3WPYA

Microbacterium saccharophilum k-1 beta-fructofuranosidase mutant t47s/s200t/f447v/p500s
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
538
structure length
538
Chain Sequence
LQDGPEPSIHTQQAYAPEDDFTAKWTRADARQLQRMSDPTAPSRENSMPASVTMPTVPQDFPDMSNEQVWVWDTWPLTDEDANQYSVNGWEIIFSLVADRNLGFDDRHVFAKIGYFYRPAGVPAAERPENGGWTYGGLVFKEGVTGQIFEDQSFSHQTQWTGSARVSKNGEIKLFFTDVAFYRNSDGTNIKPYDPRIALSVGKVKANKKGVTLTGFNKVTDLLQADGTYYQTGAQNEFFNFRDPFTFEDPAHPGETFMVFEGNSAMQRETATCNEADLGYRQGDPYAETVDDVNASGATYQIGNVGLAKAKNKQLTEWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFVGDGIRSDYQPLNGGSGLALGNPTNLNFLGGQPFAPDVNQHPGHFQAYSHYVMPGGLVQSFIDTIGTHDDFVRGGTLAPTVKMDIGVGGDSTKTAVDYSYGSEGLGGWADIPANKHLFTNGKFGVAVSDEAAQKIRKILGSKFDDYLDGKPVSATVRALIEKLLAQYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-fructofuranosidase
publication title Enhancing thermostability and the structural characterization of Microbacterium saccharophilum K-1 beta-fructofuranosidase
pubmed doi rcsb
source organism Arthrobacter
total genus 152
structure length 538
sequence length 538
chains with identical sequence B, C
ec nomenclature ec 3.2.1.26: Beta-fructofuranosidase.
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02435 Glyco_hydro_68 Levansucrase/Invertase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3wpyA01
3R67A 4EQVA 1WL7A 3C7EA 4O8NA 3OM2A 3C7HA 3WN2A 3OM6A 4O8PA 3CU9A 2ADEA 5GLMA 1UV4A 2EXKA 4UDKA 2EXHA 1Y9GA 3LIGA 1OYGA 3LDKA 1UYPA 3U75A 2QQUA 5FK8A 3BYLA 3LFIA 1PT2A 3R4ZA 3WATA 4N1IA 3WPVA 3WPYA 3WPUA 2ADDA 1Y4WA 3WN0A 3U14A 3AKHA 3QZ4A 5FKCA 1W18A 4PVAA 2VDTA 2X8SA 3D5ZA 4NOVA 3OM4A 3QEFA 3VT0A 3C7FA 4FFFA 2X8FA 3VT1A 1YIFA 3D61A 1VKDA 3P2NA 3WASA 5GLOA 3PIGA 3LV4A 3WMZA 4AK7A 2YFRA 5GLQA 3WAUA 5JOYA 3D5YA 4FFHA 1YRZA 5GLKA 4KMIA 5FLWA 3KSTA 3UGGA 5FK7A 1ST8A 3BYKA 2B4WA 4ONZA 4PVIA 4KC7A 4QQSA 1GYEB 2AEYA 4UDIA 3AKGA 5A7VB 3OM5A 4FFIA 5A8CA 4KCAA 4KC8A 4UDKE 4D47A 3VSRA 3VSSA 3BYJA 1W2TA 2X8TA 3C2UA 1GYDB 2EXJA 3UGHA 5FKBA 5AYCA 5FMDA 5A7VA 3K1UA 5AY9A 4UDGA 3QC2A 3SC7X 1GYHA 5FMCA 5JOXA 5GLNA 4U6DA 3QEEA 5ANNA 5AYEA 4FFGA 3VT2A 3QEDA 3OM7A 5AYDA 2XQRA 4N2ZA 3VSFA 3AKFA 4U6BA 3WMYA 3C7OA 3TAWA 4COTA 4N4BA 3ZXJA 5B6TA 3R4YA 2OXBA 3WPZA 2YFTA 3UGFA 3WN1A 2QQVA 2YFSA 4MLGA 3BYNA 3ZXLA 3D60A 3PIJA 3LDRA 3LEMA 5JOWA 3LIHA 5GLPA 5GLRA 5JOZA 1Y9MA 2EXIA 5C0PA 3ZXKA 4N2RA 5GLLA 5FIXA 4KCBA 5B6SA 2AC1A 3C7GA 1Y7BA 2AEZA 2QQWA 4AK5A 3NQHA 4AK6A 3KF3A 4UDJA 5FMBA 3LF7A 3RWKX 4O8OA 5A8DA 3KF5A 3AKIA 1YI7A 3VSZA
chains in the Genus database with same CATH superfamily
3R67A 4EQVA 1WL7A 3C7EA 4O8NA 3OM2A 3C7HA 3WN2A 3OM6A 4O8PA 3CU9A 2ADEA 5GLMA 1UV4A 2EXKA 4UDKA 2EXHA 1Y9GA 3LIGA 1OYGA 3LDKA 1TL2A 1UYPA 5C2MA 3U75A 2QQUA 5FK8A 3BYLA 3LFIA 1PT2A 3R4ZA 3WATA 4N1IA 3WPVA 3WPYA 3WPUA 2ADDA 1Y4WA 3WN0A 3U14A 3AKHA 3QZ4A 5FKCA 1W18A 4PVAA 2VDTA 2X8SA 3D5ZA 4NOVA 3OM4A 3QEFA 3VT0A 3C7FA 4FFFA 2X8FA 3VT1A 1YIFA 3D61A 1VKDA 3P2NA 3WASA 5GLOA 3PIGA 3LV4A 3WMZA 4AK7A 2YFRA 5GLQA 3WAUA 5JOYA 3D5YA 4FFHA 1YRZA 5GLKA 4KMIA 5FLWA 3KSTA 3UGGA 5FK7A 1ST8A 3BYKA 2B4WA 4ONZA 4PVIA 4KC7A 4QQSA 1GYEB 2AEYA 4UDIA 3AKGA 5A7VB 3OM5A 4FFIA 5A8CA 4KCAA 4KC8A 4UDKE 4D47A 3VSRA 3VSSA 3BYJA 1W2TA 2X8TA 3C2UA 1GYDB 2EXJA 3UGHA 5FKBA 5AYCA 5FMDA 5A7VA 3K1UA 5AY9A 4UDGA 3QC2A 3SC7X 1GYHA 5FMCA 5JOXA 5GLNA 4U6DA 3QEEA 5ANNA 5AYEA 4FFGA 3VT2A 3QEDA 3OM7A 5AYDA 2XQRA 4N2ZA 3VSFA 3AKFA 4U6BA 3WMYA 3C7OA 3TAWA 4COTA 4N4BA 3ZXJA 5B6TA 3R4YA 2OXBA 3WPZA 2YFTA 3UGFA 3WN1A 2QQVA 2YFSA 4MLGA 3BYNA 3ZXLA 3D60A 3PIJA 3LDRA 3LEMA 5JOWA 3LIHA 5GLPA 5GLRA 5JOZA 1Y9MA 2EXIA 5C0PA 3ZXKA 4N2RA 5GLLA 5FIXA 4KCBA 5B6SA 2AC1A 3C7GA 1Y7BA 2AEZA 2QQWA 4AK5A 3NQHA 4AK6A 3KF3A 4UDJA 5FMBA 3LF7A 3RWKX 4O8OA 5A8DA 3KF5A 3AKIA 1YI7A 3VSZA
chains in the Genus database with same CATH topology
3R67A 4EQVA 1WL7A 3C7EA 4O8NA 3OM2A 3C7HA 3WN2A 3OM6A 4O8PA 3CU9A 2ADEA 5GLMA 1UV4A 2EXKA 4UDKA 2EXHA 1Y9GA 3LIGA 1OYGA 3LDKA 1UYPA 3U75A 2QQUA 5FK8A 3BYLA 3LFIA 1PT2A 3R4ZA 3WATA 4N1IA 3WPVA 3WPYA 3WPUA 2ADDA 1Y4WA 3WN0A 3U14A 3AKHA 3QZ4A 5FKCA 1W18A 4PVAA 2VDTA 2X8SA 3D5ZA 4NOVA 3OM4A 3QEFA 3VT0A 3C7FA 4FFFA 2X8FA 3VT1A 1YIFA 3D61A 1VKDA 3P2NA 3WASA 5GLOA 3PIGA 3LV4A 3WMZA 4AK7A 2YFRA 5GLQA 3WAUA 5JOYA 3D5YA 4FFHA 1YRZA 5GLKA 4KMIA 5FLWA 3KSTA 3UGGA 5FK7A 1ST8A 3BYKA 2B4WA 4ONZA 4PVIA 4KC7A 4QQSA 1GYEB 2AEYA 4UDIA 3AKGA 5A7VB 3OM5A 4FFIA 5A8CA 4KCAA 4KC8A 4UDKE 4D47A 3VSRA 3VSSA 3BYJA 1W2TA 2X8TA 3C2UA 1GYDB 2EXJA 3UGHA 5FKBA 5AYCA 5FMDA 5A7VA 3K1UA 5AY9A 4UDGA 3QC2A 3SC7X 1GYHA 5FMCA 5JOXA 5GLNA 4U6DA 3QEEA 5ANNA 5AYEA 4FFGA 3VT2A 3QEDA 3OM7A 5AYDA 2XQRA 4N2ZA 3VSFA 3AKFA 4U6BA 3WMYA 3C7OA 3TAWA 4COTA 4N4BA 3ZXJA 5B6TA 3R4YA 2OXBA 3WPZA 2YFTA 3UGFA 3WN1A 2QQVA 2YFSA 4MLGA 3BYNA 3ZXLA 3D60A 3PIJA 3LDRA 3LEMA 5JOWA 3LIHA 5GLPA 5GLRA 5JOZA 1Y9MA 2EXIA 5C0PA 3ZXKA 4N2RA 5GLLA 5FIXA 4KCBA 5B6SA 2AC1A 3C7GA 1Y7BA 2AEZA 2QQWA 4AK5A 3NQHA 4AK6A 3KF3A 4UDJA 5FMBA 3LF7A 3RWKX 4O8OA 5A8DA 3KF5A 3AKIA 1YI7A 3VSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R67 A;  4EQV A;  1WL7 A;  3C7E A;  4O8N A;  3OM2 A;  3C7H A;  3WN2 A;  3OM6 A;  4O8P A;  3CU9 A;  2ADE A;  5GLM A;  1UV4 A;  2EXK A;  4UDK A;  2EXH A;  1Y9G A;  3LIG A;  1OYG A;  3LDK A;  1UYP A;  3U75 A;  2QQU A;  5FK8 A;  3BYL A;  3LFI A;  1PT2 A;  3R4Z A;  3WAT A;  4N1I A;  3WPV A;  3WPY A;  3WPU A;  2ADD A;  1Y4W A;  3WN0 A;  3U14 A;  3AKH A;  3QZ4 A;  5FKC A;  1W18 A;  4PVA A;  2VDT A;  2X8S A;  3D5Z A;  4NOV A;  3OM4 A;  3QEF A;  3VT0 A;  3C7F A;  4FFF A;  2X8F A;  3VT1 A;  1YIF A;  3D61 A;  1VKD A;  3P2N A;  3WAS A;  5GLO A;  3PIG A;  3LV4 A;  3WMZ A;  4AK7 A;  2YFR A;  5GLQ A;  3WAU A;  5JOY A;  3D5Y A;  4FFH A;  1YRZ A;  5GLK A;  4KMI A;  5FLW A;  3KST A;  3UGG A;  5FK7 A;  1ST8 A;  3BYK A;  2B4W A;  4ONZ A;  4PVI A;  4KC7 A;  4QQS A;  1GYE B;  2AEY A;  4UDI A;  3AKG A;  5A7V B;  3OM5 A;  4FFI A;  5A8C A;  4KCA A;  4KC8 A;  4UDK E;  4D47 A;  3VSR A;  3VSS A;  3BYJ A;  1W2T A;  2X8T A;  3C2U A;  1GYD B;  2EXJ A;  3UGH A;  5FKB A;  5AYC A;  5FMD A;  5A7V A;  3K1U A;  5AY9 A;  4UDG A;  3QC2 A;  3SC7 X;  1GYH A;  5FMC A;  5JOX A;  5GLN A;  4U6D A;  3QEE A;  5ANN A;  5AYE A;  4FFG A;  3VT2 A;  3QED A;  3OM7 A;  5AYD A;  2XQR A;  4N2Z A;  3VSF A;  3AKF A;  4U6B A;  3WMY A;  3C7O A;  3TAW A;  4COT A;  4N4B A;  3ZXJ A;  5B6T A;  3R4Y A;  2OXB A;  3WPZ A;  2YFT A;  3UGF A;  3WN1 A;  2QQV A;  2YFS A;  4MLG A;  3BYN A;  3ZXL A;  3D60 A;  3PIJ A;  3LDR A;  3LEM A;  5JOW A;  3LIH A;  5GLP A;  5GLR A;  5JOZ A;  1Y9M A;  2EXI A;  5C0P A;  3ZXK A;  4N2R A;  5GLL A;  5FIX A;  4KCB A;  5B6S A;  2AC1 A;  3C7G A;  1Y7B A;  2AEZ A;  2QQW A;  4AK5 A;  3NQH A;  4AK6 A;  3KF3 A;  4UDJ A;  5FMB A;  3LF7 A;  3RWK X;  4O8O A;  5A8D A;  3KF5 A;  3AKI A;  1YI7 A;  3VSZ A; 
#chains in the Genus database with same CATH topology
 3R67 A;  4EQV A;  1WL7 A;  3C7E A;  4O8N A;  3OM2 A;  3C7H A;  3WN2 A;  3OM6 A;  4O8P A;  3CU9 A;  2ADE A;  5GLM A;  1UV4 A;  2EXK A;  4UDK A;  2EXH A;  1Y9G A;  3LIG A;  1OYG A;  3LDK A;  1TL2 A;  1UYP A;  5C2M A;  3U75 A;  2QQU A;  5FK8 A;  3BYL A;  3LFI A;  1PT2 A;  3R4Z A;  3WAT A;  4N1I A;  3WPV A;  3WPY A;  3WPU A;  2ADD A;  1Y4W A;  3WN0 A;  3U14 A;  3AKH A;  3QZ4 A;  5FKC A;  1W18 A;  4PVA A;  2VDT A;  2X8S A;  3D5Z A;  4NOV A;  3OM4 A;  3QEF A;  3VT0 A;  3C7F A;  4FFF A;  2X8F A;  3VT1 A;  1YIF A;  3D61 A;  1VKD A;  3P2N A;  3WAS A;  5GLO A;  3PIG A;  3LV4 A;  3WMZ A;  4AK7 A;  2YFR A;  5GLQ A;  3WAU A;  5JOY A;  3D5Y A;  4FFH A;  1YRZ A;  5GLK A;  4KMI A;  5FLW A;  3KST A;  3UGG A;  5FK7 A;  1ST8 A;  3BYK A;  2B4W A;  4ONZ A;  4PVI A;  4KC7 A;  4QQS A;  1GYE B;  2AEY A;  4UDI A;  3AKG A;  5A7V B;  3OM5 A;  4FFI A;  5A8C A;  4KCA A;  4KC8 A;  4UDK E;  4D47 A;  3VSR A;  3VSS A;  3BYJ A;  1W2T A;  2X8T A;  3C2U A;  1GYD B;  2EXJ A;  3UGH A;  5FKB A;  5AYC A;  5FMD A;  5A7V A;  3K1U A;  5AY9 A;  4UDG A;  3QC2 A;  3SC7 X;  1GYH A;  5FMC A;  5JOX A;  5GLN A;  4U6D A;  3QEE A;  5ANN A;  5AYE A;  4FFG A;  3VT2 A;  3QED A;  3OM7 A;  5AYD A;  2XQR A;  4N2Z A;  3VSF A;  3AKF A;  4U6B A;  3WMY A;  3C7O A;  3TAW A;  4COT A;  4N4B A;  3ZXJ A;  5B6T A;  3R4Y A;  2OXB A;  3WPZ A;  2YFT A;  3UGF A;  3WN1 A;  2QQV A;  2YFS A;  4MLG A;  3BYN A;  3ZXL A;  3D60 A;  3PIJ A;  3LDR A;  3LEM A;  5JOW A;  3LIH A;  5GLP A;  5GLR A;  5JOZ A;  1Y9M A;  2EXI A;  5C0P A;  3ZXK A;  4N2R A;  5GLL A;  5FIX A;  4KCB A;  5B6S A;  2AC1 A;  3C7G A;  1Y7B A;  2AEZ A;  2QQW A;  4AK5 A;  3NQH A;  4AK6 A;  3KF3 A;  4UDJ A;  5FMB A;  3LF7 A;  3RWK X;  4O8O A;  5A8D A;  3KF5 A;  3AKI A;  1YI7 A;  3VSZ A; 
#chains in the Genus database with same CATH homology
 3R67 A;  4EQV A;  1WL7 A;  3C7E A;  4O8N A;  3OM2 A;  3C7H A;  3WN2 A;  3OM6 A;  4O8P A;  3CU9 A;  2ADE A;  5GLM A;  1UV4 A;  2EXK A;  4UDK A;  2EXH A;  1Y9G A;  3LIG A;  1OYG A;  3LDK A;  1UYP A;  3U75 A;  2QQU A;  5FK8 A;  3BYL A;  3LFI A;  1PT2 A;  3R4Z A;  3WAT A;  4N1I A;  3WPV A;  3WPY A;  3WPU A;  2ADD A;  1Y4W A;  3WN0 A;  3U14 A;  3AKH A;  3QZ4 A;  5FKC A;  1W18 A;  4PVA A;  2VDT A;  2X8S A;  3D5Z A;  4NOV A;  3OM4 A;  3QEF A;  3VT0 A;  3C7F A;  4FFF A;  2X8F A;  3VT1 A;  1YIF A;  3D61 A;  1VKD A;  3P2N A;  3WAS A;  5GLO A;  3PIG A;  3LV4 A;  3WMZ A;  4AK7 A;  2YFR A;  5GLQ A;  3WAU A;  5JOY A;  3D5Y A;  4FFH A;  1YRZ A;  5GLK A;  4KMI A;  5FLW A;  3KST A;  3UGG A;  5FK7 A;  1ST8 A;  3BYK A;  2B4W A;  4ONZ A;  4PVI A;  4KC7 A;  4QQS A;  1GYE B;  2AEY A;  4UDI A;  3AKG A;  5A7V B;  3OM5 A;  4FFI A;  5A8C A;  4KCA A;  4KC8 A;  4UDK E;  4D47 A;  3VSR A;  3VSS A;  3BYJ A;  1W2T A;  2X8T A;  3C2U A;  1GYD B;  2EXJ A;  3UGH A;  5FKB A;  5AYC A;  5FMD A;  5A7V A;  3K1U A;  5AY9 A;  4UDG A;  3QC2 A;  3SC7 X;  1GYH A;  5FMC A;  5JOX A;  5GLN A;  4U6D A;  3QEE A;  5ANN A;  5AYE A;  4FFG A;  3VT2 A;  3QED A;  3OM7 A;  5AYD A;  2XQR A;  4N2Z A;  3VSF A;  3AKF A;  4U6B A;  3WMY A;  3C7O A;  3TAW A;  4COT A;  4N4B A;  3ZXJ A;  5B6T A;  3R4Y A;  2OXB A;  3WPZ A;  2YFT A;  3UGF A;  3WN1 A;  2QQV A;  2YFS A;  4MLG A;  3BYN A;  3ZXL A;  3D60 A;  3PIJ A;  3LDR A;  3LEM A;  5JOW A;  3LIH A;  5GLP A;  5GLR A;  5JOZ A;  1Y9M A;  2EXI A;  5C0P A;  3ZXK A;  4N2R A;  5GLL A;  5FIX A;  4KCB A;  5B6S A;  2AC1 A;  3C7G A;  1Y7B A;  2AEZ A;  2QQW A;  4AK5 A;  3NQH A;  4AK6 A;  3KF3 A;  4UDJ A;  5FMB A;  3LF7 A;  3RWK X;  4O8O A;  5A8D A;  3KF5 A;  3AKI A;  1YI7 A;  3VSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...