3WPVA

Microbacterium saccharophilum k-1 beta-fructofuranosidase mutant t47s/f447v/f470y/p500s
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
538
structure length
538
Chain Sequence
LQDGPEPSIHTQQAYAPEDDFTAKWTRADARQLQRMSDPTAPSRENSMPASVTMPTVPQDFPDMSNEQVWVWDTWPLTDEDANQYSVNGWEIIFSLVADRNLGFDDRHVFAKIGYFYRPAGVPAAERPENGGWTYGGLVFKEGVTGQIFEDQSFSHQTQWSGSARVSKNGEIKLFFTDVAFYRNSDGTNIKPYDPRIALSVGKVKANKKGVTLTGFNKVTDLLQADGTYYQTGAQNEFFNFRDPFTFEDPAHPGETFMVFEGNSAMQRETATCNEADLGYRQGDPYAETVDDVNASGATYQIGNVGLAKAKNKQLTEWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFVGDGIRSDYQPLNGGSGLALGNPTNLNFLGGQPFAPDVNQHPGHFQAYSHYVMPGGLVQSYIDTIGTHDDFVRGGTLAPTVKMDIGVGGDSTKTAVDYSYGSEGLGGWADIPANKHLFTNGKFGVAVSDEAAQKIRKILGSKFDDYLDGKPVSATVRALIEKLLAQYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-fructofuranosidase
publication title Enhancing thermostability and the structural characterization of Microbacterium saccharophilum K-1 beta-fructofuranosidase
pubmed doi rcsb
source organism Arthrobacter
total genus 152
structure length 538
sequence length 538
chains with identical sequence B, C
ec nomenclature ec 3.2.1.26: Beta-fructofuranosidase.
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02435 Glyco_hydro_68 Levansucrase/Invertase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3wpvA01
5GLLA 3RWKX 2YFTA 5AY9A 2EXKA 3KF5A 2B4WA 3LIHA 4N2ZA 5JOXA 3AKFA 3WATA 5FIXA 3WPUA 5JOZA 4PVIA 3CU9A 4PVAA 2X8FA 4N1IA 3OM6A 3C7HA 5C0PA 3WASA 1YI7A 2QQUA 3VT0A 2X8SA 3AKHA 4UDKE 3QC2A 5ANNA 1PT2A 2EXJA 1YIFA 3LEMA 5GLOA 4AK5A 3KF3A 3D60A 5JOYA 3LV4A 3QEEA 1Y4WA 3VSRA 3AKIA 3U14A 5GLKA 3C7OA 1YRZA 5FKCA 3C2UA 5FMBA 4N2RA 3BYKA 3BYJA 3LFIA 3K1UA 5FMDA 3OM5A 5A8CA 2AEZA 3WN2A 3WMYA 3QEFA 3PIJA 2XQRA 1W2TA 2AEYA 3LDRA 3OM7A 2YFSA 3WN1A 4FFGA 5FK7A 5FKBA 3TAWA 1UV4A 2QQWA 3C7GA 4MLGA 3OM2A 5A7VB 4ONZA 4O8PA 4AK6A 1VKDA 4UDGA 1GYEB 3QZ4A 3VT2A 1WL7A 3ZXKA 4U6DA 3LIGA 5AYCA 3WPVA 1Y9MA 4KCBA 3OM4A 4N4BA 2OXBA 4O8NA 3C7FA 2ADDA 5AYEA 4O8OA 3R4ZA 2QQVA 5A7VA 3WN0A 2AC1A 3UGHA 2VDTA 4QQSA 4U6BA 4UDKA 3LDKA 3VT1A 5GLRA 5B6TA 5GLMA 5A8DA 3ZXLA 5FLWA 1Y7BA 2X8TA 1UYPA 1GYDB 3VSSA 4FFFA 3D5YA 5GLNA 3BYNA 3R67A 4NOVA 2YFRA 5AYDA 3PIGA 3QEDA 4UDIA 5FMCA 3NQHA 2EXHA 5B6SA 3UGGA 1OYGA 3D61A 3WAUA 5JOWA 3P2NA 4KC7A 3WPZA 5GLPA 3WMZA 3U75A 1Y9GA 3C7EA 3ZXJA 4KC8A 1ST8A 3WPYA 4AK7A 3VSFA 2EXIA 4COTA 1W18A 4KMIA 4UDJA 3VSZA 4KCAA 3LF7A 4D47A 3D5ZA 5GLQA 3KSTA 3R4YA 3SC7X 4FFHA 3UGFA 5FK8A 4EQVA 2ADEA 3AKGA 1GYHA 3BYLA 4FFIA
chains in the Genus database with same CATH superfamily
5GLLA 3RWKX 2YFTA 5AY9A 2EXKA 3KF5A 2B4WA 3LIHA 4N2ZA 5JOXA 3AKFA 3WATA 5FIXA 3WPUA 5JOZA 4PVIA 3CU9A 4PVAA 2X8FA 4N1IA 3OM6A 3C7HA 5C0PA 3WASA 1YI7A 2QQUA 3VT0A 2X8SA 3AKHA 4UDKE 3QC2A 5ANNA 1PT2A 2EXJA 1YIFA 3LEMA 5GLOA 4AK5A 3KF3A 3D60A 5JOYA 3LV4A 3QEEA 1Y4WA 3VSRA 3AKIA 3U14A 5GLKA 3C7OA 1YRZA 5FKCA 3C2UA 5FMBA 4N2RA 3BYKA 3BYJA 3LFIA 3K1UA 5FMDA 3OM5A 5A8CA 2AEZA 3WN2A 3WMYA 3QEFA 3PIJA 2XQRA 1W2TA 2AEYA 3LDRA 3OM7A 2YFSA 3WN1A 4FFGA 5FK7A 5FKBA 3TAWA 1UV4A 2QQWA 3C7GA 4MLGA 3OM2A 5A7VB 4ONZA 4O8PA 4AK6A 1VKDA 4UDGA 1GYEB 3QZ4A 3VT2A 1WL7A 3ZXKA 4U6DA 3LIGA 5AYCA 3WPVA 1Y9MA 4KCBA 3OM4A 4N4BA 2OXBA 4O8NA 3C7FA 2ADDA 5AYEA 4O8OA 3R4ZA 2QQVA 5A7VA 3WN0A 2AC1A 3UGHA 2VDTA 4QQSA 4U6BA 4UDKA 3LDKA 3VT1A 5GLRA 5C2MA 5B6TA 5GLMA 5A8DA 3ZXLA 5FLWA 1Y7BA 2X8TA 1UYPA 1GYDB 3VSSA 4FFFA 3D5YA 5GLNA 3BYNA 3R67A 4NOVA 2YFRA 5AYDA 3PIGA 3QEDA 4UDIA 5FMCA 3NQHA 2EXHA 5B6SA 3UGGA 1OYGA 3D61A 3WAUA 5JOWA 3P2NA 4KC7A 3WPZA 5GLPA 3WMZA 3U75A 1Y9GA 3C7EA 3ZXJA 4KC8A 1ST8A 3WPYA 4AK7A 3VSFA 2EXIA 4COTA 1W18A 4KMIA 4UDJA 3VSZA 4KCAA 3LF7A 4D47A 3D5ZA 5GLQA 3KSTA 3R4YA 3SC7X 4FFHA 3UGFA 5FK8A 4EQVA 2ADEA 3AKGA 1GYHA 3BYLA 1TL2A 4FFIA
chains in the Genus database with same CATH topology
5GLLA 3RWKX 2YFTA 5AY9A 2EXKA 3KF5A 2B4WA 3LIHA 4N2ZA 5JOXA 3AKFA 3WATA 5FIXA 3WPUA 5JOZA 4PVIA 3CU9A 4PVAA 2X8FA 4N1IA 3OM6A 3C7HA 5C0PA 3WASA 1YI7A 2QQUA 3VT0A 2X8SA 3AKHA 4UDKE 3QC2A 5ANNA 1PT2A 2EXJA 1YIFA 3LEMA 5GLOA 4AK5A 3KF3A 3D60A 5JOYA 3LV4A 3QEEA 1Y4WA 3VSRA 3AKIA 3U14A 5GLKA 3C7OA 1YRZA 5FKCA 3C2UA 5FMBA 4N2RA 3BYKA 3BYJA 3LFIA 3K1UA 5FMDA 3OM5A 5A8CA 2AEZA 3WN2A 3WMYA 3QEFA 3PIJA 2XQRA 1W2TA 2AEYA 3LDRA 3OM7A 2YFSA 3WN1A 4FFGA 5FK7A 5FKBA 3TAWA 1UV4A 2QQWA 3C7GA 4MLGA 3OM2A 5A7VB 4ONZA 4O8PA 4AK6A 1VKDA 4UDGA 1GYEB 3QZ4A 3VT2A 1WL7A 3ZXKA 4U6DA 3LIGA 5AYCA 3WPVA 1Y9MA 4KCBA 3OM4A 4N4BA 2OXBA 4O8NA 3C7FA 2ADDA 5AYEA 4O8OA 3R4ZA 2QQVA 5A7VA 3WN0A 2AC1A 3UGHA 2VDTA 4QQSA 4U6BA 4UDKA 3LDKA 3VT1A 5GLRA 5B6TA 5GLMA 5A8DA 3ZXLA 5FLWA 1Y7BA 2X8TA 1UYPA 1GYDB 3VSSA 4FFFA 3D5YA 5GLNA 3BYNA 3R67A 4NOVA 2YFRA 5AYDA 3PIGA 3QEDA 4UDIA 5FMCA 3NQHA 2EXHA 5B6SA 3UGGA 1OYGA 3D61A 3WAUA 5JOWA 3P2NA 4KC7A 3WPZA 5GLPA 3WMZA 3U75A 1Y9GA 3C7EA 3ZXJA 4KC8A 1ST8A 3WPYA 4AK7A 3VSFA 2EXIA 4COTA 1W18A 4KMIA 4UDJA 3VSZA 4KCAA 3LF7A 4D47A 3D5ZA 5GLQA 3KSTA 3R4YA 3SC7X 4FFHA 3UGFA 5FK8A 4EQVA 2ADEA 3AKGA 1GYHA 3BYLA 4FFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GLL A;  3RWK X;  2YFT A;  5AY9 A;  2EXK A;  3KF5 A;  2B4W A;  3LIH A;  4N2Z A;  5JOX A;  3AKF A;  3WAT A;  5FIX A;  3WPU A;  5JOZ A;  4PVI A;  3CU9 A;  4PVA A;  2X8F A;  4N1I A;  3OM6 A;  3C7H A;  5C0P A;  3WAS A;  1YI7 A;  2QQU A;  3VT0 A;  2X8S A;  3AKH A;  4UDK E;  3QC2 A;  5ANN A;  1PT2 A;  2EXJ A;  1YIF A;  3LEM A;  5GLO A;  4AK5 A;  3KF3 A;  3D60 A;  5JOY A;  3LV4 A;  3QEE A;  1Y4W A;  3VSR A;  3AKI A;  3U14 A;  5GLK A;  3C7O A;  1YRZ A;  5FKC A;  3C2U A;  5FMB A;  4N2R A;  3BYK A;  3BYJ A;  3LFI A;  3K1U A;  5FMD A;  3OM5 A;  5A8C A;  2AEZ A;  3WN2 A;  3WMY A;  3QEF A;  3PIJ A;  2XQR A;  1W2T A;  2AEY A;  3LDR A;  3OM7 A;  2YFS A;  3WN1 A;  4FFG A;  5FK7 A;  5FKB A;  3TAW A;  1UV4 A;  2QQW A;  3C7G A;  4MLG A;  3OM2 A;  5A7V B;  4ONZ A;  4O8P A;  4AK6 A;  1VKD A;  4UDG A;  1GYE B;  3QZ4 A;  3VT2 A;  1WL7 A;  3ZXK A;  4U6D A;  3LIG A;  5AYC A;  3WPV A;  1Y9M A;  4KCB A;  3OM4 A;  4N4B A;  2OXB A;  4O8N A;  3C7F A;  2ADD A;  5AYE A;  4O8O A;  3R4Z A;  2QQV A;  5A7V A;  3WN0 A;  2AC1 A;  3UGH A;  2VDT A;  4QQS A;  4U6B A;  4UDK A;  3LDK A;  3VT1 A;  5GLR A;  5B6T A;  5GLM A;  5A8D A;  3ZXL A;  5FLW A;  1Y7B A;  2X8T A;  1UYP A;  1GYD B;  3VSS A;  4FFF A;  3D5Y A;  5GLN A;  3BYN A;  3R67 A;  4NOV A;  2YFR A;  5AYD A;  3PIG A;  3QED A;  4UDI A;  5FMC A;  3NQH A;  2EXH A;  5B6S A;  3UGG A;  1OYG A;  3D61 A;  3WAU A;  5JOW A;  3P2N A;  4KC7 A;  3WPZ A;  5GLP A;  3WMZ A;  3U75 A;  1Y9G A;  3C7E A;  3ZXJ A;  4KC8 A;  1ST8 A;  3WPY A;  4AK7 A;  3VSF A;  2EXI A;  4COT A;  1W18 A;  4KMI A;  4UDJ A;  3VSZ A;  4KCA A;  3LF7 A;  4D47 A;  3D5Z A;  5GLQ A;  3KST A;  3R4Y A;  3SC7 X;  4FFH A;  3UGF A;  5FK8 A;  4EQV A;  2ADE A;  3AKG A;  1GYH A;  3BYL A;  4FFI A; 
#chains in the Genus database with same CATH topology
 5GLL A;  3RWK X;  2YFT A;  5AY9 A;  2EXK A;  3KF5 A;  2B4W A;  3LIH A;  4N2Z A;  5JOX A;  3AKF A;  3WAT A;  5FIX A;  3WPU A;  5JOZ A;  4PVI A;  3CU9 A;  4PVA A;  2X8F A;  4N1I A;  3OM6 A;  3C7H A;  5C0P A;  3WAS A;  1YI7 A;  2QQU A;  3VT0 A;  2X8S A;  3AKH A;  4UDK E;  3QC2 A;  5ANN A;  1PT2 A;  2EXJ A;  1YIF A;  3LEM A;  5GLO A;  4AK5 A;  3KF3 A;  3D60 A;  5JOY A;  3LV4 A;  3QEE A;  1Y4W A;  3VSR A;  3AKI A;  3U14 A;  5GLK A;  3C7O A;  1YRZ A;  5FKC A;  3C2U A;  5FMB A;  4N2R A;  3BYK A;  3BYJ A;  3LFI A;  3K1U A;  5FMD A;  3OM5 A;  5A8C A;  2AEZ A;  3WN2 A;  3WMY A;  3QEF A;  3PIJ A;  2XQR A;  1W2T A;  2AEY A;  3LDR A;  3OM7 A;  2YFS A;  3WN1 A;  4FFG A;  5FK7 A;  5FKB A;  3TAW A;  1UV4 A;  2QQW A;  3C7G A;  4MLG A;  3OM2 A;  5A7V B;  4ONZ A;  4O8P A;  4AK6 A;  1VKD A;  4UDG A;  1GYE B;  3QZ4 A;  3VT2 A;  1WL7 A;  3ZXK A;  4U6D A;  3LIG A;  5AYC A;  3WPV A;  1Y9M A;  4KCB A;  3OM4 A;  4N4B A;  2OXB A;  4O8N A;  3C7F A;  2ADD A;  5AYE A;  4O8O A;  3R4Z A;  2QQV A;  5A7V A;  3WN0 A;  2AC1 A;  3UGH A;  2VDT A;  4QQS A;  4U6B A;  4UDK A;  3LDK A;  3VT1 A;  5GLR A;  5C2M A;  5B6T A;  5GLM A;  5A8D A;  3ZXL A;  5FLW A;  1Y7B A;  2X8T A;  1UYP A;  1GYD B;  3VSS A;  4FFF A;  3D5Y A;  5GLN A;  3BYN A;  3R67 A;  4NOV A;  2YFR A;  5AYD A;  3PIG A;  3QED A;  4UDI A;  5FMC A;  3NQH A;  2EXH A;  5B6S A;  3UGG A;  1OYG A;  3D61 A;  3WAU A;  5JOW A;  3P2N A;  4KC7 A;  3WPZ A;  5GLP A;  3WMZ A;  3U75 A;  1Y9G A;  3C7E A;  3ZXJ A;  4KC8 A;  1ST8 A;  3WPY A;  4AK7 A;  3VSF A;  2EXI A;  4COT A;  1W18 A;  4KMI A;  4UDJ A;  3VSZ A;  4KCA A;  3LF7 A;  4D47 A;  3D5Z A;  5GLQ A;  3KST A;  3R4Y A;  3SC7 X;  4FFH A;  3UGF A;  5FK8 A;  4EQV A;  2ADE A;  3AKG A;  1GYH A;  3BYL A;  1TL2 A;  4FFI A; 
#chains in the Genus database with same CATH homology
 5GLL A;  3RWK X;  2YFT A;  5AY9 A;  2EXK A;  3KF5 A;  2B4W A;  3LIH A;  4N2Z A;  5JOX A;  3AKF A;  3WAT A;  5FIX A;  3WPU A;  5JOZ A;  4PVI A;  3CU9 A;  4PVA A;  2X8F A;  4N1I A;  3OM6 A;  3C7H A;  5C0P A;  3WAS A;  1YI7 A;  2QQU A;  3VT0 A;  2X8S A;  3AKH A;  4UDK E;  3QC2 A;  5ANN A;  1PT2 A;  2EXJ A;  1YIF A;  3LEM A;  5GLO A;  4AK5 A;  3KF3 A;  3D60 A;  5JOY A;  3LV4 A;  3QEE A;  1Y4W A;  3VSR A;  3AKI A;  3U14 A;  5GLK A;  3C7O A;  1YRZ A;  5FKC A;  3C2U A;  5FMB A;  4N2R A;  3BYK A;  3BYJ A;  3LFI A;  3K1U A;  5FMD A;  3OM5 A;  5A8C A;  2AEZ A;  3WN2 A;  3WMY A;  3QEF A;  3PIJ A;  2XQR A;  1W2T A;  2AEY A;  3LDR A;  3OM7 A;  2YFS A;  3WN1 A;  4FFG A;  5FK7 A;  5FKB A;  3TAW A;  1UV4 A;  2QQW A;  3C7G A;  4MLG A;  3OM2 A;  5A7V B;  4ONZ A;  4O8P A;  4AK6 A;  1VKD A;  4UDG A;  1GYE B;  3QZ4 A;  3VT2 A;  1WL7 A;  3ZXK A;  4U6D A;  3LIG A;  5AYC A;  3WPV A;  1Y9M A;  4KCB A;  3OM4 A;  4N4B A;  2OXB A;  4O8N A;  3C7F A;  2ADD A;  5AYE A;  4O8O A;  3R4Z A;  2QQV A;  5A7V A;  3WN0 A;  2AC1 A;  3UGH A;  2VDT A;  4QQS A;  4U6B A;  4UDK A;  3LDK A;  3VT1 A;  5GLR A;  5B6T A;  5GLM A;  5A8D A;  3ZXL A;  5FLW A;  1Y7B A;  2X8T A;  1UYP A;  1GYD B;  3VSS A;  4FFF A;  3D5Y A;  5GLN A;  3BYN A;  3R67 A;  4NOV A;  2YFR A;  5AYD A;  3PIG A;  3QED A;  4UDI A;  5FMC A;  3NQH A;  2EXH A;  5B6S A;  3UGG A;  1OYG A;  3D61 A;  3WAU A;  5JOW A;  3P2N A;  4KC7 A;  3WPZ A;  5GLP A;  3WMZ A;  3U75 A;  1Y9G A;  3C7E A;  3ZXJ A;  4KC8 A;  1ST8 A;  3WPY A;  4AK7 A;  3VSF A;  2EXI A;  4COT A;  1W18 A;  4KMI A;  4UDJ A;  3VSZ A;  4KCA A;  3LF7 A;  4D47 A;  3D5Z A;  5GLQ A;  3KST A;  3R4Y A;  3SC7 X;  4FFH A;  3UGF A;  5FK8 A;  4EQV A;  2ADE A;  3AKG A;  1GYH A;  3BYL A;  4FFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...