  3ZXK A;  5B6S A;  5GLL A;  3WAS A;  5B6T A;  1ST8 A;  4QQS A;  2AC1 A;  5FIX A;  5GLQ A;  3VT2 A;  3LF7 A;  3U75 A;  2ADD A;  2VDT A;  3C7H A;  3QED A;  4N1I A;  2XQR A;  5FMD A;  1Y7B A;  2QQV A;  3C7O A;  3WMZ A;  3D5Y A;  1PT2 A;  2X8F A;  3QEE A;  4PVA A;  3WN1 A;  3C7E A;  3UGG A;  4AK6 A;  5JOZ A;  3PIJ A;  3VT1 A;  3CU9 A;  1Y9G A;  5GLP A;  3BYK A;  4N4B A;  4UDJ A;  1Y4W A;  4ONZ A;  3OM4 A;  4KCA A;  3WPV A;  4N2Z A;  2YFR A;  5ANN A;  5AYD A;  4NOV A;  5JOW A;  3KF3 A;  3D5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...