3WN0A

Crystal structure of streptomyces coelicolor alpha-l-arabinofuranosidase in complex with l-arabinose
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
302
structure length
302
Chain Sequence
GTCALPSTYRWSSTGVLAQPKSGWVALKDFTTVTHNGRHLVYGSTSSGSSYGSMVFSPFTNWSDMASAGQNAMNQAAVAPTLFYFAPKNIWVLAYQWGSWPFIYRTSSDPTDPNGWSAPQPLFTGSISGSDTGPIDQTLIADGQNMYLFFAGDNGKIYRASMPIGNFPGNFGSSYTTIMSDTKANLFEGVQVYKVQGQNQYLMIVEAMGANGRYFRSFTASSLSGSWTPQAASEGNPFAGKANSGATWTNDISHGDLVRDNPDQTMTVDPCNLQFLYQGKSPNAGGDYNSLPWRPGVLTLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Extracellular exo-alpha-L-arabinofuranosidase
publication title Crystal structure and characterization of the glycoside hydrolase family 62 alpha-L-arabinofuranosidase from Streptomyces coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 69
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2013-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
A PF03664 Glyco_hydro_62 Glycosyl hydrolase family 62
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3wn0A00
5FIXA 3U14A 4COTA 4PVIA 5GLNA 5JOWA 3WPUA 1WL7A 3R4ZA 2EXHA 5B6SA 2QQVA 3LEMA 2ADDA 5JOYA 3K1UA 3WPVA 3OM7A 1YI7A 5FKCA 5B6TA 3LFIA 3C7EA 4N1IA 5ANNA 3OM5A 3SC7X 4KCBA 1YRZA 4UDKE 5AY9A 1GYHA 5FMCA 3R67A 4AK7A 1GYEB 4N2ZA 3KF5A 3ZXKA 3VSFA 3RWKX 3VSSA 3WATA 5FLWA 3C2UA 4QQSA 5A7VA 4KCAA 3C7OA 4NOVA 2X8FA 3LDKA 4KC7A 3WN2A 3QEEA 4N2RA 3BYKA 3KF3A 4AK6A 4KC8A 5A7VB 3WMZA 3AKHA 4ONZA 2YFTA 5FMDA 5GLRA 2EXJA 5AYDA 3QC2A 1ST8A 4FFGA 4UDGA 3WAUA 3WMYA 2AC1A 3ZXJA 5A8DA 3QEFA 2X8SA 3WPZA 3D61A 4FFIA 3VSZA 4KMIA 5FK7A 4FFHA 3VT0A 2XQRA 2VDTA 1GYDB 3BYJA 3PIJA 3AKGA 3AKIA 4UDJA 3C7FA 5C0PA 1VKDA 2B4WA 3LIGA 3BYNA 5GLMA 5FKBA 3P2NA 5GLPA 1W2TA 2YFRA 3OM2A 4MLGA 3BYLA 3AKFA 2ADEA 4UDIA 5FMBA 4N4BA 4D47A 3WN0A 3LV4A 4EQVA 3D5ZA 3OM4A 5FK8A 4AK5A 3UGGA 1W18A 3WASA 3VT1A 1Y9MA 3D5YA 5JOZA 3UGFA 3R4YA 1UV4A 1YIFA 3C7HA 2EXKA 3D60A 5A8CA 3VSRA 4O8NA 2EXIA 5AYCA 1PT2A 5GLQA 2QQWA 3QZ4A 4PVAA 4U6DA 3U75A 3UGHA 1OYGA 3WN1A 1UYPA 2AEZA 3CU9A 4FFFA 3TAWA 3LDRA 3NQHA 4UDKA 3QEDA 3WPYA 5GLKA 3OM6A 5JOXA 4O8PA 3LF7A 2OXBA 3VT2A 1Y7BA 4U6BA 1Y9GA 2AEYA 2X8TA 3C7GA 3LIHA 2QQUA 3PIGA 2YFSA 3ZXLA 5AYEA 1Y4WA 5GLLA 5GLOA 3KSTA 4O8OA
chains in the Genus database with same CATH superfamily
5FIXA 3U14A 4COTA 4PVIA 5GLNA 5JOWA 3WPUA 1WL7A 3R4ZA 2EXHA 5B6SA 2QQVA 3LEMA 2ADDA 5JOYA 3K1UA 3WPVA 3OM7A 1YI7A 5FKCA 5B6TA 3LFIA 3C7EA 4N1IA 5ANNA 3OM5A 3SC7X 4KCBA 1YRZA 4UDKE 5AY9A 1GYHA 5FMCA 3R67A 4AK7A 1GYEB 4N2ZA 3KF5A 3ZXKA 3VSFA 3RWKX 3VSSA 3WATA 5FLWA 3C2UA 4QQSA 5A7VA 4KCAA 3C7OA 4NOVA 2X8FA 3LDKA 4KC7A 3WN2A 3QEEA 4N2RA 3BYKA 3KF3A 4AK6A 4KC8A 5A7VB 3WMZA 3AKHA 4ONZA 2YFTA 5FMDA 5GLRA 2EXJA 1TL2A 5AYDA 3QC2A 1ST8A 4FFGA 4UDGA 3WAUA 3WMYA 2AC1A 3ZXJA 5A8DA 3QEFA 2X8SA 3WPZA 3D61A 4FFIA 3VSZA 4KMIA 5FK7A 4FFHA 3VT0A 2XQRA 2VDTA 1GYDB 3BYJA 3PIJA 3AKGA 3AKIA 4UDJA 3C7FA 5C0PA 1VKDA 2B4WA 3LIGA 3BYNA 5GLMA 5FKBA 3P2NA 5GLPA 1W2TA 2YFRA 3OM2A 4MLGA 3BYLA 3AKFA 2ADEA 4UDIA 5FMBA 5C2MA 4N4BA 4D47A 3WN0A 3LV4A 4EQVA 3D5ZA 3OM4A 5FK8A 4AK5A 3UGGA 1W18A 3WASA 3VT1A 1Y9MA 3D5YA 5JOZA 3UGFA 3R4YA 1UV4A 1YIFA 3C7HA 2EXKA 3D60A 5A8CA 3VSRA 4O8NA 2EXIA 5AYCA 1PT2A 5GLQA 2QQWA 3QZ4A 4PVAA 4U6DA 3U75A 3UGHA 1OYGA 3WN1A 1UYPA 2AEZA 3CU9A 4FFFA 3TAWA 3LDRA 3NQHA 4UDKA 3QEDA 3WPYA 5GLKA 3OM6A 5JOXA 4O8PA 3LF7A 2OXBA 3VT2A 1Y7BA 4U6BA 1Y9GA 2AEYA 2X8TA 3C7GA 3LIHA 2QQUA 3PIGA 2YFSA 3ZXLA 5AYEA 1Y4WA 5GLLA 5GLOA 3KSTA 4O8OA
chains in the Genus database with same CATH topology
5FIXA 3U14A 4COTA 4PVIA 5GLNA 5JOWA 3WPUA 1WL7A 3R4ZA 2EXHA 5B6SA 2QQVA 3LEMA 2ADDA 5JOYA 3K1UA 3WPVA 3OM7A 1YI7A 5FKCA 5B6TA 3LFIA 3C7EA 4N1IA 5ANNA 3OM5A 3SC7X 4KCBA 1YRZA 4UDKE 5AY9A 1GYHA 5FMCA 3R67A 4AK7A 1GYEB 4N2ZA 3KF5A 3ZXKA 3VSFA 3RWKX 3VSSA 3WATA 5FLWA 3C2UA 4QQSA 5A7VA 4KCAA 3C7OA 4NOVA 2X8FA 3LDKA 4KC7A 3WN2A 3QEEA 4N2RA 3BYKA 3KF3A 4AK6A 4KC8A 5A7VB 3WMZA 3AKHA 4ONZA 2YFTA 5FMDA 5GLRA 2EXJA 5AYDA 3QC2A 1ST8A 4FFGA 4UDGA 3WAUA 3WMYA 2AC1A 3ZXJA 5A8DA 3QEFA 2X8SA 3WPZA 3D61A 4FFIA 3VSZA 4KMIA 5FK7A 4FFHA 3VT0A 2XQRA 2VDTA 1GYDB 3BYJA 3PIJA 3AKGA 3AKIA 4UDJA 3C7FA 5C0PA 1VKDA 2B4WA 3LIGA 3BYNA 5GLMA 5FKBA 3P2NA 5GLPA 1W2TA 2YFRA 3OM2A 4MLGA 3BYLA 3AKFA 2ADEA 4UDIA 5FMBA 4N4BA 4D47A 3WN0A 3LV4A 4EQVA 3D5ZA 3OM4A 5FK8A 4AK5A 3UGGA 1W18A 3WASA 3VT1A 1Y9MA 3D5YA 5JOZA 3UGFA 3R4YA 1UV4A 1YIFA 3C7HA 2EXKA 3D60A 5A8CA 3VSRA 4O8NA 2EXIA 5AYCA 1PT2A 5GLQA 2QQWA 3QZ4A 4PVAA 4U6DA 3U75A 3UGHA 1OYGA 3WN1A 1UYPA 2AEZA 3CU9A 4FFFA 3TAWA 3LDRA 3NQHA 4UDKA 3QEDA 3WPYA 5GLKA 3OM6A 5JOXA 4O8PA 3LF7A 2OXBA 3VT2A 1Y7BA 4U6BA 1Y9GA 2AEYA 2X8TA 3C7GA 3LIHA 2QQUA 3PIGA 2YFSA 3ZXLA 5AYEA 1Y4WA 5GLLA 5GLOA 3KSTA 4O8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FIX A;  3U14 A;  4COT A;  4PVI A;  5GLN A;  5JOW A;  3WPU A;  1WL7 A;  3R4Z A;  2EXH A;  5B6S A;  2QQV A;  3LEM A;  2ADD A;  5JOY A;  3K1U A;  3WPV A;  3OM7 A;  1YI7 A;  5FKC A;  5B6T A;  3LFI A;  3C7E A;  4N1I A;  5ANN A;  3OM5 A;  3SC7 X;  4KCB A;  1YRZ A;  4UDK E;  5AY9 A;  1GYH A;  5FMC A;  3R67 A;  4AK7 A;  1GYE B;  4N2Z A;  3KF5 A;  3ZXK A;  3VSF A;  3RWK X;  3VSS A;  3WAT A;  5FLW A;  3C2U A;  4QQS A;  5A7V A;  4KCA A;  3C7O A;  4NOV A;  2X8F A;  3LDK A;  4KC7 A;  3WN2 A;  3QEE A;  4N2R A;  3BYK A;  3KF3 A;  4AK6 A;  4KC8 A;  5A7V B;  3WMZ A;  3AKH A;  4ONZ A;  2YFT A;  5FMD A;  5GLR A;  2EXJ A;  5AYD A;  3QC2 A;  1ST8 A;  4FFG A;  4UDG A;  3WAU A;  3WMY A;  2AC1 A;  3ZXJ A;  5A8D A;  3QEF A;  2X8S A;  3WPZ A;  3D61 A;  4FFI A;  3VSZ A;  4KMI A;  5FK7 A;  4FFH A;  3VT0 A;  2XQR A;  2VDT A;  1GYD B;  3BYJ A;  3PIJ A;  3AKG A;  3AKI A;  4UDJ A;  3C7F A;  5C0P A;  1VKD A;  2B4W A;  3LIG A;  3BYN A;  5GLM A;  5FKB A;  3P2N A;  5GLP A;  1W2T A;  2YFR A;  3OM2 A;  4MLG A;  3BYL A;  3AKF A;  2ADE A;  4UDI A;  5FMB A;  4N4B A;  4D47 A;  3WN0 A;  3LV4 A;  4EQV A;  3D5Z A;  3OM4 A;  5FK8 A;  4AK5 A;  3UGG A;  1W18 A;  3WAS A;  3VT1 A;  1Y9M A;  3D5Y A;  5JOZ A;  3UGF A;  3R4Y A;  1UV4 A;  1YIF A;  3C7H A;  2EXK A;  3D60 A;  5A8C A;  3VSR A;  4O8N A;  2EXI A;  5AYC A;  1PT2 A;  5GLQ A;  2QQW A;  3QZ4 A;  4PVA A;  4U6D A;  3U75 A;  3UGH A;  1OYG A;  3WN1 A;  1UYP A;  2AEZ A;  3CU9 A;  4FFF A;  3TAW A;  3LDR A;  3NQH A;  4UDK A;  3QED A;  3WPY A;  5GLK A;  3OM6 A;  5JOX A;  4O8P A;  3LF7 A;  2OXB A;  3VT2 A;  1Y7B A;  4U6B A;  1Y9G A;  2AEY A;  2X8T A;  3C7G A;  3LIH A;  2QQU A;  3PIG A;  2YFS A;  3ZXL A;  5AYE A;  1Y4W A;  5GLL A;  5GLO A;  3KST A;  4O8O A; 
#chains in the Genus database with same CATH topology
 5FIX A;  3U14 A;  4COT A;  4PVI A;  5GLN A;  5JOW A;  3WPU A;  1WL7 A;  3R4Z A;  2EXH A;  5B6S A;  2QQV A;  3LEM A;  2ADD A;  5JOY A;  3K1U A;  3WPV A;  3OM7 A;  1YI7 A;  5FKC A;  5B6T A;  3LFI A;  3C7E A;  4N1I A;  5ANN A;  3OM5 A;  3SC7 X;  4KCB A;  1YRZ A;  4UDK E;  5AY9 A;  1GYH A;  5FMC A;  3R67 A;  4AK7 A;  1GYE B;  4N2Z A;  3KF5 A;  3ZXK A;  3VSF A;  3RWK X;  3VSS A;  3WAT A;  5FLW A;  3C2U A;  4QQS A;  5A7V A;  4KCA A;  3C7O A;  4NOV A;  2X8F A;  3LDK A;  4KC7 A;  3WN2 A;  3QEE A;  4N2R A;  3BYK A;  3KF3 A;  4AK6 A;  4KC8 A;  5A7V B;  3WMZ A;  3AKH A;  4ONZ A;  2YFT A;  5FMD A;  5GLR A;  2EXJ A;  1TL2 A;  5AYD A;  3QC2 A;  1ST8 A;  4FFG A;  4UDG A;  3WAU A;  3WMY A;  2AC1 A;  3ZXJ A;  5A8D A;  3QEF A;  2X8S A;  3WPZ A;  3D61 A;  4FFI A;  3VSZ A;  4KMI A;  5FK7 A;  4FFH A;  3VT0 A;  2XQR A;  2VDT A;  1GYD B;  3BYJ A;  3PIJ A;  3AKG A;  3AKI A;  4UDJ A;  3C7F A;  5C0P A;  1VKD A;  2B4W A;  3LIG A;  3BYN A;  5GLM A;  5FKB A;  3P2N A;  5GLP A;  1W2T A;  2YFR A;  3OM2 A;  4MLG A;  3BYL A;  3AKF A;  2ADE A;  4UDI A;  5FMB A;  5C2M A;  4N4B A;  4D47 A;  3WN0 A;  3LV4 A;  4EQV A;  3D5Z A;  3OM4 A;  5FK8 A;  4AK5 A;  3UGG A;  1W18 A;  3WAS A;  3VT1 A;  1Y9M A;  3D5Y A;  5JOZ A;  3UGF A;  3R4Y A;  1UV4 A;  1YIF A;  3C7H A;  2EXK A;  3D60 A;  5A8C A;  3VSR A;  4O8N A;  2EXI A;  5AYC A;  1PT2 A;  5GLQ A;  2QQW A;  3QZ4 A;  4PVA A;  4U6D A;  3U75 A;  3UGH A;  1OYG A;  3WN1 A;  1UYP A;  2AEZ A;  3CU9 A;  4FFF A;  3TAW A;  3LDR A;  3NQH A;  4UDK A;  3QED A;  3WPY A;  5GLK A;  3OM6 A;  5JOX A;  4O8P A;  3LF7 A;  2OXB A;  3VT2 A;  1Y7B A;  4U6B A;  1Y9G A;  2AEY A;  2X8T A;  3C7G A;  3LIH A;  2QQU A;  3PIG A;  2YFS A;  3ZXL A;  5AYE A;  1Y4W A;  5GLL A;  5GLO A;  3KST A;  4O8O A; 
#chains in the Genus database with same CATH homology
 5FIX A;  3U14 A;  4COT A;  4PVI A;  5GLN A;  5JOW A;  3WPU A;  1WL7 A;  3R4Z A;  2EXH A;  5B6S A;  2QQV A;  3LEM A;  2ADD A;  5JOY A;  3K1U A;  3WPV A;  3OM7 A;  1YI7 A;  5FKC A;  5B6T A;  3LFI A;  3C7E A;  4N1I A;  5ANN A;  3OM5 A;  3SC7 X;  4KCB A;  1YRZ A;  4UDK E;  5AY9 A;  1GYH A;  5FMC A;  3R67 A;  4AK7 A;  1GYE B;  4N2Z A;  3KF5 A;  3ZXK A;  3VSF A;  3RWK X;  3VSS A;  3WAT A;  5FLW A;  3C2U A;  4QQS A;  5A7V A;  4KCA A;  3C7O A;  4NOV A;  2X8F A;  3LDK A;  4KC7 A;  3WN2 A;  3QEE A;  4N2R A;  3BYK A;  3KF3 A;  4AK6 A;  4KC8 A;  5A7V B;  3WMZ A;  3AKH A;  4ONZ A;  2YFT A;  5FMD A;  5GLR A;  2EXJ A;  5AYD A;  3QC2 A;  1ST8 A;  4FFG A;  4UDG A;  3WAU A;  3WMY A;  2AC1 A;  3ZXJ A;  5A8D A;  3QEF A;  2X8S A;  3WPZ A;  3D61 A;  4FFI A;  3VSZ A;  4KMI A;  5FK7 A;  4FFH A;  3VT0 A;  2XQR A;  2VDT A;  1GYD B;  3BYJ A;  3PIJ A;  3AKG A;  3AKI A;  4UDJ A;  3C7F A;  5C0P A;  1VKD A;  2B4W A;  3LIG A;  3BYN A;  5GLM A;  5FKB A;  3P2N A;  5GLP A;  1W2T A;  2YFR A;  3OM2 A;  4MLG A;  3BYL A;  3AKF A;  2ADE A;  4UDI A;  5FMB A;  4N4B A;  4D47 A;  3WN0 A;  3LV4 A;  4EQV A;  3D5Z A;  3OM4 A;  5FK8 A;  4AK5 A;  3UGG A;  1W18 A;  3WAS A;  3VT1 A;  1Y9M A;  3D5Y A;  5JOZ A;  3UGF A;  3R4Y A;  1UV4 A;  1YIF A;  3C7H A;  2EXK A;  3D60 A;  5A8C A;  3VSR A;  4O8N A;  2EXI A;  5AYC A;  1PT2 A;  5GLQ A;  2QQW A;  3QZ4 A;  4PVA A;  4U6D A;  3U75 A;  3UGH A;  1OYG A;  3WN1 A;  1UYP A;  2AEZ A;  3CU9 A;  4FFF A;  3TAW A;  3LDR A;  3NQH A;  4UDK A;  3QED A;  3WPY A;  5GLK A;  3OM6 A;  5JOX A;  4O8P A;  3LF7 A;  2OXB A;  3VT2 A;  1Y7B A;  4U6B A;  1Y9G A;  2AEY A;  2X8T A;  3C7G A;  3LIH A;  2QQU A;  3PIG A;  2YFS A;  3ZXL A;  5AYE A;  1Y4W A;  5GLL A;  5GLO A;  3KST A;  4O8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...