4AK7A

Crystal structure of bpgh117_e303q in complex with neoagarobiose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
369
structure length
369
Chain Sequence
NYDERKADSLGIPKGNKLSAAMKRAMKWENHDNKWFFEYKMEPLKGDLAYEEGVVRRDPSAMLKIGDTYYVWYSKSYGPTQGFAGDIEKDKVFPWDRCDIWYATSKDGLTWKEQGIAVKRGEKGAYDDRSVFTPEVMEWKGKYYLCYQAVKSPYTVRVKNTIGMACADSPEGLWTKTDKPVLEPSDTGEWEGDEDNRFKVVSKGDFDSHKVHDPCIIPYNGKFYMYYKGERMGEEITWGGREIKHGVAIAENPMGPYVKSEYNPISNSGHQVCVWPYKGGIASLITTDGPEKNTLQWSPDGINFEIMSVVKGAPHAIGLNRSADAEKEPTEILRWGLTHIYNSSDYQSIMRFSTWTLQTHTAKGESKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ANHYDRO-ALPHA-L-GALACTOSIDASE
publication title Analysis of Keystone Enzyme in Agar Hydrolysis Provides Insight Into the Degradation (of a Polysaccharide from) Red Seaweeds.
pubmed doi rcsb
source organism Bacteroides plebeius
total genus 93
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 4ak7A00
2EXKA 3C7OA 3PIJA 1W2TA 3BYLA 4D47A 3CU9A 3WMYA 3WPYA 3BYJA 3C7HA 4FFHA 2AEZA 3K1UA 4FFGA 3AKIA 3U14A 2AC1A 3R4YA 3ZXLA 1WL7A 3QEEA 2QQWA 5JOWA 3C7GA 3VT0A 2AEYA 2X8SA 4AK6A 5A8DA 1UYPA 3PIGA 5FIXA 3C7EA 5FMDA 1GYDB 3AKFA 4KMIA 3OM2A 3WATA 3UGGA 5FK8A 5AYCA 1YIFA 4ONZA 3KF3A 3VSSA 3WASA 1Y7BA 4UDKE 5AYEA 2OXBA 3LFIA 4O8PA 2ADDA 3BYNA 3OM7A 1OYGA 3WN0A 5JOZA 3WPUA 2YFRA 3OM4A 5FK7A 5ANNA 4FFFA 3WAUA 5B6TA 2VDTA 2QQUA 4N4BA 1YI7A 4COTA 4KCAA 5FKBA 3AKGA 3QEFA 5JOYA 1VKDA 2X8TA 3WMZA 5AY9A 1Y9MA 2EXHA 3VT2A 3QEDA 1YRZA 1ST8A 1W18A 3LIHA 4N2ZA 3VSFA 4KC7A 3ZXJA 3UGHA 1Y9GA 2ADEA 3VT1A 3R4ZA 3D5ZA 5B6SA 3AKHA 3SC7X 3C2UA 4KCBA 5A7VA 3LDRA 3D60A 3WN1A 3LEMA 5C0PA 3LV4A 3OM6A 3C7FA 5GLLA 5A7VB 5FMBA 3WPVA 2YFTA 4O8OA 2YFSA 3BYKA 3UGFA 3LIGA 5GLKA 4U6DA 4UDKA 1Y4WA 3D61A 3OM5A 2X8FA 5GLOA 2XQRA 4O8NA 2EXIA 4PVIA 3P2NA 3QC2A 5GLQA 3KSTA 5GLNA 3TAWA 5GLRA 4EQVA 3VSZA 2B4WA 5AYDA 3KF5A 5GLPA 1PT2A 1GYEB 5A8CA 3LF7A 3RWKX 4NOVA 3NQHA 2QQVA 1GYHA 4AK7A 3WN2A 5JOXA 4AK5A 4UDGA 4FFIA 3D5YA 5GLMA 5FLWA 4UDIA 3LDKA 5FKCA 4UDJA 4N1IA 4PVAA 2EXJA 5FMCA 4KC8A 4U6BA 3WPZA 3ZXKA 4QQSA 3QZ4A 3U75A 4MLGA 1UV4A 3VSRA 4N2RA 3R67A
chains in the Genus database with same CATH superfamily
2EXKA 3C7OA 3PIJA 1W2TA 3BYLA 4D47A 3CU9A 3WMYA 3WPYA 3BYJA 3C7HA 4FFHA 2AEZA 3K1UA 4FFGA 3AKIA 3U14A 2AC1A 3R4YA 3ZXLA 1WL7A 3QEEA 2QQWA 5C2MA 5JOWA 3C7GA 3VT0A 2AEYA 2X8SA 4AK6A 5A8DA 1UYPA 3PIGA 5FIXA 3C7EA 5FMDA 1GYDB 3AKFA 4KMIA 3OM2A 1TL2A 3WATA 3UGGA 5FK8A 5AYCA 1YIFA 4ONZA 3KF3A 3VSSA 3WASA 1Y7BA 4UDKE 5AYEA 2OXBA 3LFIA 4O8PA 2ADDA 3BYNA 3OM7A 1OYGA 3WN0A 5JOZA 3WPUA 2YFRA 3OM4A 5FK7A 5ANNA 4FFFA 3WAUA 5B6TA 2VDTA 2QQUA 4N4BA 1YI7A 4COTA 4KCAA 5FKBA 3AKGA 3QEFA 5JOYA 1VKDA 2X8TA 3WMZA 5AY9A 1Y9MA 2EXHA 3VT2A 3QEDA 1YRZA 1ST8A 1W18A 3LIHA 4N2ZA 3VSFA 4KC7A 3ZXJA 3UGHA 1Y9GA 2ADEA 3VT1A 3R4ZA 3D5ZA 5B6SA 3AKHA 3SC7X 3C2UA 4KCBA 5A7VA 3LDRA 3D60A 3WN1A 3LEMA 5C0PA 3LV4A 3OM6A 3C7FA 5GLLA 5A7VB 5FMBA 3WPVA 2YFTA 4O8OA 2YFSA 3BYKA 3UGFA 3LIGA 5GLKA 4U6DA 4UDKA 1Y4WA 3D61A 3OM5A 2X8FA 5GLOA 2XQRA 4O8NA 2EXIA 4PVIA 3P2NA 3QC2A 5GLQA 3KSTA 5GLNA 3TAWA 5GLRA 4EQVA 3VSZA 2B4WA 5AYDA 3KF5A 5GLPA 1PT2A 1GYEB 5A8CA 3LF7A 3RWKX 4NOVA 3NQHA 2QQVA 1GYHA 4AK7A 3WN2A 5JOXA 4AK5A 4UDGA 4FFIA 3D5YA 5GLMA 5FLWA 4UDIA 3LDKA 5FKCA 4UDJA 4N1IA 4PVAA 2EXJA 5FMCA 4KC8A 4U6BA 3WPZA 3ZXKA 4QQSA 3QZ4A 3U75A 4MLGA 1UV4A 3VSRA 4N2RA 3R67A
chains in the Genus database with same CATH topology
2EXKA 3C7OA 3PIJA 1W2TA 3BYLA 4D47A 3CU9A 3WMYA 3WPYA 3BYJA 3C7HA 4FFHA 2AEZA 3K1UA 4FFGA 3AKIA 3U14A 2AC1A 3R4YA 3ZXLA 1WL7A 3QEEA 2QQWA 5JOWA 3C7GA 3VT0A 2AEYA 2X8SA 4AK6A 5A8DA 1UYPA 3PIGA 5FIXA 3C7EA 5FMDA 1GYDB 3AKFA 4KMIA 3OM2A 3WATA 3UGGA 5FK8A 5AYCA 1YIFA 4ONZA 3KF3A 3VSSA 3WASA 1Y7BA 4UDKE 5AYEA 2OXBA 3LFIA 4O8PA 2ADDA 3BYNA 3OM7A 1OYGA 3WN0A 5JOZA 3WPUA 2YFRA 3OM4A 5FK7A 5ANNA 4FFFA 3WAUA 5B6TA 2VDTA 2QQUA 4N4BA 1YI7A 4COTA 4KCAA 5FKBA 3AKGA 3QEFA 5JOYA 1VKDA 2X8TA 3WMZA 5AY9A 1Y9MA 2EXHA 3VT2A 3QEDA 1YRZA 1ST8A 1W18A 3LIHA 4N2ZA 3VSFA 4KC7A 3ZXJA 3UGHA 1Y9GA 2ADEA 3VT1A 3R4ZA 3D5ZA 5B6SA 3AKHA 3SC7X 3C2UA 4KCBA 5A7VA 3LDRA 3D60A 3WN1A 3LEMA 5C0PA 3LV4A 3OM6A 3C7FA 5GLLA 5A7VB 5FMBA 3WPVA 2YFTA 4O8OA 2YFSA 3BYKA 3UGFA 3LIGA 5GLKA 4U6DA 4UDKA 1Y4WA 3D61A 3OM5A 2X8FA 5GLOA 2XQRA 4O8NA 2EXIA 4PVIA 3P2NA 3QC2A 5GLQA 3KSTA 5GLNA 3TAWA 5GLRA 4EQVA 3VSZA 2B4WA 5AYDA 3KF5A 5GLPA 1PT2A 1GYEB 5A8CA 3LF7A 3RWKX 4NOVA 3NQHA 2QQVA 1GYHA 4AK7A 3WN2A 5JOXA 4AK5A 4UDGA 4FFIA 3D5YA 5GLMA 5FLWA 4UDIA 3LDKA 5FKCA 4UDJA 4N1IA 4PVAA 2EXJA 5FMCA 4KC8A 4U6BA 3WPZA 3ZXKA 4QQSA 3QZ4A 3U75A 4MLGA 1UV4A 3VSRA 4N2RA 3R67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXK A;  3C7O A;  3PIJ A;  1W2T A;  3BYL A;  4D47 A;  3CU9 A;  3WMY A;  3WPY A;  3BYJ A;  3C7H A;  4FFH A;  2AEZ A;  3K1U A;  4FFG A;  3AKI A;  3U14 A;  2AC1 A;  3R4Y A;  3ZXL A;  1WL7 A;  3QEE A;  2QQW A;  5JOW A;  3C7G A;  3VT0 A;  2AEY A;  2X8S A;  4AK6 A;  5A8D A;  1UYP A;  3PIG A;  5FIX A;  3C7E A;  5FMD A;  1GYD B;  3AKF A;  4KMI A;  3OM2 A;  3WAT A;  3UGG A;  5FK8 A;  5AYC A;  1YIF A;  4ONZ A;  3KF3 A;  3VSS A;  3WAS A;  1Y7B A;  4UDK E;  5AYE A;  2OXB A;  3LFI A;  4O8P A;  2ADD A;  3BYN A;  3OM7 A;  1OYG A;  3WN0 A;  5JOZ A;  3WPU A;  2YFR A;  3OM4 A;  5FK7 A;  5ANN A;  4FFF A;  3WAU A;  5B6T A;  2VDT A;  2QQU A;  4N4B A;  1YI7 A;  4COT A;  4KCA A;  5FKB A;  3AKG A;  3QEF A;  5JOY A;  1VKD A;  2X8T A;  3WMZ A;  5AY9 A;  1Y9M A;  2EXH A;  3VT2 A;  3QED A;  1YRZ A;  1ST8 A;  1W18 A;  3LIH A;  4N2Z A;  3VSF A;  4KC7 A;  3ZXJ A;  3UGH A;  1Y9G A;  2ADE A;  3VT1 A;  3R4Z A;  3D5Z A;  5B6S A;  3AKH A;  3SC7 X;  3C2U A;  4KCB A;  5A7V A;  3LDR A;  3D60 A;  3WN1 A;  3LEM A;  5C0P A;  3LV4 A;  3OM6 A;  3C7F A;  5GLL A;  5A7V B;  5FMB A;  3WPV A;  2YFT A;  4O8O A;  2YFS A;  3BYK A;  3UGF A;  3LIG A;  5GLK A;  4U6D A;  4UDK A;  1Y4W A;  3D61 A;  3OM5 A;  2X8F A;  5GLO A;  2XQR A;  4O8N A;  2EXI A;  4PVI A;  3P2N A;  3QC2 A;  5GLQ A;  3KST A;  5GLN A;  3TAW A;  5GLR A;  4EQV A;  3VSZ A;  2B4W A;  5AYD A;  3KF5 A;  5GLP A;  1PT2 A;  1GYE B;  5A8C A;  3LF7 A;  3RWK X;  4NOV A;  3NQH A;  2QQV A;  1GYH A;  4AK7 A;  3WN2 A;  5JOX A;  4AK5 A;  4UDG A;  4FFI A;  3D5Y A;  5GLM A;  5FLW A;  4UDI A;  3LDK A;  5FKC A;  4UDJ A;  4N1I A;  4PVA A;  2EXJ A;  5FMC A;  4KC8 A;  4U6B A;  3WPZ A;  3ZXK A;  4QQS A;  3QZ4 A;  3U75 A;  4MLG A;  1UV4 A;  3VSR A;  4N2R A;  3R67 A; 
#chains in the Genus database with same CATH topology
 2EXK A;  3C7O A;  3PIJ A;  1W2T A;  3BYL A;  4D47 A;  3CU9 A;  3WMY A;  3WPY A;  3BYJ A;  3C7H A;  4FFH A;  2AEZ A;  3K1U A;  4FFG A;  3AKI A;  3U14 A;  2AC1 A;  3R4Y A;  3ZXL A;  1WL7 A;  3QEE A;  2QQW A;  5C2M A;  5JOW A;  3C7G A;  3VT0 A;  2AEY A;  2X8S A;  4AK6 A;  5A8D A;  1UYP A;  3PIG A;  5FIX A;  3C7E A;  5FMD A;  1GYD B;  3AKF A;  4KMI A;  3OM2 A;  1TL2 A;  3WAT A;  3UGG A;  5FK8 A;  5AYC A;  1YIF A;  4ONZ A;  3KF3 A;  3VSS A;  3WAS A;  1Y7B A;  4UDK E;  5AYE A;  2OXB A;  3LFI A;  4O8P A;  2ADD A;  3BYN A;  3OM7 A;  1OYG A;  3WN0 A;  5JOZ A;  3WPU A;  2YFR A;  3OM4 A;  5FK7 A;  5ANN A;  4FFF A;  3WAU A;  5B6T A;  2VDT A;  2QQU A;  4N4B A;  1YI7 A;  4COT A;  4KCA A;  5FKB A;  3AKG A;  3QEF A;  5JOY A;  1VKD A;  2X8T A;  3WMZ A;  5AY9 A;  1Y9M A;  2EXH A;  3VT2 A;  3QED A;  1YRZ A;  1ST8 A;  1W18 A;  3LIH A;  4N2Z A;  3VSF A;  4KC7 A;  3ZXJ A;  3UGH A;  1Y9G A;  2ADE A;  3VT1 A;  3R4Z A;  3D5Z A;  5B6S A;  3AKH A;  3SC7 X;  3C2U A;  4KCB A;  5A7V A;  3LDR A;  3D60 A;  3WN1 A;  3LEM A;  5C0P A;  3LV4 A;  3OM6 A;  3C7F A;  5GLL A;  5A7V B;  5FMB A;  3WPV A;  2YFT A;  4O8O A;  2YFS A;  3BYK A;  3UGF A;  3LIG A;  5GLK A;  4U6D A;  4UDK A;  1Y4W A;  3D61 A;  3OM5 A;  2X8F A;  5GLO A;  2XQR A;  4O8N A;  2EXI A;  4PVI A;  3P2N A;  3QC2 A;  5GLQ A;  3KST A;  5GLN A;  3TAW A;  5GLR A;  4EQV A;  3VSZ A;  2B4W A;  5AYD A;  3KF5 A;  5GLP A;  1PT2 A;  1GYE B;  5A8C A;  3LF7 A;  3RWK X;  4NOV A;  3NQH A;  2QQV A;  1GYH A;  4AK7 A;  3WN2 A;  5JOX A;  4AK5 A;  4UDG A;  4FFI A;  3D5Y A;  5GLM A;  5FLW A;  4UDI A;  3LDK A;  5FKC A;  4UDJ A;  4N1I A;  4PVA A;  2EXJ A;  5FMC A;  4KC8 A;  4U6B A;  3WPZ A;  3ZXK A;  4QQS A;  3QZ4 A;  3U75 A;  4MLG A;  1UV4 A;  3VSR A;  4N2R A;  3R67 A; 
#chains in the Genus database with same CATH homology
 2EXK A;  3C7O A;  3PIJ A;  1W2T A;  3BYL A;  4D47 A;  3CU9 A;  3WMY A;  3WPY A;  3BYJ A;  3C7H A;  4FFH A;  2AEZ A;  3K1U A;  4FFG A;  3AKI A;  3U14 A;  2AC1 A;  3R4Y A;  3ZXL A;  1WL7 A;  3QEE A;  2QQW A;  5JOW A;  3C7G A;  3VT0 A;  2AEY A;  2X8S A;  4AK6 A;  5A8D A;  1UYP A;  3PIG A;  5FIX A;  3C7E A;  5FMD A;  1GYD B;  3AKF A;  4KMI A;  3OM2 A;  3WAT A;  3UGG A;  5FK8 A;  5AYC A;  1YIF A;  4ONZ A;  3KF3 A;  3VSS A;  3WAS A;  1Y7B A;  4UDK E;  5AYE A;  2OXB A;  3LFI A;  4O8P A;  2ADD A;  3BYN A;  3OM7 A;  1OYG A;  3WN0 A;  5JOZ A;  3WPU A;  2YFR A;  3OM4 A;  5FK7 A;  5ANN A;  4FFF A;  3WAU A;  5B6T A;  2VDT A;  2QQU A;  4N4B A;  1YI7 A;  4COT A;  4KCA A;  5FKB A;  3AKG A;  3QEF A;  5JOY A;  1VKD A;  2X8T A;  3WMZ A;  5AY9 A;  1Y9M A;  2EXH A;  3VT2 A;  3QED A;  1YRZ A;  1ST8 A;  1W18 A;  3LIH A;  4N2Z A;  3VSF A;  4KC7 A;  3ZXJ A;  3UGH A;  1Y9G A;  2ADE A;  3VT1 A;  3R4Z A;  3D5Z A;  5B6S A;  3AKH A;  3SC7 X;  3C2U A;  4KCB A;  5A7V A;  3LDR A;  3D60 A;  3WN1 A;  3LEM A;  5C0P A;  3LV4 A;  3OM6 A;  3C7F A;  5GLL A;  5A7V B;  5FMB A;  3WPV A;  2YFT A;  4O8O A;  2YFS A;  3BYK A;  3UGF A;  3LIG A;  5GLK A;  4U6D A;  4UDK A;  1Y4W A;  3D61 A;  3OM5 A;  2X8F A;  5GLO A;  2XQR A;  4O8N A;  2EXI A;  4PVI A;  3P2N A;  3QC2 A;  5GLQ A;  3KST A;  5GLN A;  3TAW A;  5GLR A;  4EQV A;  3VSZ A;  2B4W A;  5AYD A;  3KF5 A;  5GLP A;  1PT2 A;  1GYE B;  5A8C A;  3LF7 A;  3RWK X;  4NOV A;  3NQH A;  2QQV A;  1GYH A;  4AK7 A;  3WN2 A;  5JOX A;  4AK5 A;  4UDG A;  4FFI A;  3D5Y A;  5GLM A;  5FLW A;  4UDI A;  3LDK A;  5FKC A;  4UDJ A;  4N1I A;  4PVA A;  2EXJ A;  5FMC A;  4KC8 A;  4U6B A;  3WPZ A;  3ZXK A;  4QQS A;  3QZ4 A;  3U75 A;  4MLG A;  1UV4 A;  3VSR A;  4N2R A;  3R67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...