3WN1A

Crystal structure of streptomyces coelicolor alpha-l-arabinofuranosidase in complex with xylotriose
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
302
structure length
302
Chain Sequence
GTCALPSTYRWSSTGVLAQPKSGWVALKDFTTVTHNGRHLVYGSTSSGSSYGSMVFSPFTNWSDMASAGQNAMNQAAVAPTLFYFAPKNIWVLAYQWGSWPFIYRTSSDPTDPNGWSAPQPLFTGSISGSDTGPIDQTLIADGQNMYLFFAGDNGKIYRASMPIGNFPGNFGSSYTTIMSDTKANLFEGVQVYKVQGQNQYLMIVEAMGANGRYFRSFTASSLSGSWTPQAASEGNPFAGKANSGATWTNDISHGDLVRDNPDQTMTVDPCNLQFLYQGKSPNAGGDYNSLPWRPGVLTLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Extracellular exo-alpha-L-arabinofuranosidase
publication title Crystal structure and characterization of the glycoside hydrolase family 62 alpha-L-arabinofuranosidase from Streptomyces coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 69
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2013-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
A PF03664 Glyco_hydro_62 Glycosyl hydrolase family 62
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3wn1A00
4N4BA 2XQRA 3R67A 5FK7A 2AC1A 3LF7A 5FMDA 4QQSA 5A8DA 4ONZA 2X8FA 3SC7X 3AKIA 2EXKA 4FFGA 3WASA 3ZXJA 4NOVA 5GLPA 5JOWA 3QEDA 1Y9GA 1PT2A 5GLLA 4O8OA 3KF5A 3D61A 3VSFA 5FIXA 3PIJA 4N1IA 3LFIA 4U6DA 1YRZA 5JOXA 4FFFA 5FK8A 4KC7A 5FMBA 3U14A 3WN2A 1ST8A 3RWKX 5GLKA 3WMYA 1YI7A 4KC8A 3ZXKA 5A8CA 3WN0A 5FKBA 5AYDA 3LV4A 3BYNA 3VSZA 1OYGA 4O8PA 2VDTA 3C7HA 1UYPA 3VT0A 3C7FA 2ADDA 3U75A 3WN1A 5FMCA 2EXIA 4KCAA 2X8TA 5AY9A 3VSRA 4EQVA 5B6TA 3TAWA 4U6BA 3BYJA 1GYDB 2EXJA 2QQVA 3C7OA 5GLNA 5GLOA 3VT1A 3OM7A 5FKCA 4PVAA 4UDJA 5GLRA 4KCBA 3D5ZA 3OM5A 3C7GA 4MLGA 3D60A 3PIGA 3QZ4A 1YIFA 2AEYA 3WAUA 1Y9MA 2QQWA 3OM4A 3ZXLA 2YFRA 3LIHA 4O8NA 4D47A 3KF3A 3WPYA 4UDGA 3AKFA 3OM6A 3CU9A 1W2TA 4FFHA 5GLQA 1W18A 1UV4A 1GYHA 3VT2A 3R4YA 3WATA 4AK6A 5GLMA 3UGGA 3C7EA 2YFSA 3P2NA 1GYEB 4N2ZA 1Y4WA 3KSTA 3WMZA 2OXBA 3OM2A 4AK5A 4N2RA 5ANNA 3QEFA 3WPUA 2B4WA 2EXHA 3LIGA 5A7VA 5A7VB 4FFIA 3UGFA 4UDIA 1Y7BA 5AYEA 4KMIA 3AKGA 1WL7A 3C2UA 3VSSA 3QEEA 2AEZA 3LDRA 4UDKA 5AYCA 3UGHA 4COTA 3LEMA 2ADEA 3BYKA 3LDKA 2QQUA 3BYLA 3QC2A 2YFTA 1VKDA 5C0PA 4AK7A 3NQHA 3D5YA 3WPVA 2X8SA 5B6SA 5JOYA 3WPZA 3K1UA 5JOZA 3R4ZA 3AKHA 4UDKE 5FLWA 4PVIA
chains in the Genus database with same CATH superfamily
4N4BA 2XQRA 3R67A 5FK7A 2AC1A 3LF7A 5FMDA 4QQSA 5A8DA 4ONZA 2X8FA 3SC7X 3AKIA 2EXKA 4FFGA 3WASA 3ZXJA 4NOVA 5GLPA 5JOWA 3QEDA 5C2MA 1Y9GA 1PT2A 5GLLA 4O8OA 3KF5A 3D61A 3VSFA 5FIXA 3PIJA 4N1IA 3LFIA 4U6DA 1YRZA 5JOXA 4FFFA 5FK8A 4KC7A 5FMBA 3U14A 3WN2A 1ST8A 3RWKX 5GLKA 3WMYA 1YI7A 4KC8A 3ZXKA 5A8CA 3WN0A 5FKBA 5AYDA 3LV4A 3BYNA 3VSZA 1OYGA 4O8PA 2VDTA 3C7HA 1UYPA 3VT0A 3C7FA 2ADDA 3U75A 3WN1A 5FMCA 2EXIA 4KCAA 2X8TA 5AY9A 3VSRA 4EQVA 5B6TA 3TAWA 4U6BA 3BYJA 1GYDB 2EXJA 2QQVA 3C7OA 1TL2A 5GLNA 5GLOA 3VT1A 3OM7A 5FKCA 4PVAA 4UDJA 5GLRA 4KCBA 3D5ZA 3OM5A 3C7GA 4MLGA 3D60A 3PIGA 3QZ4A 1YIFA 2AEYA 3WAUA 1Y9MA 2QQWA 3OM4A 3ZXLA 2YFRA 3LIHA 4O8NA 4D47A 3KF3A 3WPYA 4UDGA 3AKFA 3OM6A 3CU9A 1W2TA 4FFHA 5GLQA 1W18A 1UV4A 1GYHA 3VT2A 3R4YA 3WATA 4AK6A 5GLMA 3UGGA 3C7EA 2YFSA 3P2NA 1GYEB 4N2ZA 1Y4WA 3KSTA 3WMZA 2OXBA 3OM2A 4AK5A 4N2RA 5ANNA 3QEFA 3WPUA 2B4WA 2EXHA 3LIGA 5A7VA 5A7VB 4FFIA 3UGFA 4UDIA 1Y7BA 5AYEA 4KMIA 3AKGA 1WL7A 3C2UA 3VSSA 3QEEA 2AEZA 3LDRA 4UDKA 5AYCA 3UGHA 4COTA 3LEMA 2ADEA 3BYKA 3LDKA 2QQUA 3BYLA 3QC2A 2YFTA 1VKDA 5C0PA 4AK7A 3NQHA 3D5YA 3WPVA 2X8SA 5B6SA 5JOYA 3WPZA 3K1UA 5JOZA 3R4ZA 3AKHA 4UDKE 5FLWA 4PVIA
chains in the Genus database with same CATH topology
4N4BA 2XQRA 3R67A 5FK7A 2AC1A 3LF7A 5FMDA 4QQSA 5A8DA 4ONZA 2X8FA 3SC7X 3AKIA 2EXKA 4FFGA 3WASA 3ZXJA 4NOVA 5GLPA 5JOWA 3QEDA 1Y9GA 1PT2A 5GLLA 4O8OA 3KF5A 3D61A 3VSFA 5FIXA 3PIJA 4N1IA 3LFIA 4U6DA 1YRZA 5JOXA 4FFFA 5FK8A 4KC7A 5FMBA 3U14A 3WN2A 1ST8A 3RWKX 5GLKA 3WMYA 1YI7A 4KC8A 3ZXKA 5A8CA 3WN0A 5FKBA 5AYDA 3LV4A 3BYNA 3VSZA 1OYGA 4O8PA 2VDTA 3C7HA 1UYPA 3VT0A 3C7FA 2ADDA 3U75A 3WN1A 5FMCA 2EXIA 4KCAA 2X8TA 5AY9A 3VSRA 4EQVA 5B6TA 3TAWA 4U6BA 3BYJA 1GYDB 2EXJA 2QQVA 3C7OA 5GLNA 5GLOA 3VT1A 3OM7A 5FKCA 4PVAA 4UDJA 5GLRA 4KCBA 3D5ZA 3OM5A 3C7GA 4MLGA 3D60A 3PIGA 3QZ4A 1YIFA 2AEYA 3WAUA 1Y9MA 2QQWA 3OM4A 3ZXLA 2YFRA 3LIHA 4O8NA 4D47A 3KF3A 3WPYA 4UDGA 3AKFA 3OM6A 3CU9A 1W2TA 4FFHA 5GLQA 1W18A 1UV4A 1GYHA 3VT2A 3R4YA 3WATA 4AK6A 5GLMA 3UGGA 3C7EA 2YFSA 3P2NA 1GYEB 4N2ZA 1Y4WA 3KSTA 3WMZA 2OXBA 3OM2A 4AK5A 4N2RA 5ANNA 3QEFA 3WPUA 2B4WA 2EXHA 3LIGA 5A7VA 5A7VB 4FFIA 3UGFA 4UDIA 1Y7BA 5AYEA 4KMIA 3AKGA 1WL7A 3C2UA 3VSSA 3QEEA 2AEZA 3LDRA 4UDKA 5AYCA 3UGHA 4COTA 3LEMA 2ADEA 3BYKA 3LDKA 2QQUA 3BYLA 3QC2A 2YFTA 1VKDA 5C0PA 4AK7A 3NQHA 3D5YA 3WPVA 2X8SA 5B6SA 5JOYA 3WPZA 3K1UA 5JOZA 3R4ZA 3AKHA 4UDKE 5FLWA 4PVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4B A;  2XQR A;  3R67 A;  5FK7 A;  2AC1 A;  3LF7 A;  5FMD A;  4QQS A;  5A8D A;  4ONZ A;  2X8F A;  3SC7 X;  3AKI A;  2EXK A;  4FFG A;  3WAS A;  3ZXJ A;  4NOV A;  5GLP A;  5JOW A;  3QED A;  1Y9G A;  1PT2 A;  5GLL A;  4O8O A;  3KF5 A;  3D61 A;  3VSF A;  5FIX A;  3PIJ A;  4N1I A;  3LFI A;  4U6D A;  1YRZ A;  5JOX A;  4FFF A;  5FK8 A;  4KC7 A;  5FMB A;  3U14 A;  3WN2 A;  1ST8 A;  3RWK X;  5GLK A;  3WMY A;  1YI7 A;  4KC8 A;  3ZXK A;  5A8C A;  3WN0 A;  5FKB A;  5AYD A;  3LV4 A;  3BYN A;  3VSZ A;  1OYG A;  4O8P A;  2VDT A;  3C7H A;  1UYP A;  3VT0 A;  3C7F A;  2ADD A;  3U75 A;  3WN1 A;  5FMC A;  2EXI A;  4KCA A;  2X8T A;  5AY9 A;  3VSR A;  4EQV A;  5B6T A;  3TAW A;  4U6B A;  3BYJ A;  1GYD B;  2EXJ A;  2QQV A;  3C7O A;  5GLN A;  5GLO A;  3VT1 A;  3OM7 A;  5FKC A;  4PVA A;  4UDJ A;  5GLR A;  4KCB A;  3D5Z A;  3OM5 A;  3C7G A;  4MLG A;  3D60 A;  3PIG A;  3QZ4 A;  1YIF A;  2AEY A;  3WAU A;  1Y9M A;  2QQW A;  3OM4 A;  3ZXL A;  2YFR A;  3LIH A;  4O8N A;  4D47 A;  3KF3 A;  3WPY A;  4UDG A;  3AKF A;  3OM6 A;  3CU9 A;  1W2T A;  4FFH A;  5GLQ A;  1W18 A;  1UV4 A;  1GYH A;  3VT2 A;  3R4Y A;  3WAT A;  4AK6 A;  5GLM A;  3UGG A;  3C7E A;  2YFS A;  3P2N A;  1GYE B;  4N2Z A;  1Y4W A;  3KST A;  3WMZ A;  2OXB A;  3OM2 A;  4AK5 A;  4N2R A;  5ANN A;  3QEF A;  3WPU A;  2B4W A;  2EXH A;  3LIG A;  5A7V A;  5A7V B;  4FFI A;  3UGF A;  4UDI A;  1Y7B A;  5AYE A;  4KMI A;  3AKG A;  1WL7 A;  3C2U A;  3VSS A;  3QEE A;  2AEZ A;  3LDR A;  4UDK A;  5AYC A;  3UGH A;  4COT A;  3LEM A;  2ADE A;  3BYK A;  3LDK A;  2QQU A;  3BYL A;  3QC2 A;  2YFT A;  1VKD A;  5C0P A;  4AK7 A;  3NQH A;  3D5Y A;  3WPV A;  2X8S A;  5B6S A;  5JOY A;  3WPZ A;  3K1U A;  5JOZ A;  3R4Z A;  3AKH A;  4UDK E;  5FLW A;  4PVI A; 
#chains in the Genus database with same CATH topology
 4N4B A;  2XQR A;  3R67 A;  5FK7 A;  2AC1 A;  3LF7 A;  5FMD A;  4QQS A;  5A8D A;  4ONZ A;  2X8F A;  3SC7 X;  3AKI A;  2EXK A;  4FFG A;  3WAS A;  3ZXJ A;  4NOV A;  5GLP A;  5JOW A;  3QED A;  5C2M A;  1Y9G A;  1PT2 A;  5GLL A;  4O8O A;  3KF5 A;  3D61 A;  3VSF A;  5FIX A;  3PIJ A;  4N1I A;  3LFI A;  4U6D A;  1YRZ A;  5JOX A;  4FFF A;  5FK8 A;  4KC7 A;  5FMB A;  3U14 A;  3WN2 A;  1ST8 A;  3RWK X;  5GLK A;  3WMY A;  1YI7 A;  4KC8 A;  3ZXK A;  5A8C A;  3WN0 A;  5FKB A;  5AYD A;  3LV4 A;  3BYN A;  3VSZ A;  1OYG A;  4O8P A;  2VDT A;  3C7H A;  1UYP A;  3VT0 A;  3C7F A;  2ADD A;  3U75 A;  3WN1 A;  5FMC A;  2EXI A;  4KCA A;  2X8T A;  5AY9 A;  3VSR A;  4EQV A;  5B6T A;  3TAW A;  4U6B A;  3BYJ A;  1GYD B;  2EXJ A;  2QQV A;  3C7O A;  1TL2 A;  5GLN A;  5GLO A;  3VT1 A;  3OM7 A;  5FKC A;  4PVA A;  4UDJ A;  5GLR A;  4KCB A;  3D5Z A;  3OM5 A;  3C7G A;  4MLG A;  3D60 A;  3PIG A;  3QZ4 A;  1YIF A;  2AEY A;  3WAU A;  1Y9M A;  2QQW A;  3OM4 A;  3ZXL A;  2YFR A;  3LIH A;  4O8N A;  4D47 A;  3KF3 A;  3WPY A;  4UDG A;  3AKF A;  3OM6 A;  3CU9 A;  1W2T A;  4FFH A;  5GLQ A;  1W18 A;  1UV4 A;  1GYH A;  3VT2 A;  3R4Y A;  3WAT A;  4AK6 A;  5GLM A;  3UGG A;  3C7E A;  2YFS A;  3P2N A;  1GYE B;  4N2Z A;  1Y4W A;  3KST A;  3WMZ A;  2OXB A;  3OM2 A;  4AK5 A;  4N2R A;  5ANN A;  3QEF A;  3WPU A;  2B4W A;  2EXH A;  3LIG A;  5A7V A;  5A7V B;  4FFI A;  3UGF A;  4UDI A;  1Y7B A;  5AYE A;  4KMI A;  3AKG A;  1WL7 A;  3C2U A;  3VSS A;  3QEE A;  2AEZ A;  3LDR A;  4UDK A;  5AYC A;  3UGH A;  4COT A;  3LEM A;  2ADE A;  3BYK A;  3LDK A;  2QQU A;  3BYL A;  3QC2 A;  2YFT A;  1VKD A;  5C0P A;  4AK7 A;  3NQH A;  3D5Y A;  3WPV A;  2X8S A;  5B6S A;  5JOY A;  3WPZ A;  3K1U A;  5JOZ A;  3R4Z A;  3AKH A;  4UDK E;  5FLW A;  4PVI A; 
#chains in the Genus database with same CATH homology
 4N4B A;  2XQR A;  3R67 A;  5FK7 A;  2AC1 A;  3LF7 A;  5FMD A;  4QQS A;  5A8D A;  4ONZ A;  2X8F A;  3SC7 X;  3AKI A;  2EXK A;  4FFG A;  3WAS A;  3ZXJ A;  4NOV A;  5GLP A;  5JOW A;  3QED A;  1Y9G A;  1PT2 A;  5GLL A;  4O8O A;  3KF5 A;  3D61 A;  3VSF A;  5FIX A;  3PIJ A;  4N1I A;  3LFI A;  4U6D A;  1YRZ A;  5JOX A;  4FFF A;  5FK8 A;  4KC7 A;  5FMB A;  3U14 A;  3WN2 A;  1ST8 A;  3RWK X;  5GLK A;  3WMY A;  1YI7 A;  4KC8 A;  3ZXK A;  5A8C A;  3WN0 A;  5FKB A;  5AYD A;  3LV4 A;  3BYN A;  3VSZ A;  1OYG A;  4O8P A;  2VDT A;  3C7H A;  1UYP A;  3VT0 A;  3C7F A;  2ADD A;  3U75 A;  3WN1 A;  5FMC A;  2EXI A;  4KCA A;  2X8T A;  5AY9 A;  3VSR A;  4EQV A;  5B6T A;  3TAW A;  4U6B A;  3BYJ A;  1GYD B;  2EXJ A;  2QQV A;  3C7O A;  5GLN A;  5GLO A;  3VT1 A;  3OM7 A;  5FKC A;  4PVA A;  4UDJ A;  5GLR A;  4KCB A;  3D5Z A;  3OM5 A;  3C7G A;  4MLG A;  3D60 A;  3PIG A;  3QZ4 A;  1YIF A;  2AEY A;  3WAU A;  1Y9M A;  2QQW A;  3OM4 A;  3ZXL A;  2YFR A;  3LIH A;  4O8N A;  4D47 A;  3KF3 A;  3WPY A;  4UDG A;  3AKF A;  3OM6 A;  3CU9 A;  1W2T A;  4FFH A;  5GLQ A;  1W18 A;  1UV4 A;  1GYH A;  3VT2 A;  3R4Y A;  3WAT A;  4AK6 A;  5GLM A;  3UGG A;  3C7E A;  2YFS A;  3P2N A;  1GYE B;  4N2Z A;  1Y4W A;  3KST A;  3WMZ A;  2OXB A;  3OM2 A;  4AK5 A;  4N2R A;  5ANN A;  3QEF A;  3WPU A;  2B4W A;  2EXH A;  3LIG A;  5A7V A;  5A7V B;  4FFI A;  3UGF A;  4UDI A;  1Y7B A;  5AYE A;  4KMI A;  3AKG A;  1WL7 A;  3C2U A;  3VSS A;  3QEE A;  2AEZ A;  3LDR A;  4UDK A;  5AYC A;  3UGH A;  4COT A;  3LEM A;  2ADE A;  3BYK A;  3LDK A;  2QQU A;  3BYL A;  3QC2 A;  2YFT A;  1VKD A;  5C0P A;  4AK7 A;  3NQH A;  3D5Y A;  3WPV A;  2X8S A;  5B6S A;  5JOY A;  3WPZ A;  3K1U A;  5JOZ A;  3R4Z A;  3AKH A;  4UDK E;  5FLW A;  4PVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...