3WMZA

Crystal structure of streptomyces coelicolor alpha-l-arabinofuranosidase ethylmercury derivative
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
302
structure length
302
Chain Sequence
GTCALPSTYRWSSTGVLAQPKSGWVALKDFTTVTHNGRHLVYGSTSSGSSYGSMVFSPFTNWSDMASAGQNAMNQAAVAPTLFYFAPKNIWVLAYQWGSWPFIYRTSSDPTDPNGWSAPQPLFTGSISGSDTGPIDQTLIADGQNMYLFFAGDNGKIYRASMPIGNFPGNFGSSYTTIMSDTKANLFEGVQVYKVQGQNQYLMIVEAMGANGRYFRSFTASSLSGSWTPQAASEGNPFAGKANSGATWTNDISHGDLVRDNPDQTMTVDPCNLQFLYQGKSPNAGGDYNSLPWRPGVLTLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Extracellular exo-alpha-L-arabinofuranosidase
publication title Crystal structure and characterization of the glycoside hydrolase family 62 alpha-L-arabinofuranosidase from Streptomyces coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 68
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2013-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
A PF03664 Glyco_hydro_62 Glycosyl hydrolase family 62
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3wmzA00
3AKGA 3RWKX 1OYGA 2QQWA 5FK8A 4FFFA 3ZXJA 2YFSA 3LEMA 3WPVA 3R67A 4PVAA 3C7FA 2ADEA 4KC8A 3VSZA 3VT1A 2AEZA 4AK6A 3P2NA 2YFTA 3OM2A 3BYLA 3BYKA 4COTA 4FFIA 5FKBA 3WPYA 2EXIA 3OM5A 3UGFA 3WPZA 3D5YA 3OM7A 3C7GA 3C2UA 3D60A 5GLRA 3WASA 3BYNA 5A7VA 5AY9A 5FMBA 5FMCA 3QEEA 4O8OA 3D61A 4UDIA 4MLGA 5JOXA 4ONZA 5ANNA 1VKDA 5FIXA 3C7HA 3LIGA 1Y9MA 3WMZA 1GYHA 4EQVA 3VSSA 1W2TA 3VT2A 3ZXKA 2AC1A 4KCBA 2X8TA 5C0PA 3AKFA 3AKHA 5A8CA 4U6DA 3CU9A 5GLKA 2X8FA 5JOZA 3WAUA 1YRZA 4AK7A 3QEDA 2OXBA 4UDGA 1Y7BA 5FLWA 5A7VB 3NQHA 3WN2A 4FFGA 3WMYA 4KC7A 1WL7A 2QQUA 1YI7A 3VT0A 4KMIA 1YIFA 2B4WA 4UDKE 3LDRA 5JOYA 3LFIA 2EXKA 3C7EA 5GLNA 3KSTA 5AYCA 5JOWA 3VSFA 3U14A 4D47A 3WPUA 2ADDA 3KF3A 2EXJA 3PIJA 4PVIA 5GLPA 3SC7X 3LIHA 3OM4A 3WATA 1W18A 3AKIA 1Y4WA 4KCAA 2AEYA 3D5ZA 1GYEB 3UGHA 5B6TA 3QC2A 5FMDA 3WN0A 3R4YA 4UDJA 3U75A 3LV4A 4O8PA 3LDKA 3KF5A 3UGGA 3R4ZA 2VDTA 4UDKA 3WN1A 2XQRA 3ZXLA 4QQSA 5A8DA 4N4BA 5B6SA 5FKCA 1ST8A 4N1IA 3TAWA 3OM6A 5GLQA 3QEFA 2QQVA 3C7OA 5GLMA 4AK5A 5AYDA 3PIGA 4N2ZA 4U6BA 5FK7A 1UV4A 2YFRA 1GYDB 3LF7A 2EXHA 4N2RA 3K1UA 2X8SA 3VSRA 1UYPA 5AYEA 3BYJA 4NOVA 5GLLA 4O8NA 1PT2A 5GLOA 4FFHA 3QZ4A 1Y9GA
chains in the Genus database with same CATH superfamily
3AKGA 3RWKX 1OYGA 2QQWA 5FK8A 4FFFA 3ZXJA 2YFSA 3LEMA 3WPVA 3R67A 4PVAA 3C7FA 2ADEA 4KC8A 3VSZA 3VT1A 2AEZA 4AK6A 3P2NA 2YFTA 3OM2A 3BYLA 3BYKA 4COTA 4FFIA 5FKBA 3WPYA 2EXIA 3OM5A 3UGFA 3WPZA 3D5YA 3OM7A 3C7GA 3C2UA 3D60A 5GLRA 3WASA 3BYNA 5A7VA 5AY9A 5FMBA 5FMCA 3QEEA 4O8OA 3D61A 4UDIA 4MLGA 5JOXA 4ONZA 5ANNA 1VKDA 5FIXA 3C7HA 3LIGA 1TL2A 1Y9MA 5C2MA 3WMZA 1GYHA 4EQVA 3VSSA 1W2TA 3VT2A 3ZXKA 2AC1A 4KCBA 2X8TA 5C0PA 3AKFA 3AKHA 5A8CA 4U6DA 3CU9A 5GLKA 2X8FA 5JOZA 3WAUA 1YRZA 4AK7A 3QEDA 2OXBA 4UDGA 1Y7BA 5FLWA 5A7VB 3NQHA 3WN2A 4FFGA 3WMYA 4KC7A 1WL7A 2QQUA 1YI7A 3VT0A 4KMIA 1YIFA 2B4WA 4UDKE 3LDRA 5JOYA 3LFIA 2EXKA 3C7EA 5GLNA 3KSTA 5AYCA 5JOWA 3VSFA 3U14A 4D47A 3WPUA 2ADDA 3KF3A 2EXJA 3PIJA 4PVIA 5GLPA 3SC7X 3LIHA 3OM4A 3WATA 1W18A 3AKIA 1Y4WA 4KCAA 2AEYA 3D5ZA 1GYEB 3UGHA 5B6TA 3QC2A 5FMDA 3WN0A 3R4YA 4UDJA 3U75A 3LV4A 4O8PA 3LDKA 3KF5A 3UGGA 3R4ZA 2VDTA 4UDKA 3WN1A 2XQRA 3ZXLA 4QQSA 5A8DA 4N4BA 5B6SA 5FKCA 1ST8A 4N1IA 3TAWA 3OM6A 5GLQA 3QEFA 2QQVA 3C7OA 5GLMA 4AK5A 5AYDA 3PIGA 4N2ZA 4U6BA 5FK7A 1UV4A 2YFRA 1GYDB 3LF7A 2EXHA 4N2RA 3K1UA 2X8SA 3VSRA 1UYPA 5AYEA 3BYJA 4NOVA 5GLLA 4O8NA 1PT2A 5GLOA 4FFHA 3QZ4A 1Y9GA
chains in the Genus database with same CATH topology
3AKGA 3RWKX 1OYGA 2QQWA 5FK8A 4FFFA 3ZXJA 2YFSA 3LEMA 3WPVA 3R67A 4PVAA 3C7FA 2ADEA 4KC8A 3VSZA 3VT1A 2AEZA 4AK6A 3P2NA 2YFTA 3OM2A 3BYLA 3BYKA 4COTA 4FFIA 5FKBA 3WPYA 2EXIA 3OM5A 3UGFA 3WPZA 3D5YA 3OM7A 3C7GA 3C2UA 3D60A 5GLRA 3WASA 3BYNA 5A7VA 5AY9A 5FMBA 5FMCA 3QEEA 4O8OA 3D61A 4UDIA 4MLGA 5JOXA 4ONZA 5ANNA 1VKDA 5FIXA 3C7HA 3LIGA 1Y9MA 3WMZA 1GYHA 4EQVA 3VSSA 1W2TA 3VT2A 3ZXKA 2AC1A 4KCBA 2X8TA 5C0PA 3AKFA 3AKHA 5A8CA 4U6DA 3CU9A 5GLKA 2X8FA 5JOZA 3WAUA 1YRZA 4AK7A 3QEDA 2OXBA 4UDGA 1Y7BA 5FLWA 5A7VB 3NQHA 3WN2A 4FFGA 3WMYA 4KC7A 1WL7A 2QQUA 1YI7A 3VT0A 4KMIA 1YIFA 2B4WA 4UDKE 3LDRA 5JOYA 3LFIA 2EXKA 3C7EA 5GLNA 3KSTA 5AYCA 5JOWA 3VSFA 3U14A 4D47A 3WPUA 2ADDA 3KF3A 2EXJA 3PIJA 4PVIA 5GLPA 3SC7X 3LIHA 3OM4A 3WATA 1W18A 3AKIA 1Y4WA 4KCAA 2AEYA 3D5ZA 1GYEB 3UGHA 5B6TA 3QC2A 5FMDA 3WN0A 3R4YA 4UDJA 3U75A 3LV4A 4O8PA 3LDKA 3KF5A 3UGGA 3R4ZA 2VDTA 4UDKA 3WN1A 2XQRA 3ZXLA 4QQSA 5A8DA 4N4BA 5B6SA 5FKCA 1ST8A 4N1IA 3TAWA 3OM6A 5GLQA 3QEFA 2QQVA 3C7OA 5GLMA 4AK5A 5AYDA 3PIGA 4N2ZA 4U6BA 5FK7A 1UV4A 2YFRA 1GYDB 3LF7A 2EXHA 4N2RA 3K1UA 2X8SA 3VSRA 1UYPA 5AYEA 3BYJA 4NOVA 5GLLA 4O8NA 1PT2A 5GLOA 4FFHA 3QZ4A 1Y9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AKG A;  3RWK X;  1OYG A;  2QQW A;  5FK8 A;  4FFF A;  3ZXJ A;  2YFS A;  3LEM A;  3WPV A;  3R67 A;  4PVA A;  3C7F A;  2ADE A;  4KC8 A;  3VSZ A;  3VT1 A;  2AEZ A;  4AK6 A;  3P2N A;  2YFT A;  3OM2 A;  3BYL A;  3BYK A;  4COT A;  4FFI A;  5FKB A;  3WPY A;  2EXI A;  3OM5 A;  3UGF A;  3WPZ A;  3D5Y A;  3OM7 A;  3C7G A;  3C2U A;  3D60 A;  5GLR A;  3WAS A;  3BYN A;  5A7V A;  5AY9 A;  5FMB A;  5FMC A;  3QEE A;  4O8O A;  3D61 A;  4UDI A;  4MLG A;  5JOX A;  4ONZ A;  5ANN A;  1VKD A;  5FIX A;  3C7H A;  3LIG A;  1Y9M A;  3WMZ A;  1GYH A;  4EQV A;  3VSS A;  1W2T A;  3VT2 A;  3ZXK A;  2AC1 A;  4KCB A;  2X8T A;  5C0P A;  3AKF A;  3AKH A;  5A8C A;  4U6D A;  3CU9 A;  5GLK A;  2X8F A;  5JOZ A;  3WAU A;  1YRZ A;  4AK7 A;  3QED A;  2OXB A;  4UDG A;  1Y7B A;  5FLW A;  5A7V B;  3NQH A;  3WN2 A;  4FFG A;  3WMY A;  4KC7 A;  1WL7 A;  2QQU A;  1YI7 A;  3VT0 A;  4KMI A;  1YIF A;  2B4W A;  4UDK E;  3LDR A;  5JOY A;  3LFI A;  2EXK A;  3C7E A;  5GLN A;  3KST A;  5AYC A;  5JOW A;  3VSF A;  3U14 A;  4D47 A;  3WPU A;  2ADD A;  3KF3 A;  2EXJ A;  3PIJ A;  4PVI A;  5GLP A;  3SC7 X;  3LIH A;  3OM4 A;  3WAT A;  1W18 A;  3AKI A;  1Y4W A;  4KCA A;  2AEY A;  3D5Z A;  1GYE B;  3UGH A;  5B6T A;  3QC2 A;  5FMD A;  3WN0 A;  3R4Y A;  4UDJ A;  3U75 A;  3LV4 A;  4O8P A;  3LDK A;  3KF5 A;  3UGG A;  3R4Z A;  2VDT A;  4UDK A;  3WN1 A;  2XQR A;  3ZXL A;  4QQS A;  5A8D A;  4N4B A;  5B6S A;  5FKC A;  1ST8 A;  4N1I A;  3TAW A;  3OM6 A;  5GLQ A;  3QEF A;  2QQV A;  3C7O A;  5GLM A;  4AK5 A;  5AYD A;  3PIG A;  4N2Z A;  4U6B A;  5FK7 A;  1UV4 A;  2YFR A;  1GYD B;  3LF7 A;  2EXH A;  4N2R A;  3K1U A;  2X8S A;  3VSR A;  1UYP A;  5AYE A;  3BYJ A;  4NOV A;  5GLL A;  4O8N A;  1PT2 A;  5GLO A;  4FFH A;  3QZ4 A;  1Y9G A; 
#chains in the Genus database with same CATH topology
 3AKG A;  3RWK X;  1OYG A;  2QQW A;  5FK8 A;  4FFF A;  3ZXJ A;  2YFS A;  3LEM A;  3WPV A;  3R67 A;  4PVA A;  3C7F A;  2ADE A;  4KC8 A;  3VSZ A;  3VT1 A;  2AEZ A;  4AK6 A;  3P2N A;  2YFT A;  3OM2 A;  3BYL A;  3BYK A;  4COT A;  4FFI A;  5FKB A;  3WPY A;  2EXI A;  3OM5 A;  3UGF A;  3WPZ A;  3D5Y A;  3OM7 A;  3C7G A;  3C2U A;  3D60 A;  5GLR A;  3WAS A;  3BYN A;  5A7V A;  5AY9 A;  5FMB A;  5FMC A;  3QEE A;  4O8O A;  3D61 A;  4UDI A;  4MLG A;  5JOX A;  4ONZ A;  5ANN A;  1VKD A;  5FIX A;  3C7H A;  3LIG A;  1TL2 A;  1Y9M A;  5C2M A;  3WMZ A;  1GYH A;  4EQV A;  3VSS A;  1W2T A;  3VT2 A;  3ZXK A;  2AC1 A;  4KCB A;  2X8T A;  5C0P A;  3AKF A;  3AKH A;  5A8C A;  4U6D A;  3CU9 A;  5GLK A;  2X8F A;  5JOZ A;  3WAU A;  1YRZ A;  4AK7 A;  3QED A;  2OXB A;  4UDG A;  1Y7B A;  5FLW A;  5A7V B;  3NQH A;  3WN2 A;  4FFG A;  3WMY A;  4KC7 A;  1WL7 A;  2QQU A;  1YI7 A;  3VT0 A;  4KMI A;  1YIF A;  2B4W A;  4UDK E;  3LDR A;  5JOY A;  3LFI A;  2EXK A;  3C7E A;  5GLN A;  3KST A;  5AYC A;  5JOW A;  3VSF A;  3U14 A;  4D47 A;  3WPU A;  2ADD A;  3KF3 A;  2EXJ A;  3PIJ A;  4PVI A;  5GLP A;  3SC7 X;  3LIH A;  3OM4 A;  3WAT A;  1W18 A;  3AKI A;  1Y4W A;  4KCA A;  2AEY A;  3D5Z A;  1GYE B;  3UGH A;  5B6T A;  3QC2 A;  5FMD A;  3WN0 A;  3R4Y A;  4UDJ A;  3U75 A;  3LV4 A;  4O8P A;  3LDK A;  3KF5 A;  3UGG A;  3R4Z A;  2VDT A;  4UDK A;  3WN1 A;  2XQR A;  3ZXL A;  4QQS A;  5A8D A;  4N4B A;  5B6S A;  5FKC A;  1ST8 A;  4N1I A;  3TAW A;  3OM6 A;  5GLQ A;  3QEF A;  2QQV A;  3C7O A;  5GLM A;  4AK5 A;  5AYD A;  3PIG A;  4N2Z A;  4U6B A;  5FK7 A;  1UV4 A;  2YFR A;  1GYD B;  3LF7 A;  2EXH A;  4N2R A;  3K1U A;  2X8S A;  3VSR A;  1UYP A;  5AYE A;  3BYJ A;  4NOV A;  5GLL A;  4O8N A;  1PT2 A;  5GLO A;  4FFH A;  3QZ4 A;  1Y9G A; 
#chains in the Genus database with same CATH homology
 3AKG A;  3RWK X;  1OYG A;  2QQW A;  5FK8 A;  4FFF A;  3ZXJ A;  2YFS A;  3LEM A;  3WPV A;  3R67 A;  4PVA A;  3C7F A;  2ADE A;  4KC8 A;  3VSZ A;  3VT1 A;  2AEZ A;  4AK6 A;  3P2N A;  2YFT A;  3OM2 A;  3BYL A;  3BYK A;  4COT A;  4FFI A;  5FKB A;  3WPY A;  2EXI A;  3OM5 A;  3UGF A;  3WPZ A;  3D5Y A;  3OM7 A;  3C7G A;  3C2U A;  3D60 A;  5GLR A;  3WAS A;  3BYN A;  5A7V A;  5AY9 A;  5FMB A;  5FMC A;  3QEE A;  4O8O A;  3D61 A;  4UDI A;  4MLG A;  5JOX A;  4ONZ A;  5ANN A;  1VKD A;  5FIX A;  3C7H A;  3LIG A;  1Y9M A;  3WMZ A;  1GYH A;  4EQV A;  3VSS A;  1W2T A;  3VT2 A;  3ZXK A;  2AC1 A;  4KCB A;  2X8T A;  5C0P A;  3AKF A;  3AKH A;  5A8C A;  4U6D A;  3CU9 A;  5GLK A;  2X8F A;  5JOZ A;  3WAU A;  1YRZ A;  4AK7 A;  3QED A;  2OXB A;  4UDG A;  1Y7B A;  5FLW A;  5A7V B;  3NQH A;  3WN2 A;  4FFG A;  3WMY A;  4KC7 A;  1WL7 A;  2QQU A;  1YI7 A;  3VT0 A;  4KMI A;  1YIF A;  2B4W A;  4UDK E;  3LDR A;  5JOY A;  3LFI A;  2EXK A;  3C7E A;  5GLN A;  3KST A;  5AYC A;  5JOW A;  3VSF A;  3U14 A;  4D47 A;  3WPU A;  2ADD A;  3KF3 A;  2EXJ A;  3PIJ A;  4PVI A;  5GLP A;  3SC7 X;  3LIH A;  3OM4 A;  3WAT A;  1W18 A;  3AKI A;  1Y4W A;  4KCA A;  2AEY A;  3D5Z A;  1GYE B;  3UGH A;  5B6T A;  3QC2 A;  5FMD A;  3WN0 A;  3R4Y A;  4UDJ A;  3U75 A;  3LV4 A;  4O8P A;  3LDK A;  3KF5 A;  3UGG A;  3R4Z A;  2VDT A;  4UDK A;  3WN1 A;  2XQR A;  3ZXL A;  4QQS A;  5A8D A;  4N4B A;  5B6S A;  5FKC A;  1ST8 A;  4N1I A;  3TAW A;  3OM6 A;  5GLQ A;  3QEF A;  2QQV A;  3C7O A;  5GLM A;  4AK5 A;  5AYD A;  3PIG A;  4N2Z A;  4U6B A;  5FK7 A;  1UV4 A;  2YFR A;  1GYD B;  3LF7 A;  2EXH A;  4N2R A;  3K1U A;  2X8S A;  3VSR A;  1UYP A;  5AYE A;  3BYJ A;  4NOV A;  5GLL A;  4O8N A;  1PT2 A;  5GLO A;  4FFH A;  3QZ4 A;  1Y9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...