3WPZA

Microbacterium saccharophilum k-1 beta-fructofuranosidase mutant t47s/s200t/f447p/f470y/p500s
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
538
structure length
538
Chain Sequence
LQDGPEPSIHTQQAYAPEDDFTAKWTRADARQLQRMSDPTAPSRENSMPASVTMPTVPQDFPDMSNEQVWVWDTWPLTDEDANQYSVNGWEIIFSLVADRNLGFDDRHVFAKIGYFYRPAGVPAAERPENGGWTYGGLVFKEGVTGQIFEDQSFSHQTQWTGSARVSKNGEIKLFFTDVAFYRNSDGTNIKPYDPRIALSVGKVKANKKGVTLTGFNKVTDLLQADGTYYQTGAQNEFFNFRDPFTFEDPAHPGETFMVFEGNSAMQRETATCNEADLGYRQGDPYAETVDDVNASGATYQIGNVGLAKAKNKQLTEWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFVGDGIRSDYQPLNGGSGLALGNPTNLNFLGGQPFAPDPNQHPGHFQAYSHYVMPGGLVQSYIDTIGTHDDFVRGGTLAPTVKMDIGVGGDSTKTAVDYSYGSEGLGGWADIPANKHLFTNGKFGVAVSDEAAQKIRKILGSKFDDYLDGKPVSATVRALIEKLLAQYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-fructofuranosidase
publication title Enhancing thermostability and the structural characterization of Microbacterium saccharophilum K-1 beta-fructofuranosidase
pubmed doi rcsb
source organism Arthrobacter
total genus 151
structure length 538
sequence length 538
chains with identical sequence B, C
ec nomenclature ec 3.2.1.26: Beta-fructofuranosidase.
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02435 Glyco_hydro_68 Levansucrase/Invertase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3wpzA01
3LIGA 5FMDA 1YI7A 5GLLA 3WAUA 1OYGA 1YRZA 3R4YA 5ANNA 3AKGA 3WMZA 3WPYA 1GYDB 3R4ZA 4FFFA 2OXBA 2QQUA 3PIJA 4FFGA 5FMCA 3WPZA 5JOZA 1W18A 5A8DA 2ADDA 5FMBA 2X8TA 4UDKE 3SC7X 5JOWA 3UGFA 4D47A 3RWKX 3WN1A 3C7EA 2YFTA 4N4BA 3TAWA 4UDKA 2AEYA 2X8SA 1Y9GA 2B4WA 5A7VB 1GYHA 3D5YA 3K1UA 4UDIA 2EXHA 3WPVA 3VT1A 3LEMA 3QC2A 1YIFA 3OM5A 5JOXA 5GLKA 3OM7A 2AC1A 5GLOA 4KCAA 3WN0A 5AY9A 5GLMA 3BYJA 3LV4A 3ZXLA 4NOVA 5FKCA 5FLWA 5FK8A 4O8NA 3U75A 2EXJA 4O8OA 3WMYA 3LDKA 3BYNA 3ZXKA 5B6TA 3PIGA 4N2ZA 3KSTA 3QEDA 5AYEA 2YFSA 3LF7A 5FKBA 4KC8A 3LFIA 3C7GA 5C0PA 4O8PA 1PT2A 2VDTA 1Y7BA 3AKHA 3OM6A 3C2UA 2QQVA 3VSRA 4U6DA 4U6BA 3WASA 2AEZA 3C7FA 3QZ4A 3R67A 4KMIA 3BYLA 3C7OA 2ADEA 4KCBA 1WL7A 4N2RA 3VSFA 3KF5A 3KF3A 4FFIA 4UDJA 5GLPA 1W2TA 3NQHA 3CU9A 5AYDA 3AKIA 5GLRA 3WPUA 1ST8A 3QEEA 3LIHA 5GLNA 3WATA 3ZXJA 5JOYA 4AK7A 3OM4A 4AK5A 3WN2A 5A8CA 3VSZA 3AKFA 3LDRA 3UGHA 4QQSA 3U14A 4AK6A 3D5ZA 4UDGA 4EQVA 4N1IA 1Y4WA 3P2NA 3QEFA 2XQRA 4KC7A 5GLQA 1UYPA 1UV4A 3OM2A 3VT2A 2X8FA 5B6SA 3D60A 2YFRA 3BYKA 5A7VA 1GYEB 4COTA 5FIXA 3VT0A 2EXKA 3D61A 2EXIA 4MLGA 3C7HA 4PVIA 4ONZA 3UGGA 5FK7A 4FFHA 1VKDA 5AYCA 3VSSA 4PVAA 1Y9MA 2QQWA
chains in the Genus database with same CATH superfamily
3LIGA 5FMDA 1YI7A 5GLLA 3WAUA 1OYGA 1YRZA 3R4YA 5ANNA 3AKGA 3WMZA 3WPYA 1GYDB 3R4ZA 4FFFA 2OXBA 2QQUA 3PIJA 4FFGA 5FMCA 3WPZA 5JOZA 1W18A 5A8DA 2ADDA 5FMBA 2X8TA 4UDKE 3SC7X 5JOWA 3UGFA 4D47A 3RWKX 3WN1A 3C7EA 2YFTA 4N4BA 3TAWA 4UDKA 2AEYA 2X8SA 1Y9GA 2B4WA 5A7VB 1GYHA 3D5YA 3K1UA 4UDIA 2EXHA 3WPVA 3VT1A 3LEMA 3QC2A 1YIFA 3OM5A 5JOXA 5GLKA 3OM7A 2AC1A 5GLOA 4KCAA 3WN0A 5AY9A 5GLMA 3BYJA 3LV4A 3ZXLA 4NOVA 5FKCA 5FLWA 5FK8A 4O8NA 3U75A 5C2MA 2EXJA 4O8OA 3WMYA 3LDKA 3BYNA 3ZXKA 5B6TA 3PIGA 4N2ZA 3KSTA 3QEDA 5AYEA 2YFSA 3LF7A 5FKBA 4KC8A 3LFIA 3C7GA 5C0PA 4O8PA 1PT2A 2VDTA 1Y7BA 3AKHA 3OM6A 3C2UA 2QQVA 3VSRA 4U6DA 4U6BA 3WASA 2AEZA 3C7FA 3QZ4A 3R67A 4KMIA 3BYLA 3C7OA 2ADEA 4KCBA 1WL7A 4N2RA 3VSFA 3KF5A 3KF3A 4FFIA 4UDJA 5GLPA 1W2TA 3NQHA 3CU9A 5AYDA 3AKIA 5GLRA 3WPUA 1ST8A 3QEEA 3LIHA 5GLNA 3WATA 3ZXJA 5JOYA 4AK7A 3OM4A 4AK5A 3WN2A 5A8CA 3VSZA 3AKFA 3LDRA 3UGHA 4QQSA 3U14A 4AK6A 3D5ZA 4UDGA 4EQVA 4N1IA 1Y4WA 3P2NA 3QEFA 2XQRA 4KC7A 5GLQA 1UYPA 1UV4A 3OM2A 3VT2A 2X8FA 5B6SA 3D60A 2YFRA 3BYKA 5A7VA 1GYEB 4COTA 5FIXA 3VT0A 2EXKA 3D61A 2EXIA 4MLGA 3C7HA 4PVIA 4ONZA 3UGGA 5FK7A 4FFHA 1VKDA 5AYCA 3VSSA 4PVAA 1TL2A 1Y9MA 2QQWA
chains in the Genus database with same CATH topology
3LIGA 5FMDA 1YI7A 5GLLA 3WAUA 1OYGA 1YRZA 3R4YA 5ANNA 3AKGA 3WMZA 3WPYA 1GYDB 3R4ZA 4FFFA 2OXBA 2QQUA 3PIJA 4FFGA 5FMCA 3WPZA 5JOZA 1W18A 5A8DA 2ADDA 5FMBA 2X8TA 4UDKE 3SC7X 5JOWA 3UGFA 4D47A 3RWKX 3WN1A 3C7EA 2YFTA 4N4BA 3TAWA 4UDKA 2AEYA 2X8SA 1Y9GA 2B4WA 5A7VB 1GYHA 3D5YA 3K1UA 4UDIA 2EXHA 3WPVA 3VT1A 3LEMA 3QC2A 1YIFA 3OM5A 5JOXA 5GLKA 3OM7A 2AC1A 5GLOA 4KCAA 3WN0A 5AY9A 5GLMA 3BYJA 3LV4A 3ZXLA 4NOVA 5FKCA 5FLWA 5FK8A 4O8NA 3U75A 2EXJA 4O8OA 3WMYA 3LDKA 3BYNA 3ZXKA 5B6TA 3PIGA 4N2ZA 3KSTA 3QEDA 5AYEA 2YFSA 3LF7A 5FKBA 4KC8A 3LFIA 3C7GA 5C0PA 4O8PA 1PT2A 2VDTA 1Y7BA 3AKHA 3OM6A 3C2UA 2QQVA 3VSRA 4U6DA 4U6BA 3WASA 2AEZA 3C7FA 3QZ4A 3R67A 4KMIA 3BYLA 3C7OA 2ADEA 4KCBA 1WL7A 4N2RA 3VSFA 3KF5A 3KF3A 4FFIA 4UDJA 5GLPA 1W2TA 3NQHA 3CU9A 5AYDA 3AKIA 5GLRA 3WPUA 1ST8A 3QEEA 3LIHA 5GLNA 3WATA 3ZXJA 5JOYA 4AK7A 3OM4A 4AK5A 3WN2A 5A8CA 3VSZA 3AKFA 3LDRA 3UGHA 4QQSA 3U14A 4AK6A 3D5ZA 4UDGA 4EQVA 4N1IA 1Y4WA 3P2NA 3QEFA 2XQRA 4KC7A 5GLQA 1UYPA 1UV4A 3OM2A 3VT2A 2X8FA 5B6SA 3D60A 2YFRA 3BYKA 5A7VA 1GYEB 4COTA 5FIXA 3VT0A 2EXKA 3D61A 2EXIA 4MLGA 3C7HA 4PVIA 4ONZA 3UGGA 5FK7A 4FFHA 1VKDA 5AYCA 3VSSA 4PVAA 1Y9MA 2QQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIG A;  5FMD A;  1YI7 A;  5GLL A;  3WAU A;  1OYG A;  1YRZ A;  3R4Y A;  5ANN A;  3AKG A;  3WMZ A;  3WPY A;  1GYD B;  3R4Z A;  4FFF A;  2OXB A;  2QQU A;  3PIJ A;  4FFG A;  5FMC A;  3WPZ A;  5JOZ A;  1W18 A;  5A8D A;  2ADD A;  5FMB A;  2X8T A;  4UDK E;  3SC7 X;  5JOW A;  3UGF A;  4D47 A;  3RWK X;  3WN1 A;  3C7E A;  2YFT A;  4N4B A;  3TAW A;  4UDK A;  2AEY A;  2X8S A;  1Y9G A;  2B4W A;  5A7V B;  1GYH A;  3D5Y A;  3K1U A;  4UDI A;  2EXH A;  3WPV A;  3VT1 A;  3LEM A;  3QC2 A;  1YIF A;  3OM5 A;  5JOX A;  5GLK A;  3OM7 A;  2AC1 A;  5GLO A;  4KCA A;  3WN0 A;  5AY9 A;  5GLM A;  3BYJ A;  3LV4 A;  3ZXL A;  4NOV A;  5FKC A;  5FLW A;  5FK8 A;  4O8N A;  3U75 A;  2EXJ A;  4O8O A;  3WMY A;  3LDK A;  3BYN A;  3ZXK A;  5B6T A;  3PIG A;  4N2Z A;  3KST A;  3QED A;  5AYE A;  2YFS A;  3LF7 A;  5FKB A;  4KC8 A;  3LFI A;  3C7G A;  5C0P A;  4O8P A;  1PT2 A;  2VDT A;  1Y7B A;  3AKH A;  3OM6 A;  3C2U A;  2QQV A;  3VSR A;  4U6D A;  4U6B A;  3WAS A;  2AEZ A;  3C7F A;  3QZ4 A;  3R67 A;  4KMI A;  3BYL A;  3C7O A;  2ADE A;  4KCB A;  1WL7 A;  4N2R A;  3VSF A;  3KF5 A;  3KF3 A;  4FFI A;  4UDJ A;  5GLP A;  1W2T A;  3NQH A;  3CU9 A;  5AYD A;  3AKI A;  5GLR A;  3WPU A;  1ST8 A;  3QEE A;  3LIH A;  5GLN A;  3WAT A;  3ZXJ A;  5JOY A;  4AK7 A;  3OM4 A;  4AK5 A;  3WN2 A;  5A8C A;  3VSZ A;  3AKF A;  3LDR A;  3UGH A;  4QQS A;  3U14 A;  4AK6 A;  3D5Z A;  4UDG A;  4EQV A;  4N1I A;  1Y4W A;  3P2N A;  3QEF A;  2XQR A;  4KC7 A;  5GLQ A;  1UYP A;  1UV4 A;  3OM2 A;  3VT2 A;  2X8F A;  5B6S A;  3D60 A;  2YFR A;  3BYK A;  5A7V A;  1GYE B;  4COT A;  5FIX A;  3VT0 A;  2EXK A;  3D61 A;  2EXI A;  4MLG A;  3C7H A;  4PVI A;  4ONZ A;  3UGG A;  5FK7 A;  4FFH A;  1VKD A;  5AYC A;  3VSS A;  4PVA A;  1Y9M A;  2QQW A; 
#chains in the Genus database with same CATH topology
 3LIG A;  5FMD A;  1YI7 A;  5GLL A;  3WAU A;  1OYG A;  1YRZ A;  3R4Y A;  5ANN A;  3AKG A;  3WMZ A;  3WPY A;  1GYD B;  3R4Z A;  4FFF A;  2OXB A;  2QQU A;  3PIJ A;  4FFG A;  5FMC A;  3WPZ A;  5JOZ A;  1W18 A;  5A8D A;  2ADD A;  5FMB A;  2X8T A;  4UDK E;  3SC7 X;  5JOW A;  3UGF A;  4D47 A;  3RWK X;  3WN1 A;  3C7E A;  2YFT A;  4N4B A;  3TAW A;  4UDK A;  2AEY A;  2X8S A;  1Y9G A;  2B4W A;  5A7V B;  1GYH A;  3D5Y A;  3K1U A;  4UDI A;  2EXH A;  3WPV A;  3VT1 A;  3LEM A;  3QC2 A;  1YIF A;  3OM5 A;  5JOX A;  5GLK A;  3OM7 A;  2AC1 A;  5GLO A;  4KCA A;  3WN0 A;  5AY9 A;  5GLM A;  3BYJ A;  3LV4 A;  3ZXL A;  4NOV A;  5FKC A;  5FLW A;  5FK8 A;  4O8N A;  3U75 A;  5C2M A;  2EXJ A;  4O8O A;  3WMY A;  3LDK A;  3BYN A;  3ZXK A;  5B6T A;  3PIG A;  4N2Z A;  3KST A;  3QED A;  5AYE A;  2YFS A;  3LF7 A;  5FKB A;  4KC8 A;  3LFI A;  3C7G A;  5C0P A;  4O8P A;  1PT2 A;  2VDT A;  1Y7B A;  3AKH A;  3OM6 A;  3C2U A;  2QQV A;  3VSR A;  4U6D A;  4U6B A;  3WAS A;  2AEZ A;  3C7F A;  3QZ4 A;  3R67 A;  4KMI A;  3BYL A;  3C7O A;  2ADE A;  4KCB A;  1WL7 A;  4N2R A;  3VSF A;  3KF5 A;  3KF3 A;  4FFI A;  4UDJ A;  5GLP A;  1W2T A;  3NQH A;  3CU9 A;  5AYD A;  3AKI A;  5GLR A;  3WPU A;  1ST8 A;  3QEE A;  3LIH A;  5GLN A;  3WAT A;  3ZXJ A;  5JOY A;  4AK7 A;  3OM4 A;  4AK5 A;  3WN2 A;  5A8C A;  3VSZ A;  3AKF A;  3LDR A;  3UGH A;  4QQS A;  3U14 A;  4AK6 A;  3D5Z A;  4UDG A;  4EQV A;  4N1I A;  1Y4W A;  3P2N A;  3QEF A;  2XQR A;  4KC7 A;  5GLQ A;  1UYP A;  1UV4 A;  3OM2 A;  3VT2 A;  2X8F A;  5B6S A;  3D60 A;  2YFR A;  3BYK A;  5A7V A;  1GYE B;  4COT A;  5FIX A;  3VT0 A;  2EXK A;  3D61 A;  2EXI A;  4MLG A;  3C7H A;  4PVI A;  4ONZ A;  3UGG A;  5FK7 A;  4FFH A;  1VKD A;  5AYC A;  3VSS A;  4PVA A;  1TL2 A;  1Y9M A;  2QQW A; 
#chains in the Genus database with same CATH homology
 3LIG A;  5FMD A;  1YI7 A;  5GLL A;  3WAU A;  1OYG A;  1YRZ A;  3R4Y A;  5ANN A;  3AKG A;  3WMZ A;  3WPY A;  1GYD B;  3R4Z A;  4FFF A;  2OXB A;  2QQU A;  3PIJ A;  4FFG A;  5FMC A;  3WPZ A;  5JOZ A;  1W18 A;  5A8D A;  2ADD A;  5FMB A;  2X8T A;  4UDK E;  3SC7 X;  5JOW A;  3UGF A;  4D47 A;  3RWK X;  3WN1 A;  3C7E A;  2YFT A;  4N4B A;  3TAW A;  4UDK A;  2AEY A;  2X8S A;  1Y9G A;  2B4W A;  5A7V B;  1GYH A;  3D5Y A;  3K1U A;  4UDI A;  2EXH A;  3WPV A;  3VT1 A;  3LEM A;  3QC2 A;  1YIF A;  3OM5 A;  5JOX A;  5GLK A;  3OM7 A;  2AC1 A;  5GLO A;  4KCA A;  3WN0 A;  5AY9 A;  5GLM A;  3BYJ A;  3LV4 A;  3ZXL A;  4NOV A;  5FKC A;  5FLW A;  5FK8 A;  4O8N A;  3U75 A;  2EXJ A;  4O8O A;  3WMY A;  3LDK A;  3BYN A;  3ZXK A;  5B6T A;  3PIG A;  4N2Z A;  3KST A;  3QED A;  5AYE A;  2YFS A;  3LF7 A;  5FKB A;  4KC8 A;  3LFI A;  3C7G A;  5C0P A;  4O8P A;  1PT2 A;  2VDT A;  1Y7B A;  3AKH A;  3OM6 A;  3C2U A;  2QQV A;  3VSR A;  4U6D A;  4U6B A;  3WAS A;  2AEZ A;  3C7F A;  3QZ4 A;  3R67 A;  4KMI A;  3BYL A;  3C7O A;  2ADE A;  4KCB A;  1WL7 A;  4N2R A;  3VSF A;  3KF5 A;  3KF3 A;  4FFI A;  4UDJ A;  5GLP A;  1W2T A;  3NQH A;  3CU9 A;  5AYD A;  3AKI A;  5GLR A;  3WPU A;  1ST8 A;  3QEE A;  3LIH A;  5GLN A;  3WAT A;  3ZXJ A;  5JOY A;  4AK7 A;  3OM4 A;  4AK5 A;  3WN2 A;  5A8C A;  3VSZ A;  3AKF A;  3LDR A;  3UGH A;  4QQS A;  3U14 A;  4AK6 A;  3D5Z A;  4UDG A;  4EQV A;  4N1I A;  1Y4W A;  3P2N A;  3QEF A;  2XQR A;  4KC7 A;  5GLQ A;  1UYP A;  1UV4 A;  3OM2 A;  3VT2 A;  2X8F A;  5B6S A;  3D60 A;  2YFR A;  3BYK A;  5A7V A;  1GYE B;  4COT A;  5FIX A;  3VT0 A;  2EXK A;  3D61 A;  2EXI A;  4MLG A;  3C7H A;  4PVI A;  4ONZ A;  3UGG A;  5FK7 A;  4FFH A;  1VKD A;  5AYC A;  3VSS A;  4PVA A;  1Y9M A;  2QQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...