3WPUA

Full-length beta-fructofuranosidase from microbacterium saccharophilum k-1
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
538
structure length
535
Chain Sequence
GLQDGPEPTIHTQQAYAPEDDFTAKWTRADARQLQRMSDPTAPSRENSMPASVTMPTVPQDFPDMSNEQVWVWDTWPLTDEDANQYSVNGWEIIFSLVADRNLGFDDRHVFAKIGYFYRPAGVPAAERPENGGWTYGGLVFKEGVTGQIFEDQSFSHQTQWGSARVSKNGEIKLFFTDVAFYRNSDGTNIKPYDPRIALSVGKVKANKKGVLTGFNKVTDLLQADGTYYQTGAQNEFFNFRDPFTFEDPAHPGETFMVFEGNSAMQRETATCNEADLGYRQGDPYAETVDDVNASGATYQIGNVGLAKAKNKQLTEWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFVGDGIRSDYQPLNGGSGLALGNPTNLNFLGGQPFAPDFNQHPGHFQAYSHYVMPGGLVQSFIDTIGTHDDFVRGGTLAPTVKMDIGVGGDPTKTAVDYSYGEGLGGWADIPANKHLFTNGKFGVAVSDEAAQKIRKILGSKFDDYLDGKPVSATVRALIEKLLAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-fructofuranosidase
publication title Enhancing thermostability and the structural characterization of Microbacterium saccharophilum K-1 beta-fructofuranosidase
pubmed doi rcsb
source organism Arthrobacter
total genus 155
structure length 535
sequence length 538
chains with identical sequence B
ec nomenclature ec 3.2.1.26: Beta-fructofuranosidase.
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02435 Glyco_hydro_68 Levansucrase/Invertase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3wpuA01
2QQUA 3BYKA 4FFIA 5A7VB 5JOWA 5AYDA 5C0PA 2EXKA 4AK7A 5JOZA 3VSFA 4N2RA 4AK5A 3KF5A 5FMBA 1WL7A 2B4WA 3VT2A 5GLKA 3BYNA 3LIGA 3PIJA 5FK7A 3VT0A 3UGGA 5GLQA 3LF7A 3LDKA 5FMDA 2X8FA 3AKGA 3R4ZA 3D5YA 3OM6A 3D5ZA 3AKHA 5B6TA 2OXBA 3ZXLA 2QQWA 3ZXKA 2XQRA 3QZ4A 2YFSA 4UDJA 3WPUA 3OM4A 4MLGA 5GLPA 4NOVA 3U75A 3ZXJA 3OM2A 3KSTA 3WMYA 1Y9MA 3K1UA 4FFFA 4UDGA 5AY9A 3C7FA 3WN1A 4KC8A 1Y9GA 2QQVA 3C7GA 3UGFA 4UDIA 5A7VA 4ONZA 3VSSA 3WPZA 1VKDA 3NQHA 5GLNA 3RWKX 3CU9A 5FK8A 4KMIA 3LFIA 5GLRA 5A8CA 5FIXA 3WN2A 3P2NA 1YIFA 2EXHA 3VSRA 4N2ZA 5FLWA 5AYEA 3QEDA 2YFRA 5A8DA 4U6DA 4UDKA 3WAUA 4N4BA 1GYEB 2X8SA 4AK6A 2X8TA 3LDRA 1GYDB 3BYLA 1OYGA 2EXJA 4N1IA 4O8OA 5FMCA 1Y7BA 4UDKE 5FKBA 3TAWA 3BYJA 3AKIA 5JOXA 3OM7A 4D47A 3LIHA 1PT2A 4U6BA 3C7OA 4KCBA 3OM5A 2AEYA 3C7HA 5GLMA 3VSZA 3WN0A 3R4YA 5AYCA 2EXIA 5ANNA 3C7EA 2AC1A 3VT1A 3AKFA 1W2TA 3WATA 3KF3A 4KCAA 2ADEA 3QEFA 4COTA 3QC2A 2YFTA 3WPYA 1W18A 3D60A 4FFHA 4KC7A 5GLOA 4EQVA 3QEEA 1Y4WA 5FKCA 1GYHA 3U14A 1YRZA 4PVIA 4FFGA 3UGHA 3D61A 1YI7A 5GLLA 4PVAA 4O8PA 4O8NA 4QQSA 3WPVA 3LEMA 3C2UA 2VDTA 3LV4A 1ST8A 3SC7X 5B6SA 3R67A 3WMZA 3PIGA 2AEZA 5JOYA 1UV4A 2ADDA 3WASA 1UYPA
chains in the Genus database with same CATH superfamily
2QQUA 3BYKA 4FFIA 5A7VB 5JOWA 5AYDA 5C0PA 2EXKA 4AK7A 5JOZA 3VSFA 4N2RA 4AK5A 3KF5A 5FMBA 1WL7A 2B4WA 3VT2A 5GLKA 3BYNA 3LIGA 3PIJA 5FK7A 3VT0A 3UGGA 5GLQA 3LF7A 3LDKA 5FMDA 2X8FA 3AKGA 3R4ZA 3D5YA 3OM6A 3D5ZA 3AKHA 5B6TA 5C2MA 2OXBA 3ZXLA 2QQWA 3ZXKA 2XQRA 3QZ4A 2YFSA 4UDJA 3WPUA 3OM4A 4MLGA 5GLPA 4NOVA 3U75A 3ZXJA 3OM2A 3KSTA 3WMYA 1Y9MA 3K1UA 4FFFA 4UDGA 5AY9A 3C7FA 3WN1A 4KC8A 1Y9GA 2QQVA 3C7GA 3UGFA 4UDIA 5A7VA 4ONZA 3VSSA 3WPZA 1VKDA 3NQHA 5GLNA 3RWKX 3CU9A 5FK8A 4KMIA 3LFIA 5GLRA 5A8CA 5FIXA 3WN2A 3P2NA 1YIFA 2EXHA 3VSRA 4N2ZA 5FLWA 5AYEA 3QEDA 2YFRA 5A8DA 4U6DA 4UDKA 3WAUA 4N4BA 1GYEB 2X8SA 4AK6A 2X8TA 3LDRA 1GYDB 3BYLA 1OYGA 2EXJA 4N1IA 4O8OA 5FMCA 1Y7BA 4UDKE 5FKBA 3TAWA 3BYJA 3AKIA 5JOXA 3OM7A 4D47A 3LIHA 1PT2A 4U6BA 3C7OA 4KCBA 3OM5A 2AEYA 3C7HA 5GLMA 3VSZA 3WN0A 3R4YA 5AYCA 2EXIA 5ANNA 3C7EA 2AC1A 3VT1A 3AKFA 1W2TA 3WATA 3KF3A 4KCAA 2ADEA 3QEFA 4COTA 3QC2A 2YFTA 3WPYA 1W18A 3D60A 4FFHA 4KC7A 1TL2A 5GLOA 4EQVA 3QEEA 1Y4WA 5FKCA 1GYHA 3U14A 1YRZA 4PVIA 4FFGA 3UGHA 3D61A 1YI7A 5GLLA 4PVAA 4O8PA 4O8NA 4QQSA 3WPVA 3LEMA 3C2UA 2VDTA 3LV4A 1ST8A 3SC7X 5B6SA 3R67A 3WMZA 3PIGA 2AEZA 5JOYA 1UV4A 2ADDA 3WASA 1UYPA
chains in the Genus database with same CATH topology
2QQUA 3BYKA 4FFIA 5A7VB 5JOWA 5AYDA 5C0PA 2EXKA 4AK7A 5JOZA 3VSFA 4N2RA 4AK5A 3KF5A 5FMBA 1WL7A 2B4WA 3VT2A 5GLKA 3BYNA 3LIGA 3PIJA 5FK7A 3VT0A 3UGGA 5GLQA 3LF7A 3LDKA 5FMDA 2X8FA 3AKGA 3R4ZA 3D5YA 3OM6A 3D5ZA 3AKHA 5B6TA 2OXBA 3ZXLA 2QQWA 3ZXKA 2XQRA 3QZ4A 2YFSA 4UDJA 3WPUA 3OM4A 4MLGA 5GLPA 4NOVA 3U75A 3ZXJA 3OM2A 3KSTA 3WMYA 1Y9MA 3K1UA 4FFFA 4UDGA 5AY9A 3C7FA 3WN1A 4KC8A 1Y9GA 2QQVA 3C7GA 3UGFA 4UDIA 5A7VA 4ONZA 3VSSA 3WPZA 1VKDA 3NQHA 5GLNA 3RWKX 3CU9A 5FK8A 4KMIA 3LFIA 5GLRA 5A8CA 5FIXA 3WN2A 3P2NA 1YIFA 2EXHA 3VSRA 4N2ZA 5FLWA 5AYEA 3QEDA 2YFRA 5A8DA 4U6DA 4UDKA 3WAUA 4N4BA 1GYEB 2X8SA 4AK6A 2X8TA 3LDRA 1GYDB 3BYLA 1OYGA 2EXJA 4N1IA 4O8OA 5FMCA 1Y7BA 4UDKE 5FKBA 3TAWA 3BYJA 3AKIA 5JOXA 3OM7A 4D47A 3LIHA 1PT2A 4U6BA 3C7OA 4KCBA 3OM5A 2AEYA 3C7HA 5GLMA 3VSZA 3WN0A 3R4YA 5AYCA 2EXIA 5ANNA 3C7EA 2AC1A 3VT1A 3AKFA 1W2TA 3WATA 3KF3A 4KCAA 2ADEA 3QEFA 4COTA 3QC2A 2YFTA 3WPYA 1W18A 3D60A 4FFHA 4KC7A 5GLOA 4EQVA 3QEEA 1Y4WA 5FKCA 1GYHA 3U14A 1YRZA 4PVIA 4FFGA 3UGHA 3D61A 1YI7A 5GLLA 4PVAA 4O8PA 4O8NA 4QQSA 3WPVA 3LEMA 3C2UA 2VDTA 3LV4A 1ST8A 3SC7X 5B6SA 3R67A 3WMZA 3PIGA 2AEZA 5JOYA 1UV4A 2ADDA 3WASA 1UYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQU A;  3BYK A;  4FFI A;  5A7V B;  5JOW A;  5AYD A;  5C0P A;  2EXK A;  4AK7 A;  5JOZ A;  3VSF A;  4N2R A;  4AK5 A;  3KF5 A;  5FMB A;  1WL7 A;  2B4W A;  3VT2 A;  5GLK A;  3BYN A;  3LIG A;  3PIJ A;  5FK7 A;  3VT0 A;  3UGG A;  5GLQ A;  3LF7 A;  3LDK A;  5FMD A;  2X8F A;  3AKG A;  3R4Z A;  3D5Y A;  3OM6 A;  3D5Z A;  3AKH A;  5B6T A;  2OXB A;  3ZXL A;  2QQW A;  3ZXK A;  2XQR A;  3QZ4 A;  2YFS A;  4UDJ A;  3WPU A;  3OM4 A;  4MLG A;  5GLP A;  4NOV A;  3U75 A;  3ZXJ A;  3OM2 A;  3KST A;  3WMY A;  1Y9M A;  3K1U A;  4FFF A;  4UDG A;  5AY9 A;  3C7F A;  3WN1 A;  4KC8 A;  1Y9G A;  2QQV A;  3C7G A;  3UGF A;  4UDI A;  5A7V A;  4ONZ A;  3VSS A;  3WPZ A;  1VKD A;  3NQH A;  5GLN A;  3RWK X;  3CU9 A;  5FK8 A;  4KMI A;  3LFI A;  5GLR A;  5A8C A;  5FIX A;  3WN2 A;  3P2N A;  1YIF A;  2EXH A;  3VSR A;  4N2Z A;  5FLW A;  5AYE A;  3QED A;  2YFR A;  5A8D A;  4U6D A;  4UDK A;  3WAU A;  4N4B A;  1GYE B;  2X8S A;  4AK6 A;  2X8T A;  3LDR A;  1GYD B;  3BYL A;  1OYG A;  2EXJ A;  4N1I A;  4O8O A;  5FMC A;  1Y7B A;  4UDK E;  5FKB A;  3TAW A;  3BYJ A;  3AKI A;  5JOX A;  3OM7 A;  4D47 A;  3LIH A;  1PT2 A;  4U6B A;  3C7O A;  4KCB A;  3OM5 A;  2AEY A;  3C7H A;  5GLM A;  3VSZ A;  3WN0 A;  3R4Y A;  5AYC A;  2EXI A;  5ANN A;  3C7E A;  2AC1 A;  3VT1 A;  3AKF A;  1W2T A;  3WAT A;  3KF3 A;  4KCA A;  2ADE A;  3QEF A;  4COT A;  3QC2 A;  2YFT A;  3WPY A;  1W18 A;  3D60 A;  4FFH A;  4KC7 A;  5GLO A;  4EQV A;  3QEE A;  1Y4W A;  5FKC A;  1GYH A;  3U14 A;  1YRZ A;  4PVI A;  4FFG A;  3UGH A;  3D61 A;  1YI7 A;  5GLL A;  4PVA A;  4O8P A;  4O8N A;  4QQS A;  3WPV A;  3LEM A;  3C2U A;  2VDT A;  3LV4 A;  1ST8 A;  3SC7 X;  5B6S A;  3R67 A;  3WMZ A;  3PIG A;  2AEZ A;  5JOY A;  1UV4 A;  2ADD A;  3WAS A;  1UYP A; 
#chains in the Genus database with same CATH topology
 2QQU A;  3BYK A;  4FFI A;  5A7V B;  5JOW A;  5AYD A;  5C0P A;  2EXK A;  4AK7 A;  5JOZ A;  3VSF A;  4N2R A;  4AK5 A;  3KF5 A;  5FMB A;  1WL7 A;  2B4W A;  3VT2 A;  5GLK A;  3BYN A;  3LIG A;  3PIJ A;  5FK7 A;  3VT0 A;  3UGG A;  5GLQ A;  3LF7 A;  3LDK A;  5FMD A;  2X8F A;  3AKG A;  3R4Z A;  3D5Y A;  3OM6 A;  3D5Z A;  3AKH A;  5B6T A;  5C2M A;  2OXB A;  3ZXL A;  2QQW A;  3ZXK A;  2XQR A;  3QZ4 A;  2YFS A;  4UDJ A;  3WPU A;  3OM4 A;  4MLG A;  5GLP A;  4NOV A;  3U75 A;  3ZXJ A;  3OM2 A;  3KST A;  3WMY A;  1Y9M A;  3K1U A;  4FFF A;  4UDG A;  5AY9 A;  3C7F A;  3WN1 A;  4KC8 A;  1Y9G A;  2QQV A;  3C7G A;  3UGF A;  4UDI A;  5A7V A;  4ONZ A;  3VSS A;  3WPZ A;  1VKD A;  3NQH A;  5GLN A;  3RWK X;  3CU9 A;  5FK8 A;  4KMI A;  3LFI A;  5GLR A;  5A8C A;  5FIX A;  3WN2 A;  3P2N A;  1YIF A;  2EXH A;  3VSR A;  4N2Z A;  5FLW A;  5AYE A;  3QED A;  2YFR A;  5A8D A;  4U6D A;  4UDK A;  3WAU A;  4N4B A;  1GYE B;  2X8S A;  4AK6 A;  2X8T A;  3LDR A;  1GYD B;  3BYL A;  1OYG A;  2EXJ A;  4N1I A;  4O8O A;  5FMC A;  1Y7B A;  4UDK E;  5FKB A;  3TAW A;  3BYJ A;  3AKI A;  5JOX A;  3OM7 A;  4D47 A;  3LIH A;  1PT2 A;  4U6B A;  3C7O A;  4KCB A;  3OM5 A;  2AEY A;  3C7H A;  5GLM A;  3VSZ A;  3WN0 A;  3R4Y A;  5AYC A;  2EXI A;  5ANN A;  3C7E A;  2AC1 A;  3VT1 A;  3AKF A;  1W2T A;  3WAT A;  3KF3 A;  4KCA A;  2ADE A;  3QEF A;  4COT A;  3QC2 A;  2YFT A;  3WPY A;  1W18 A;  3D60 A;  4FFH A;  4KC7 A;  1TL2 A;  5GLO A;  4EQV A;  3QEE A;  1Y4W A;  5FKC A;  1GYH A;  3U14 A;  1YRZ A;  4PVI A;  4FFG A;  3UGH A;  3D61 A;  1YI7 A;  5GLL A;  4PVA A;  4O8P A;  4O8N A;  4QQS A;  3WPV A;  3LEM A;  3C2U A;  2VDT A;  3LV4 A;  1ST8 A;  3SC7 X;  5B6S A;  3R67 A;  3WMZ A;  3PIG A;  2AEZ A;  5JOY A;  1UV4 A;  2ADD A;  3WAS A;  1UYP A; 
#chains in the Genus database with same CATH homology
 2QQU A;  3BYK A;  4FFI A;  5A7V B;  5JOW A;  5AYD A;  5C0P A;  2EXK A;  4AK7 A;  5JOZ A;  3VSF A;  4N2R A;  4AK5 A;  3KF5 A;  5FMB A;  1WL7 A;  2B4W A;  3VT2 A;  5GLK A;  3BYN A;  3LIG A;  3PIJ A;  5FK7 A;  3VT0 A;  3UGG A;  5GLQ A;  3LF7 A;  3LDK A;  5FMD A;  2X8F A;  3AKG A;  3R4Z A;  3D5Y A;  3OM6 A;  3D5Z A;  3AKH A;  5B6T A;  2OXB A;  3ZXL A;  2QQW A;  3ZXK A;  2XQR A;  3QZ4 A;  2YFS A;  4UDJ A;  3WPU A;  3OM4 A;  4MLG A;  5GLP A;  4NOV A;  3U75 A;  3ZXJ A;  3OM2 A;  3KST A;  3WMY A;  1Y9M A;  3K1U A;  4FFF A;  4UDG A;  5AY9 A;  3C7F A;  3WN1 A;  4KC8 A;  1Y9G A;  2QQV A;  3C7G A;  3UGF A;  4UDI A;  5A7V A;  4ONZ A;  3VSS A;  3WPZ A;  1VKD A;  3NQH A;  5GLN A;  3RWK X;  3CU9 A;  5FK8 A;  4KMI A;  3LFI A;  5GLR A;  5A8C A;  5FIX A;  3WN2 A;  3P2N A;  1YIF A;  2EXH A;  3VSR A;  4N2Z A;  5FLW A;  5AYE A;  3QED A;  2YFR A;  5A8D A;  4U6D A;  4UDK A;  3WAU A;  4N4B A;  1GYE B;  2X8S A;  4AK6 A;  2X8T A;  3LDR A;  1GYD B;  3BYL A;  1OYG A;  2EXJ A;  4N1I A;  4O8O A;  5FMC A;  1Y7B A;  4UDK E;  5FKB A;  3TAW A;  3BYJ A;  3AKI A;  5JOX A;  3OM7 A;  4D47 A;  3LIH A;  1PT2 A;  4U6B A;  3C7O A;  4KCB A;  3OM5 A;  2AEY A;  3C7H A;  5GLM A;  3VSZ A;  3WN0 A;  3R4Y A;  5AYC A;  2EXI A;  5ANN A;  3C7E A;  2AC1 A;  3VT1 A;  3AKF A;  1W2T A;  3WAT A;  3KF3 A;  4KCA A;  2ADE A;  3QEF A;  4COT A;  3QC2 A;  2YFT A;  3WPY A;  1W18 A;  3D60 A;  4FFH A;  4KC7 A;  5GLO A;  4EQV A;  3QEE A;  1Y4W A;  5FKC A;  1GYH A;  3U14 A;  1YRZ A;  4PVI A;  4FFG A;  3UGH A;  3D61 A;  1YI7 A;  5GLL A;  4PVA A;  4O8P A;  4O8N A;  4QQS A;  3WPV A;  3LEM A;  3C2U A;  2VDT A;  3LV4 A;  1ST8 A;  3SC7 X;  5B6S A;  3R67 A;  3WMZ A;  3PIG A;  2AEZ A;  5JOY A;  1UV4 A;  2ADD A;  3WAS A;  1UYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...