4AK6A

Bpgh117_h302e mutant glycoside hydrolase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
368
structure length
368
Chain Sequence
YDERKADSLGIPKGNKLSAAMKRAMKWENHDNKWFFEYKMEPLKGDLAYEEGVVRRDPSAMLKIGDTYYVWYSKSYGPTQGFAGDIEKDKVFPWDRCDIWYATSKDGLTWKEQGIAVKRGEKGAYDDRSVFTPEVMEWKGKYYLCYQAVKSPYTVRVKNTIGMACADSPEGLWTKTDKPVLEPSDTGEWEGDEDNRFKVVSKGDFDSHKVHDPCIIPYNGKFYMYYKGERMGEEITWGGREIKHGVAIAENPMGPYVKSEYNPISNSGEEVCVWPYKGGIASLITTDGPEKNTLQWSPDGINFEIMSVVKGAPHAIGLNRSADAEKEPTEILRWGLTHIYNSSDYQSIMRFSTWTLQTHTAKGESKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ANHYDRO-ALPHA-L-GALACTOSIDASE
publication title Analysis of Keystone Enzyme in Agar Hydrolysis Provides Insight Into the Degradation (of a Polysaccharide from) Red Seaweeds.
pubmed doi rcsb
source organism Bacteroides plebeius
total genus 92
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 4ak6A00
3VT2A 5GLMA 3WATA 4N1IA 5GLQA 2QQUA 3BYJA 5AYEA 4UDJA 3AKHA 4FFHA 3WN2A 2VDTA 3CU9A 1UYPA 3SC7X 1GYHA 4KCAA 3LFIA 4AK7A 1YIFA 3OM7A 3BYLA 3LV4A 5FK7A 2QQWA 4N4BA 5JOXA 3PIJA 5GLRA 3U75A 4FFFA 3LIHA 4KMIA 4MLGA 4AK6A 3WMYA 1OYGA 3WASA 4D47A 1Y4WA 5A8CA 5JOYA 3WMZA 1Y9GA 2YFTA 2YFRA 3C7HA 4EQVA 3AKGA 3TAWA 1ST8A 2X8FA 4AK5A 4PVIA 1WL7A 5GLKA 3D61A 3LIGA 3C2UA 3D5YA 4N2RA 3LDKA 5FMBA 2ADEA 2YFSA 3P2NA 3C7EA 3ZXKA 3C7FA 1W2TA 5FKBA 5FK8A 1GYDB 3ZXJA 5FIXA 4UDKE 3WPYA 3VSFA 1YI7A 3RWKX 4U6BA 1Y7BA 3VT0A 3QEDA 3R4YA 3WPZA 2X8SA 5A7VA 3LF7A 3KF5A 5FMDA 2EXIA 3WN1A 3BYNA 4KC7A 3R4ZA 3QEEA 3ZXLA 3OM6A 4O8NA 3WN0A 4UDKA 3AKIA 4NOVA 3NQHA 3U14A 2AEZA 5AYCA 2AC1A 3VSZA 5A8DA 5B6TA 2AEYA 2EXKA 5FMCA 4KCBA 4UDGA 4O8PA 3PIGA 3WPVA 3K1UA 3C7GA 3WPUA 3C7OA 3R67A 1PT2A 3OM4A 3VSRA 3AKFA 3D60A 4N2ZA 2ADDA 3QEFA 2X8TA 4UDIA 3BYKA 1YRZA 5JOWA 5JOZA 4KC8A 5B6SA 1UV4A 1VKDA 3OM5A 5FLWA 5ANNA 3UGGA 3D5ZA 3VSSA 4ONZA 4PVAA 1Y9MA 5GLLA 3UGHA 1W18A 3OM2A 2XQRA 5C0PA 3QZ4A 4QQSA 4O8OA 5A7VB 5FKCA 2B4WA 5GLPA 3LDRA 4COTA 3KSTA 3UGFA 5GLOA 4FFGA 2QQVA 3KF3A 5GLNA 2OXBA 4FFIA 2EXHA 3VT1A 3WAUA 2EXJA 5AYDA 5AY9A 4U6DA 3LEMA 1GYEB 3QC2A
chains in the Genus database with same CATH superfamily
3VT2A 5GLMA 3WATA 4N1IA 5GLQA 2QQUA 3BYJA 5AYEA 4UDJA 3AKHA 4FFHA 3WN2A 2VDTA 3CU9A 1UYPA 3SC7X 1GYHA 4KCAA 3LFIA 4AK7A 1YIFA 3OM7A 3BYLA 3LV4A 5FK7A 2QQWA 4N4BA 5JOXA 3PIJA 5GLRA 3U75A 4FFFA 3LIHA 4KMIA 4MLGA 4AK6A 3WMYA 1OYGA 3WASA 4D47A 1Y4WA 5A8CA 5JOYA 3WMZA 1Y9GA 2YFTA 2YFRA 3C7HA 4EQVA 3AKGA 3TAWA 1ST8A 2X8FA 4AK5A 4PVIA 1WL7A 5GLKA 3D61A 3LIGA 3C2UA 3D5YA 4N2RA 3LDKA 5FMBA 2ADEA 2YFSA 3P2NA 3C7EA 3ZXKA 3C7FA 1W2TA 5FKBA 5FK8A 1GYDB 3ZXJA 5FIXA 4UDKE 3WPYA 3VSFA 1YI7A 3RWKX 4U6BA 1Y7BA 3VT0A 3QEDA 3R4YA 3WPZA 1TL2A 2X8SA 5A7VA 3LF7A 3KF5A 5FMDA 2EXIA 3WN1A 3BYNA 4KC7A 3R4ZA 3QEEA 3ZXLA 3OM6A 4O8NA 3WN0A 4UDKA 3AKIA 4NOVA 3NQHA 3U14A 2AEZA 5AYCA 2AC1A 3VSZA 5A8DA 5B6TA 2AEYA 2EXKA 5FMCA 4KCBA 4UDGA 4O8PA 3PIGA 3WPVA 3K1UA 3C7GA 3WPUA 3C7OA 3R67A 1PT2A 3OM4A 3VSRA 3AKFA 3D60A 4N2ZA 2ADDA 3QEFA 2X8TA 4UDIA 3BYKA 1YRZA 5JOWA 5JOZA 4KC8A 5B6SA 5C2MA 1UV4A 1VKDA 3OM5A 5FLWA 5ANNA 3UGGA 3D5ZA 3VSSA 4ONZA 4PVAA 1Y9MA 5GLLA 3UGHA 1W18A 3OM2A 2XQRA 5C0PA 3QZ4A 4QQSA 4O8OA 5A7VB 5FKCA 2B4WA 5GLPA 3LDRA 4COTA 3KSTA 3UGFA 5GLOA 4FFGA 2QQVA 3KF3A 5GLNA 2OXBA 4FFIA 2EXHA 3VT1A 3WAUA 2EXJA 5AYDA 5AY9A 4U6DA 3LEMA 1GYEB 3QC2A
chains in the Genus database with same CATH topology
3VT2A 5GLMA 3WATA 4N1IA 5GLQA 2QQUA 3BYJA 5AYEA 4UDJA 3AKHA 4FFHA 3WN2A 2VDTA 3CU9A 1UYPA 3SC7X 1GYHA 4KCAA 3LFIA 4AK7A 1YIFA 3OM7A 3BYLA 3LV4A 5FK7A 2QQWA 4N4BA 5JOXA 3PIJA 5GLRA 3U75A 4FFFA 3LIHA 4KMIA 4MLGA 4AK6A 3WMYA 1OYGA 3WASA 4D47A 1Y4WA 5A8CA 5JOYA 3WMZA 1Y9GA 2YFTA 2YFRA 3C7HA 4EQVA 3AKGA 3TAWA 1ST8A 2X8FA 4AK5A 4PVIA 1WL7A 5GLKA 3D61A 3LIGA 3C2UA 3D5YA 4N2RA 3LDKA 5FMBA 2ADEA 2YFSA 3P2NA 3C7EA 3ZXKA 3C7FA 1W2TA 5FKBA 5FK8A 1GYDB 3ZXJA 5FIXA 4UDKE 3WPYA 3VSFA 1YI7A 3RWKX 4U6BA 1Y7BA 3VT0A 3QEDA 3R4YA 3WPZA 2X8SA 5A7VA 3LF7A 3KF5A 5FMDA 2EXIA 3WN1A 3BYNA 4KC7A 3R4ZA 3QEEA 3ZXLA 3OM6A 4O8NA 3WN0A 4UDKA 3AKIA 4NOVA 3NQHA 3U14A 2AEZA 5AYCA 2AC1A 3VSZA 5A8DA 5B6TA 2AEYA 2EXKA 5FMCA 4KCBA 4UDGA 4O8PA 3PIGA 3WPVA 3K1UA 3C7GA 3WPUA 3C7OA 3R67A 1PT2A 3OM4A 3VSRA 3AKFA 3D60A 4N2ZA 2ADDA 3QEFA 2X8TA 4UDIA 3BYKA 1YRZA 5JOWA 5JOZA 4KC8A 5B6SA 1UV4A 1VKDA 3OM5A 5FLWA 5ANNA 3UGGA 3D5ZA 3VSSA 4ONZA 4PVAA 1Y9MA 5GLLA 3UGHA 1W18A 3OM2A 2XQRA 5C0PA 3QZ4A 4QQSA 4O8OA 5A7VB 5FKCA 2B4WA 5GLPA 3LDRA 4COTA 3KSTA 3UGFA 5GLOA 4FFGA 2QQVA 3KF3A 5GLNA 2OXBA 4FFIA 2EXHA 3VT1A 3WAUA 2EXJA 5AYDA 5AY9A 4U6DA 3LEMA 1GYEB 3QC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VT2 A;  5GLM A;  3WAT A;  4N1I A;  5GLQ A;  2QQU A;  3BYJ A;  5AYE A;  4UDJ A;  3AKH A;  4FFH A;  3WN2 A;  2VDT A;  3CU9 A;  1UYP A;  3SC7 X;  1GYH A;  4KCA A;  3LFI A;  4AK7 A;  1YIF A;  3OM7 A;  3BYL A;  3LV4 A;  5FK7 A;  2QQW A;  4N4B A;  5JOX A;  3PIJ A;  5GLR A;  3U75 A;  4FFF A;  3LIH A;  4KMI A;  4MLG A;  4AK6 A;  3WMY A;  1OYG A;  3WAS A;  4D47 A;  1Y4W A;  5A8C A;  5JOY A;  3WMZ A;  1Y9G A;  2YFT A;  2YFR A;  3C7H A;  4EQV A;  3AKG A;  3TAW A;  1ST8 A;  2X8F A;  4AK5 A;  4PVI A;  1WL7 A;  5GLK A;  3D61 A;  3LIG A;  3C2U A;  3D5Y A;  4N2R A;  3LDK A;  5FMB A;  2ADE A;  2YFS A;  3P2N A;  3C7E A;  3ZXK A;  3C7F A;  1W2T A;  5FKB A;  5FK8 A;  1GYD B;  3ZXJ A;  5FIX A;  4UDK E;  3WPY A;  3VSF A;  1YI7 A;  3RWK X;  4U6B A;  1Y7B A;  3VT0 A;  3QED A;  3R4Y A;  3WPZ A;  2X8S A;  5A7V A;  3LF7 A;  3KF5 A;  5FMD A;  2EXI A;  3WN1 A;  3BYN A;  4KC7 A;  3R4Z A;  3QEE A;  3ZXL A;  3OM6 A;  4O8N A;  3WN0 A;  4UDK A;  3AKI A;  4NOV A;  3NQH A;  3U14 A;  2AEZ A;  5AYC A;  2AC1 A;  3VSZ A;  5A8D A;  5B6T A;  2AEY A;  2EXK A;  5FMC A;  4KCB A;  4UDG A;  4O8P A;  3PIG A;  3WPV A;  3K1U A;  3C7G A;  3WPU A;  3C7O A;  3R67 A;  1PT2 A;  3OM4 A;  3VSR A;  3AKF A;  3D60 A;  4N2Z A;  2ADD A;  3QEF A;  2X8T A;  4UDI A;  3BYK A;  1YRZ A;  5JOW A;  5JOZ A;  4KC8 A;  5B6S A;  1UV4 A;  1VKD A;  3OM5 A;  5FLW A;  5ANN A;  3UGG A;  3D5Z A;  3VSS A;  4ONZ A;  4PVA A;  1Y9M A;  5GLL A;  3UGH A;  1W18 A;  3OM2 A;  2XQR A;  5C0P A;  3QZ4 A;  4QQS A;  4O8O A;  5A7V B;  5FKC A;  2B4W A;  5GLP A;  3LDR A;  4COT A;  3KST A;  3UGF A;  5GLO A;  4FFG A;  2QQV A;  3KF3 A;  5GLN A;  2OXB A;  4FFI A;  2EXH A;  3VT1 A;  3WAU A;  2EXJ A;  5AYD A;  5AY9 A;  4U6D A;  3LEM A;  1GYE B;  3QC2 A; 
#chains in the Genus database with same CATH topology
 3VT2 A;  5GLM A;  3WAT A;  4N1I A;  5GLQ A;  2QQU A;  3BYJ A;  5AYE A;  4UDJ A;  3AKH A;  4FFH A;  3WN2 A;  2VDT A;  3CU9 A;  1UYP A;  3SC7 X;  1GYH A;  4KCA A;  3LFI A;  4AK7 A;  1YIF A;  3OM7 A;  3BYL A;  3LV4 A;  5FK7 A;  2QQW A;  4N4B A;  5JOX A;  3PIJ A;  5GLR A;  3U75 A;  4FFF A;  3LIH A;  4KMI A;  4MLG A;  4AK6 A;  3WMY A;  1OYG A;  3WAS A;  4D47 A;  1Y4W A;  5A8C A;  5JOY A;  3WMZ A;  1Y9G A;  2YFT A;  2YFR A;  3C7H A;  4EQV A;  3AKG A;  3TAW A;  1ST8 A;  2X8F A;  4AK5 A;  4PVI A;  1WL7 A;  5GLK A;  3D61 A;  3LIG A;  3C2U A;  3D5Y A;  4N2R A;  3LDK A;  5FMB A;  2ADE A;  2YFS A;  3P2N A;  3C7E A;  3ZXK A;  3C7F A;  1W2T A;  5FKB A;  5FK8 A;  1GYD B;  3ZXJ A;  5FIX A;  4UDK E;  3WPY A;  3VSF A;  1YI7 A;  3RWK X;  4U6B A;  1Y7B A;  3VT0 A;  3QED A;  3R4Y A;  3WPZ A;  1TL2 A;  2X8S A;  5A7V A;  3LF7 A;  3KF5 A;  5FMD A;  2EXI A;  3WN1 A;  3BYN A;  4KC7 A;  3R4Z A;  3QEE A;  3ZXL A;  3OM6 A;  4O8N A;  3WN0 A;  4UDK A;  3AKI A;  4NOV A;  3NQH A;  3U14 A;  2AEZ A;  5AYC A;  2AC1 A;  3VSZ A;  5A8D A;  5B6T A;  2AEY A;  2EXK A;  5FMC A;  4KCB A;  4UDG A;  4O8P A;  3PIG A;  3WPV A;  3K1U A;  3C7G A;  3WPU A;  3C7O A;  3R67 A;  1PT2 A;  3OM4 A;  3VSR A;  3AKF A;  3D60 A;  4N2Z A;  2ADD A;  3QEF A;  2X8T A;  4UDI A;  3BYK A;  1YRZ A;  5JOW A;  5JOZ A;  4KC8 A;  5B6S A;  5C2M A;  1UV4 A;  1VKD A;  3OM5 A;  5FLW A;  5ANN A;  3UGG A;  3D5Z A;  3VSS A;  4ONZ A;  4PVA A;  1Y9M A;  5GLL A;  3UGH A;  1W18 A;  3OM2 A;  2XQR A;  5C0P A;  3QZ4 A;  4QQS A;  4O8O A;  5A7V B;  5FKC A;  2B4W A;  5GLP A;  3LDR A;  4COT A;  3KST A;  3UGF A;  5GLO A;  4FFG A;  2QQV A;  3KF3 A;  5GLN A;  2OXB A;  4FFI A;  2EXH A;  3VT1 A;  3WAU A;  2EXJ A;  5AYD A;  5AY9 A;  4U6D A;  3LEM A;  1GYE B;  3QC2 A; 
#chains in the Genus database with same CATH homology
 3VT2 A;  5GLM A;  3WAT A;  4N1I A;  5GLQ A;  2QQU A;  3BYJ A;  5AYE A;  4UDJ A;  3AKH A;  4FFH A;  3WN2 A;  2VDT A;  3CU9 A;  1UYP A;  3SC7 X;  1GYH A;  4KCA A;  3LFI A;  4AK7 A;  1YIF A;  3OM7 A;  3BYL A;  3LV4 A;  5FK7 A;  2QQW A;  4N4B A;  5JOX A;  3PIJ A;  5GLR A;  3U75 A;  4FFF A;  3LIH A;  4KMI A;  4MLG A;  4AK6 A;  3WMY A;  1OYG A;  3WAS A;  4D47 A;  1Y4W A;  5A8C A;  5JOY A;  3WMZ A;  1Y9G A;  2YFT A;  2YFR A;  3C7H A;  4EQV A;  3AKG A;  3TAW A;  1ST8 A;  2X8F A;  4AK5 A;  4PVI A;  1WL7 A;  5GLK A;  3D61 A;  3LIG A;  3C2U A;  3D5Y A;  4N2R A;  3LDK A;  5FMB A;  2ADE A;  2YFS A;  3P2N A;  3C7E A;  3ZXK A;  3C7F A;  1W2T A;  5FKB A;  5FK8 A;  1GYD B;  3ZXJ A;  5FIX A;  4UDK E;  3WPY A;  3VSF A;  1YI7 A;  3RWK X;  4U6B A;  1Y7B A;  3VT0 A;  3QED A;  3R4Y A;  3WPZ A;  2X8S A;  5A7V A;  3LF7 A;  3KF5 A;  5FMD A;  2EXI A;  3WN1 A;  3BYN A;  4KC7 A;  3R4Z A;  3QEE A;  3ZXL A;  3OM6 A;  4O8N A;  3WN0 A;  4UDK A;  3AKI A;  4NOV A;  3NQH A;  3U14 A;  2AEZ A;  5AYC A;  2AC1 A;  3VSZ A;  5A8D A;  5B6T A;  2AEY A;  2EXK A;  5FMC A;  4KCB A;  4UDG A;  4O8P A;  3PIG A;  3WPV A;  3K1U A;  3C7G A;  3WPU A;  3C7O A;  3R67 A;  1PT2 A;  3OM4 A;  3VSR A;  3AKF A;  3D60 A;  4N2Z A;  2ADD A;  3QEF A;  2X8T A;  4UDI A;  3BYK A;  1YRZ A;  5JOW A;  5JOZ A;  4KC8 A;  5B6S A;  1UV4 A;  1VKD A;  3OM5 A;  5FLW A;  5ANN A;  3UGG A;  3D5Z A;  3VSS A;  4ONZ A;  4PVA A;  1Y9M A;  5GLL A;  3UGH A;  1W18 A;  3OM2 A;  2XQR A;  5C0P A;  3QZ4 A;  4QQS A;  4O8O A;  5A7V B;  5FKC A;  2B4W A;  5GLP A;  3LDR A;  4COT A;  3KST A;  3UGF A;  5GLO A;  4FFG A;  2QQV A;  3KF3 A;  5GLN A;  2OXB A;  4FFI A;  2EXH A;  3VT1 A;  3WAU A;  2EXJ A;  5AYD A;  5AY9 A;  4U6D A;  3LEM A;  1GYE B;  3QC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...