4AK5A

Native crystal structure of bpgh117
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
370
structure length
370
Chain Sequence
NYDERKADSLGIPKGNKLSAAMKRAMKWENHDNKWFFEYKMEPLKGDLAYEEGVVRRDPSAMLKIGDTYYVWYSKSYGPTQGFAGDIEKDKVFPWDRCDIWYATSKDGLTWKEQGIAVKRGEKGAYDDRSVFTPEVMEWKGKYYLCYQAVKSPYTVRVKNTIGMACADSPEGLWTKTDKPVLEPSDTGEWEGDEDNRFKVVSKGDFDSHKVHDPCIIPYNGKFYMYYKGERMGEEITWGGREIKHGVAIAENPMGPYVKSEYNPISNSGHEVCVWPYKGGIASLITTDGPEKNTLQWSPDGINFEIMSVVKGAPHAIGLNRSADAEKEPTEILRWGLTHIYNSSDYQSIMRFSTWTLQTHTAKGESKERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ANHYDRO-ALPHA-L-GALACTOSIDASE
publication title Analysis of Keystone Enzyme in Agar Hydrolysis Provides Insight Into the Degradation (of a Polysaccharide from) Red Seaweeds.
pubmed doi rcsb
source organism Bacteroides plebeius
total genus 95
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 4ak5A00
1Y7BA 3K1UA 4U6BA 3D5ZA 4N2RA 2EXHA 1YIFA 3C7EA 4U6DA 3WPVA 3UGGA 5B6SA 5A8CA 3LIGA 3BYKA 2X8FA 4O8OA 3ZXKA 5A8DA 3ZXLA 4KCAA 1VKDA 4D47A 3LIHA 2ADEA 3KSTA 3QEEA 5JOZA 4KC8A 3VT1A 5FKBA 4KCBA 3SC7X 5FMDA 4EQVA 1YI7A 3C7GA 3LV4A 2EXJA 3LDRA 5FK7A 3TAWA 5A7VB 2X8SA 5GLOA 2EXIA 5GLNA 3WMYA 5C0PA 4FFGA 1GYDB 3WMZA 5GLMA 4AK6A 1Y4WA 3BYLA 5JOXA 4MLGA 3PIGA 4PVAA 4NOVA 3WPZA 3WN0A 4AK5A 1Y9GA 3VSRA 4AK7A 2AC1A 4PVIA 4UDJA 2ADDA 4QQSA 3WPYA 3U14A 3RWKX 1GYHA 3C7OA 3OM5A 3R4ZA 1W2TA 2YFRA 3WATA 3QC2A 5FIXA 3VSSA 1YRZA 3AKIA 3AKFA 3VT0A 4UDKE 3WN2A 3D61A 2EXKA 5A7VA 3VT2A 3LF7A 1GYEB 4UDKA 3VSFA 3C2UA 5AYDA 5AY9A 2QQWA 5FMBA 1UV4A 3OM4A 2B4WA 3R67A 4COTA 1UYPA 5GLLA 4UDGA 5GLKA 2OXBA 4N1IA 5GLQA 3OM6A 5AYEA 3AKHA 5GLRA 4N2ZA 5JOWA 3OM2A 3R4YA 3P2NA 2X8TA 1ST8A 3LEMA 1OYGA 1PT2A 3OM7A 3CU9A 4O8NA 3KF3A 5FKCA 2YFSA 3U75A 2QQVA 4O8PA 1WL7A 3QEDA 3NQHA 2XQRA 4KC7A 5FMCA 3UGHA 2AEYA 3PIJA 3C7HA 3QEFA 4N4BA 3BYNA 3KF5A 3D5YA 5B6TA 4FFIA 4UDIA 3LDKA 3QZ4A 5JOYA 3WAUA 3LFIA 3WPUA 2YFTA 4FFFA 3WN1A 3BYJA 4KMIA 5ANNA 5FLWA 3VSZA 2AEZA 2QQUA 3ZXJA 1Y9MA 5GLPA 4ONZA 3C7FA 3D60A 5FK8A 4FFHA 3WASA 1W18A 3AKGA 5AYCA 2VDTA 3UGFA
chains in the Genus database with same CATH superfamily
1Y7BA 3K1UA 4U6BA 3D5ZA 4N2RA 2EXHA 1YIFA 3C7EA 4U6DA 3WPVA 3UGGA 5B6SA 5A8CA 3LIGA 3BYKA 2X8FA 4O8OA 3ZXKA 5A8DA 1TL2A 3ZXLA 4KCAA 1VKDA 4D47A 3LIHA 2ADEA 3KSTA 3QEEA 5JOZA 4KC8A 3VT1A 5FKBA 4KCBA 3SC7X 5FMDA 4EQVA 1YI7A 3C7GA 3LV4A 2EXJA 3LDRA 5FK7A 3TAWA 5A7VB 2X8SA 5GLOA 2EXIA 5GLNA 3WMYA 5C0PA 4FFGA 1GYDB 3WMZA 5GLMA 4AK6A 1Y4WA 3BYLA 5JOXA 4MLGA 3PIGA 4PVAA 4NOVA 3WPZA 3WN0A 4AK5A 1Y9GA 3VSRA 4AK7A 2AC1A 4PVIA 4UDJA 2ADDA 4QQSA 3WPYA 3U14A 5C2MA 3RWKX 1GYHA 3C7OA 3OM5A 3R4ZA 1W2TA 2YFRA 3WATA 3QC2A 5FIXA 3VSSA 1YRZA 3AKIA 3AKFA 3VT0A 4UDKE 3WN2A 3D61A 2EXKA 5A7VA 3VT2A 3LF7A 1GYEB 4UDKA 3VSFA 3C2UA 5AYDA 5AY9A 2QQWA 5FMBA 1UV4A 3OM4A 2B4WA 3R67A 4COTA 1UYPA 5GLLA 4UDGA 5GLKA 2OXBA 4N1IA 5GLQA 3OM6A 5AYEA 3AKHA 5GLRA 4N2ZA 5JOWA 3OM2A 3R4YA 3P2NA 2X8TA 1ST8A 3LEMA 1OYGA 1PT2A 3OM7A 3CU9A 4O8NA 3KF3A 5FKCA 2YFSA 3U75A 2QQVA 4O8PA 1WL7A 3QEDA 3NQHA 2XQRA 4KC7A 5FMCA 3UGHA 2AEYA 3PIJA 3C7HA 3QEFA 4N4BA 3BYNA 3KF5A 3D5YA 5B6TA 4FFIA 4UDIA 3LDKA 3QZ4A 5JOYA 3WAUA 3LFIA 3WPUA 2YFTA 4FFFA 3WN1A 3BYJA 4KMIA 5ANNA 5FLWA 3VSZA 2AEZA 2QQUA 3ZXJA 1Y9MA 5GLPA 4ONZA 3C7FA 3D60A 5FK8A 4FFHA 3WASA 1W18A 3AKGA 5AYCA 2VDTA 3UGFA
chains in the Genus database with same CATH topology
1Y7BA 3K1UA 4U6BA 3D5ZA 4N2RA 2EXHA 1YIFA 3C7EA 4U6DA 3WPVA 3UGGA 5B6SA 5A8CA 3LIGA 3BYKA 2X8FA 4O8OA 3ZXKA 5A8DA 3ZXLA 4KCAA 1VKDA 4D47A 3LIHA 2ADEA 3KSTA 3QEEA 5JOZA 4KC8A 3VT1A 5FKBA 4KCBA 3SC7X 5FMDA 4EQVA 1YI7A 3C7GA 3LV4A 2EXJA 3LDRA 5FK7A 3TAWA 5A7VB 2X8SA 5GLOA 2EXIA 5GLNA 3WMYA 5C0PA 4FFGA 1GYDB 3WMZA 5GLMA 4AK6A 1Y4WA 3BYLA 5JOXA 4MLGA 3PIGA 4PVAA 4NOVA 3WPZA 3WN0A 4AK5A 1Y9GA 3VSRA 4AK7A 2AC1A 4PVIA 4UDJA 2ADDA 4QQSA 3WPYA 3U14A 3RWKX 1GYHA 3C7OA 3OM5A 3R4ZA 1W2TA 2YFRA 3WATA 3QC2A 5FIXA 3VSSA 1YRZA 3AKIA 3AKFA 3VT0A 4UDKE 3WN2A 3D61A 2EXKA 5A7VA 3VT2A 3LF7A 1GYEB 4UDKA 3VSFA 3C2UA 5AYDA 5AY9A 2QQWA 5FMBA 1UV4A 3OM4A 2B4WA 3R67A 4COTA 1UYPA 5GLLA 4UDGA 5GLKA 2OXBA 4N1IA 5GLQA 3OM6A 5AYEA 3AKHA 5GLRA 4N2ZA 5JOWA 3OM2A 3R4YA 3P2NA 2X8TA 1ST8A 3LEMA 1OYGA 1PT2A 3OM7A 3CU9A 4O8NA 3KF3A 5FKCA 2YFSA 3U75A 2QQVA 4O8PA 1WL7A 3QEDA 3NQHA 2XQRA 4KC7A 5FMCA 3UGHA 2AEYA 3PIJA 3C7HA 3QEFA 4N4BA 3BYNA 3KF5A 3D5YA 5B6TA 4FFIA 4UDIA 3LDKA 3QZ4A 5JOYA 3WAUA 3LFIA 3WPUA 2YFTA 4FFFA 3WN1A 3BYJA 4KMIA 5ANNA 5FLWA 3VSZA 2AEZA 2QQUA 3ZXJA 1Y9MA 5GLPA 4ONZA 3C7FA 3D60A 5FK8A 4FFHA 3WASA 1W18A 3AKGA 5AYCA 2VDTA 3UGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y7B A;  3K1U A;  4U6B A;  3D5Z A;  4N2R A;  2EXH A;  1YIF A;  3C7E A;  4U6D A;  3WPV A;  3UGG A;  5B6S A;  5A8C A;  3LIG A;  3BYK A;  2X8F A;  4O8O A;  3ZXK A;  5A8D A;  3ZXL A;  4KCA A;  1VKD A;  4D47 A;  3LIH A;  2ADE A;  3KST A;  3QEE A;  5JOZ A;  4KC8 A;  3VT1 A;  5FKB A;  4KCB A;  3SC7 X;  5FMD A;  4EQV A;  1YI7 A;  3C7G A;  3LV4 A;  2EXJ A;  3LDR A;  5FK7 A;  3TAW A;  5A7V B;  2X8S A;  5GLO A;  2EXI A;  5GLN A;  3WMY A;  5C0P A;  4FFG A;  1GYD B;  3WMZ A;  5GLM A;  4AK6 A;  1Y4W A;  3BYL A;  5JOX A;  4MLG A;  3PIG A;  4PVA A;  4NOV A;  3WPZ A;  3WN0 A;  4AK5 A;  1Y9G A;  3VSR A;  4AK7 A;  2AC1 A;  4PVI A;  4UDJ A;  2ADD A;  4QQS A;  3WPY A;  3U14 A;  3RWK X;  1GYH A;  3C7O A;  3OM5 A;  3R4Z A;  1W2T A;  2YFR A;  3WAT A;  3QC2 A;  5FIX A;  3VSS A;  1YRZ A;  3AKI A;  3AKF A;  3VT0 A;  4UDK E;  3WN2 A;  3D61 A;  2EXK A;  5A7V A;  3VT2 A;  3LF7 A;  1GYE B;  4UDK A;  3VSF A;  3C2U A;  5AYD A;  5AY9 A;  2QQW A;  5FMB A;  1UV4 A;  3OM4 A;  2B4W A;  3R67 A;  4COT A;  1UYP A;  5GLL A;  4UDG A;  5GLK A;  2OXB A;  4N1I A;  5GLQ A;  3OM6 A;  5AYE A;  3AKH A;  5GLR A;  4N2Z A;  5JOW A;  3OM2 A;  3R4Y A;  3P2N A;  2X8T A;  1ST8 A;  3LEM A;  1OYG A;  1PT2 A;  3OM7 A;  3CU9 A;  4O8N A;  3KF3 A;  5FKC A;  2YFS A;  3U75 A;  2QQV A;  4O8P A;  1WL7 A;  3QED A;  3NQH A;  2XQR A;  4KC7 A;  5FMC A;  3UGH A;  2AEY A;  3PIJ A;  3C7H A;  3QEF A;  4N4B A;  3BYN A;  3KF5 A;  3D5Y A;  5B6T A;  4FFI A;  4UDI A;  3LDK A;  3QZ4 A;  5JOY A;  3WAU A;  3LFI A;  3WPU A;  2YFT A;  4FFF A;  3WN1 A;  3BYJ A;  4KMI A;  5ANN A;  5FLW A;  3VSZ A;  2AEZ A;  2QQU A;  3ZXJ A;  1Y9M A;  5GLP A;  4ONZ A;  3C7F A;  3D60 A;  5FK8 A;  4FFH A;  3WAS A;  1W18 A;  3AKG A;  5AYC A;  2VDT A;  3UGF A; 
#chains in the Genus database with same CATH topology
 1Y7B A;  3K1U A;  4U6B A;  3D5Z A;  4N2R A;  2EXH A;  1YIF A;  3C7E A;  4U6D A;  3WPV A;  3UGG A;  5B6S A;  5A8C A;  3LIG A;  3BYK A;  2X8F A;  4O8O A;  3ZXK A;  5A8D A;  1TL2 A;  3ZXL A;  4KCA A;  1VKD A;  4D47 A;  3LIH A;  2ADE A;  3KST A;  3QEE A;  5JOZ A;  4KC8 A;  3VT1 A;  5FKB A;  4KCB A;  3SC7 X;  5FMD A;  4EQV A;  1YI7 A;  3C7G A;  3LV4 A;  2EXJ A;  3LDR A;  5FK7 A;  3TAW A;  5A7V B;  2X8S A;  5GLO A;  2EXI A;  5GLN A;  3WMY A;  5C0P A;  4FFG A;  1GYD B;  3WMZ A;  5GLM A;  4AK6 A;  1Y4W A;  3BYL A;  5JOX A;  4MLG A;  3PIG A;  4PVA A;  4NOV A;  3WPZ A;  3WN0 A;  4AK5 A;  1Y9G A;  3VSR A;  4AK7 A;  2AC1 A;  4PVI A;  4UDJ A;  2ADD A;  4QQS A;  3WPY A;  3U14 A;  5C2M A;  3RWK X;  1GYH A;  3C7O A;  3OM5 A;  3R4Z A;  1W2T A;  2YFR A;  3WAT A;  3QC2 A;  5FIX A;  3VSS A;  1YRZ A;  3AKI A;  3AKF A;  3VT0 A;  4UDK E;  3WN2 A;  3D61 A;  2EXK A;  5A7V A;  3VT2 A;  3LF7 A;  1GYE B;  4UDK A;  3VSF A;  3C2U A;  5AYD A;  5AY9 A;  2QQW A;  5FMB A;  1UV4 A;  3OM4 A;  2B4W A;  3R67 A;  4COT A;  1UYP A;  5GLL A;  4UDG A;  5GLK A;  2OXB A;  4N1I A;  5GLQ A;  3OM6 A;  5AYE A;  3AKH A;  5GLR A;  4N2Z A;  5JOW A;  3OM2 A;  3R4Y A;  3P2N A;  2X8T A;  1ST8 A;  3LEM A;  1OYG A;  1PT2 A;  3OM7 A;  3CU9 A;  4O8N A;  3KF3 A;  5FKC A;  2YFS A;  3U75 A;  2QQV A;  4O8P A;  1WL7 A;  3QED A;  3NQH A;  2XQR A;  4KC7 A;  5FMC A;  3UGH A;  2AEY A;  3PIJ A;  3C7H A;  3QEF A;  4N4B A;  3BYN A;  3KF5 A;  3D5Y A;  5B6T A;  4FFI A;  4UDI A;  3LDK A;  3QZ4 A;  5JOY A;  3WAU A;  3LFI A;  3WPU A;  2YFT A;  4FFF A;  3WN1 A;  3BYJ A;  4KMI A;  5ANN A;  5FLW A;  3VSZ A;  2AEZ A;  2QQU A;  3ZXJ A;  1Y9M A;  5GLP A;  4ONZ A;  3C7F A;  3D60 A;  5FK8 A;  4FFH A;  3WAS A;  1W18 A;  3AKG A;  5AYC A;  2VDT A;  3UGF A; 
#chains in the Genus database with same CATH homology
 1Y7B A;  3K1U A;  4U6B A;  3D5Z A;  4N2R A;  2EXH A;  1YIF A;  3C7E A;  4U6D A;  3WPV A;  3UGG A;  5B6S A;  5A8C A;  3LIG A;  3BYK A;  2X8F A;  4O8O A;  3ZXK A;  5A8D A;  3ZXL A;  4KCA A;  1VKD A;  4D47 A;  3LIH A;  2ADE A;  3KST A;  3QEE A;  5JOZ A;  4KC8 A;  3VT1 A;  5FKB A;  4KCB A;  3SC7 X;  5FMD A;  4EQV A;  1YI7 A;  3C7G A;  3LV4 A;  2EXJ A;  3LDR A;  5FK7 A;  3TAW A;  5A7V B;  2X8S A;  5GLO A;  2EXI A;  5GLN A;  3WMY A;  5C0P A;  4FFG A;  1GYD B;  3WMZ A;  5GLM A;  4AK6 A;  1Y4W A;  3BYL A;  5JOX A;  4MLG A;  3PIG A;  4PVA A;  4NOV A;  3WPZ A;  3WN0 A;  4AK5 A;  1Y9G A;  3VSR A;  4AK7 A;  2AC1 A;  4PVI A;  4UDJ A;  2ADD A;  4QQS A;  3WPY A;  3U14 A;  3RWK X;  1GYH A;  3C7O A;  3OM5 A;  3R4Z A;  1W2T A;  2YFR A;  3WAT A;  3QC2 A;  5FIX A;  3VSS A;  1YRZ A;  3AKI A;  3AKF A;  3VT0 A;  4UDK E;  3WN2 A;  3D61 A;  2EXK A;  5A7V A;  3VT2 A;  3LF7 A;  1GYE B;  4UDK A;  3VSF A;  3C2U A;  5AYD A;  5AY9 A;  2QQW A;  5FMB A;  1UV4 A;  3OM4 A;  2B4W A;  3R67 A;  4COT A;  1UYP A;  5GLL A;  4UDG A;  5GLK A;  2OXB A;  4N1I A;  5GLQ A;  3OM6 A;  5AYE A;  3AKH A;  5GLR A;  4N2Z A;  5JOW A;  3OM2 A;  3R4Y A;  3P2N A;  2X8T A;  1ST8 A;  3LEM A;  1OYG A;  1PT2 A;  3OM7 A;  3CU9 A;  4O8N A;  3KF3 A;  5FKC A;  2YFS A;  3U75 A;  2QQV A;  4O8P A;  1WL7 A;  3QED A;  3NQH A;  2XQR A;  4KC7 A;  5FMC A;  3UGH A;  2AEY A;  3PIJ A;  3C7H A;  3QEF A;  4N4B A;  3BYN A;  3KF5 A;  3D5Y A;  5B6T A;  4FFI A;  4UDI A;  3LDK A;  3QZ4 A;  5JOY A;  3WAU A;  3LFI A;  3WPU A;  2YFT A;  4FFF A;  3WN1 A;  3BYJ A;  4KMI A;  5ANN A;  5FLW A;  3VSZ A;  2AEZ A;  2QQU A;  3ZXJ A;  1Y9M A;  5GLP A;  4ONZ A;  3C7F A;  3D60 A;  5FK8 A;  4FFH A;  3WAS A;  1W18 A;  3AKG A;  5AYC A;  2VDT A;  3UGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...