5A7VA

The gh130 family of mannoside phosphorylases contains glycoside hydrolases that target beta-1,2 mannosidic linkages in candida mannan
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
368
structure length
368
Chain Sequence
XASGQPSNDKKNVLPDWAFGGFERPQGANPVISPIENTKFYCPMTQDYVAWESNDTFNPAATLHDGKIVVLYRAEDKSGVGIGHRTSRLGYATSSDGIHFKREKTPVFYPDNDTQKKLEWPGGCEDPRIAVTAEGLYVMTYTQWNRHIPRLAIATSRNLKDWTKHGPAFAKAYDGKFFNLGCKSGSILTEVVNGKQVIKKIDGKYFMYWGEEHVFAATSEDLVNWTPYVNTDGSLRKLFSPRDGHFDSQLTECGPPAIYTPKGIVLLYNGKNSASRGDKRYTANVYAAGQALFDANDPTRFITRLDEPFFRPMDSFEKSGQYVDGTVFIEGMVYYKDKWYLYYGCADSKVGMAIYNPKKPAAADPLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PUTATIVE GLYCOSIDASE PH117-RELATED
publication title The Gh130 Family of Mannoside Phosphorylases Contains Glycoside Hydrolases that Target Beta-1,2 Mannosidic Linkages in Candida Mannan
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 91
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04041 Glyco_hydro_130 beta-1,4-mannooligosaccharide phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 5a7vA00
3CU9A 1Y9MA 5GLNA 3NQHA 3LDRA 2YFSA 1GYEB 5FMBA 4U6BA 4MLGA 2AC1A 2X8SA 3C7FA 1W18A 5FK7A 5A8DA 5JOYA 3U75A 3QEFA 3VSSA 3AKFA 3LDKA 3TAWA 4NOVA 5A8CA 4FFFA 4AK5A 3BYKA 3KSTA 1Y4WA 2EXIA 3WN2A 3BYNA 3PIJA 3ZXLA 3K1UA 3WMZA 3QEEA 1UYPA 3D60A 2ADEA 3PIGA 5AYEA 1YIFA 1Y9GA 3ZXJA 3WASA 4COTA 3LIGA 5GLQA 4FFIA 2X8TA 4N2RA 4N1IA 2YFRA 3LEMA 4AK6A 3OM2A 4UDJA 1UV4A 1ST8A 2AEZA 2QQVA 1Y7BA 3AKIA 1YRZA 5FMCA 3VSRA 3WMYA 4ONZA 2XQRA 3U14A 4KC8A 5A7VB 5FIXA 1PT2A 1WL7A 5GLOA 3LFIA 2AEYA 3LV4A 4N2ZA 5ANNA 5FK8A 3SC7X 4UDKA 3UGHA 2X8FA 3R4YA 3WN1A 4FFGA 3VT0A 3WAUA 3UGGA 3C7GA 5JOWA 5JOZA 3OM6A 1VKDA 3VT2A 3ZXKA 4N4BA 2EXHA 3VT1A 5GLKA 3BYLA 3OM5A 5A7VA 5C0PA 3VSZA 3KF5A 3WPZA 2VDTA 3KF3A 5FLWA 4AK7A 3WPUA 2OXBA 2QQUA 3C7HA 5AYDA 4O8OA 4EQVA 5B6TA 3VSFA 3AKGA 4PVIA 5FKCA 3LF7A 1W2TA 4KCBA 4O8PA 1GYHA 4PVAA 5FMDA 3OM7A 2YFTA 3D5ZA 3D5YA 1GYDB 3WATA 5GLRA 2ADDA 4UDGA 3WN0A 3WPVA 2QQWA 3C7OA 3OM4A 3RWKX 1OYGA 3LIHA 3R67A 4KMIA 1YI7A 3D61A 2B4WA 5B6SA 3UGFA 3R4ZA 5GLLA 3QEDA 3BYJA 4O8NA 2EXKA 3QZ4A 4FFHA 4UDKE 5AYCA 3P2NA 5GLPA 5AY9A 3C2UA 3AKHA 4KCAA 5GLMA 4QQSA 3QC2A 3WPYA 5FKBA 4UDIA 5JOXA 2EXJA 3C7EA 4KC7A 4U6DA 4D47A
chains in the Genus database with same CATH superfamily
3CU9A 1Y9MA 5GLNA 3NQHA 3LDRA 2YFSA 1GYEB 5FMBA 4U6BA 4MLGA 2AC1A 2X8SA 3C7FA 1W18A 5FK7A 5A8DA 5JOYA 1TL2A 3U75A 3QEFA 3VSSA 3AKFA 3LDKA 3TAWA 4NOVA 5A8CA 4FFFA 4AK5A 3BYKA 3KSTA 1Y4WA 2EXIA 3WN2A 3BYNA 3PIJA 3ZXLA 3K1UA 3WMZA 3QEEA 1UYPA 3D60A 2ADEA 3PIGA 5AYEA 1YIFA 1Y9GA 3ZXJA 3WASA 4COTA 3LIGA 5GLQA 4FFIA 2X8TA 4N2RA 4N1IA 2YFRA 3LEMA 4AK6A 3OM2A 4UDJA 1UV4A 1ST8A 2AEZA 2QQVA 1Y7BA 3AKIA 1YRZA 5FMCA 3VSRA 3WMYA 4ONZA 2XQRA 3U14A 4KC8A 5A7VB 5FIXA 1PT2A 1WL7A 5GLOA 3LFIA 2AEYA 3LV4A 4N2ZA 5ANNA 5FK8A 3SC7X 4UDKA 3UGHA 2X8FA 3R4YA 3WN1A 4FFGA 3VT0A 3WAUA 3UGGA 3C7GA 5JOWA 5JOZA 3OM6A 1VKDA 3VT2A 3ZXKA 4N4BA 2EXHA 3VT1A 5GLKA 3BYLA 3OM5A 5A7VA 5C0PA 3VSZA 3KF5A 3WPZA 5C2MA 2VDTA 3KF3A 5FLWA 4AK7A 3WPUA 2OXBA 2QQUA 3C7HA 5AYDA 4O8OA 4EQVA 5B6TA 3VSFA 3AKGA 4PVIA 5FKCA 3LF7A 1W2TA 4KCBA 4O8PA 1GYHA 4PVAA 5FMDA 3OM7A 2YFTA 3D5ZA 3D5YA 1GYDB 3WATA 5GLRA 2ADDA 4UDGA 3WN0A 3WPVA 2QQWA 3C7OA 3OM4A 3RWKX 1OYGA 3LIHA 3R67A 4KMIA 1YI7A 3D61A 2B4WA 5B6SA 3UGFA 3R4ZA 5GLLA 3QEDA 3BYJA 4O8NA 2EXKA 3QZ4A 4FFHA 4UDKE 5AYCA 3P2NA 5GLPA 5AY9A 3C2UA 3AKHA 4KCAA 5GLMA 4QQSA 3QC2A 3WPYA 5FKBA 4UDIA 5JOXA 2EXJA 3C7EA 4KC7A 4U6DA 4D47A
chains in the Genus database with same CATH topology
3CU9A 1Y9MA 5GLNA 3NQHA 3LDRA 2YFSA 1GYEB 5FMBA 4U6BA 4MLGA 2AC1A 2X8SA 3C7FA 1W18A 5FK7A 5A8DA 5JOYA 3U75A 3QEFA 3VSSA 3AKFA 3LDKA 3TAWA 4NOVA 5A8CA 4FFFA 4AK5A 3BYKA 3KSTA 1Y4WA 2EXIA 3WN2A 3BYNA 3PIJA 3ZXLA 3K1UA 3WMZA 3QEEA 1UYPA 3D60A 2ADEA 3PIGA 5AYEA 1YIFA 1Y9GA 3ZXJA 3WASA 4COTA 3LIGA 5GLQA 4FFIA 2X8TA 4N2RA 4N1IA 2YFRA 3LEMA 4AK6A 3OM2A 4UDJA 1UV4A 1ST8A 2AEZA 2QQVA 1Y7BA 3AKIA 1YRZA 5FMCA 3VSRA 3WMYA 4ONZA 2XQRA 3U14A 4KC8A 5A7VB 5FIXA 1PT2A 1WL7A 5GLOA 3LFIA 2AEYA 3LV4A 4N2ZA 5ANNA 5FK8A 3SC7X 4UDKA 3UGHA 2X8FA 3R4YA 3WN1A 4FFGA 3VT0A 3WAUA 3UGGA 3C7GA 5JOWA 5JOZA 3OM6A 1VKDA 3VT2A 3ZXKA 4N4BA 2EXHA 3VT1A 5GLKA 3BYLA 3OM5A 5A7VA 5C0PA 3VSZA 3KF5A 3WPZA 2VDTA 3KF3A 5FLWA 4AK7A 3WPUA 2OXBA 2QQUA 3C7HA 5AYDA 4O8OA 4EQVA 5B6TA 3VSFA 3AKGA 4PVIA 5FKCA 3LF7A 1W2TA 4KCBA 4O8PA 1GYHA 4PVAA 5FMDA 3OM7A 2YFTA 3D5ZA 3D5YA 1GYDB 3WATA 5GLRA 2ADDA 4UDGA 3WN0A 3WPVA 2QQWA 3C7OA 3OM4A 3RWKX 1OYGA 3LIHA 3R67A 4KMIA 1YI7A 3D61A 2B4WA 5B6SA 3UGFA 3R4ZA 5GLLA 3QEDA 3BYJA 4O8NA 2EXKA 3QZ4A 4FFHA 4UDKE 5AYCA 3P2NA 5GLPA 5AY9A 3C2UA 3AKHA 4KCAA 5GLMA 4QQSA 3QC2A 3WPYA 5FKBA 4UDIA 5JOXA 2EXJA 3C7EA 4KC7A 4U6DA 4D47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CU9 A;  1Y9M A;  5GLN A;  3NQH A;  3LDR A;  2YFS A;  1GYE B;  5FMB A;  4U6B A;  4MLG A;  2AC1 A;  2X8S A;  3C7F A;  1W18 A;  5FK7 A;  5A8D A;  5JOY A;  3U75 A;  3QEF A;  3VSS A;  3AKF A;  3LDK A;  3TAW A;  4NOV A;  5A8C A;  4FFF A;  4AK5 A;  3BYK A;  3KST A;  1Y4W A;  2EXI A;  3WN2 A;  3BYN A;  3PIJ A;  3ZXL A;  3K1U A;  3WMZ A;  3QEE A;  1UYP A;  3D60 A;  2ADE A;  3PIG A;  5AYE A;  1YIF A;  1Y9G A;  3ZXJ A;  3WAS A;  4COT A;  3LIG A;  5GLQ A;  4FFI A;  2X8T A;  4N2R A;  4N1I A;  2YFR A;  3LEM A;  4AK6 A;  3OM2 A;  4UDJ A;  1UV4 A;  1ST8 A;  2AEZ A;  2QQV A;  1Y7B A;  3AKI A;  1YRZ A;  5FMC A;  3VSR A;  3WMY A;  4ONZ A;  2XQR A;  3U14 A;  4KC8 A;  5A7V B;  5FIX A;  1PT2 A;  1WL7 A;  5GLO A;  3LFI A;  2AEY A;  3LV4 A;  4N2Z A;  5ANN A;  5FK8 A;  3SC7 X;  4UDK A;  3UGH A;  2X8F A;  3R4Y A;  3WN1 A;  4FFG A;  3VT0 A;  3WAU A;  3UGG A;  3C7G A;  5JOW A;  5JOZ A;  3OM6 A;  1VKD A;  3VT2 A;  3ZXK A;  4N4B A;  2EXH A;  3VT1 A;  5GLK A;  3BYL A;  3OM5 A;  5A7V A;  5C0P A;  3VSZ A;  3KF5 A;  3WPZ A;  2VDT A;  3KF3 A;  5FLW A;  4AK7 A;  3WPU A;  2OXB A;  2QQU A;  3C7H A;  5AYD A;  4O8O A;  4EQV A;  5B6T A;  3VSF A;  3AKG A;  4PVI A;  5FKC A;  3LF7 A;  1W2T A;  4KCB A;  4O8P A;  1GYH A;  4PVA A;  5FMD A;  3OM7 A;  2YFT A;  3D5Z A;  3D5Y A;  1GYD B;  3WAT A;  5GLR A;  2ADD A;  4UDG A;  3WN0 A;  3WPV A;  2QQW A;  3C7O A;  3OM4 A;  3RWK X;  1OYG A;  3LIH A;  3R67 A;  4KMI A;  1YI7 A;  3D61 A;  2B4W A;  5B6S A;  3UGF A;  3R4Z A;  5GLL A;  3QED A;  3BYJ A;  4O8N A;  2EXK A;  3QZ4 A;  4FFH A;  4UDK E;  5AYC A;  3P2N A;  5GLP A;  5AY9 A;  3C2U A;  3AKH A;  4KCA A;  5GLM A;  4QQS A;  3QC2 A;  3WPY A;  5FKB A;  4UDI A;  5JOX A;  2EXJ A;  3C7E A;  4KC7 A;  4U6D A;  4D47 A; 
#chains in the Genus database with same CATH topology
 3CU9 A;  1Y9M A;  5GLN A;  3NQH A;  3LDR A;  2YFS A;  1GYE B;  5FMB A;  4U6B A;  4MLG A;  2AC1 A;  2X8S A;  3C7F A;  1W18 A;  5FK7 A;  5A8D A;  5JOY A;  1TL2 A;  3U75 A;  3QEF A;  3VSS A;  3AKF A;  3LDK A;  3TAW A;  4NOV A;  5A8C A;  4FFF A;  4AK5 A;  3BYK A;  3KST A;  1Y4W A;  2EXI A;  3WN2 A;  3BYN A;  3PIJ A;  3ZXL A;  3K1U A;  3WMZ A;  3QEE A;  1UYP A;  3D60 A;  2ADE A;  3PIG A;  5AYE A;  1YIF A;  1Y9G A;  3ZXJ A;  3WAS A;  4COT A;  3LIG A;  5GLQ A;  4FFI A;  2X8T A;  4N2R A;  4N1I A;  2YFR A;  3LEM A;  4AK6 A;  3OM2 A;  4UDJ A;  1UV4 A;  1ST8 A;  2AEZ A;  2QQV A;  1Y7B A;  3AKI A;  1YRZ A;  5FMC A;  3VSR A;  3WMY A;  4ONZ A;  2XQR A;  3U14 A;  4KC8 A;  5A7V B;  5FIX A;  1PT2 A;  1WL7 A;  5GLO A;  3LFI A;  2AEY A;  3LV4 A;  4N2Z A;  5ANN A;  5FK8 A;  3SC7 X;  4UDK A;  3UGH A;  2X8F A;  3R4Y A;  3WN1 A;  4FFG A;  3VT0 A;  3WAU A;  3UGG A;  3C7G A;  5JOW A;  5JOZ A;  3OM6 A;  1VKD A;  3VT2 A;  3ZXK A;  4N4B A;  2EXH A;  3VT1 A;  5GLK A;  3BYL A;  3OM5 A;  5A7V A;  5C0P A;  3VSZ A;  3KF5 A;  3WPZ A;  5C2M A;  2VDT A;  3KF3 A;  5FLW A;  4AK7 A;  3WPU A;  2OXB A;  2QQU A;  3C7H A;  5AYD A;  4O8O A;  4EQV A;  5B6T A;  3VSF A;  3AKG A;  4PVI A;  5FKC A;  3LF7 A;  1W2T A;  4KCB A;  4O8P A;  1GYH A;  4PVA A;  5FMD A;  3OM7 A;  2YFT A;  3D5Z A;  3D5Y A;  1GYD B;  3WAT A;  5GLR A;  2ADD A;  4UDG A;  3WN0 A;  3WPV A;  2QQW A;  3C7O A;  3OM4 A;  3RWK X;  1OYG A;  3LIH A;  3R67 A;  4KMI A;  1YI7 A;  3D61 A;  2B4W A;  5B6S A;  3UGF A;  3R4Z A;  5GLL A;  3QED A;  3BYJ A;  4O8N A;  2EXK A;  3QZ4 A;  4FFH A;  4UDK E;  5AYC A;  3P2N A;  5GLP A;  5AY9 A;  3C2U A;  3AKH A;  4KCA A;  5GLM A;  4QQS A;  3QC2 A;  3WPY A;  5FKB A;  4UDI A;  5JOX A;  2EXJ A;  3C7E A;  4KC7 A;  4U6D A;  4D47 A; 
#chains in the Genus database with same CATH homology
 3CU9 A;  1Y9M A;  5GLN A;  3NQH A;  3LDR A;  2YFS A;  1GYE B;  5FMB A;  4U6B A;  4MLG A;  2AC1 A;  2X8S A;  3C7F A;  1W18 A;  5FK7 A;  5A8D A;  5JOY A;  3U75 A;  3QEF A;  3VSS A;  3AKF A;  3LDK A;  3TAW A;  4NOV A;  5A8C A;  4FFF A;  4AK5 A;  3BYK A;  3KST A;  1Y4W A;  2EXI A;  3WN2 A;  3BYN A;  3PIJ A;  3ZXL A;  3K1U A;  3WMZ A;  3QEE A;  1UYP A;  3D60 A;  2ADE A;  3PIG A;  5AYE A;  1YIF A;  1Y9G A;  3ZXJ A;  3WAS A;  4COT A;  3LIG A;  5GLQ A;  4FFI A;  2X8T A;  4N2R A;  4N1I A;  2YFR A;  3LEM A;  4AK6 A;  3OM2 A;  4UDJ A;  1UV4 A;  1ST8 A;  2AEZ A;  2QQV A;  1Y7B A;  3AKI A;  1YRZ A;  5FMC A;  3VSR A;  3WMY A;  4ONZ A;  2XQR A;  3U14 A;  4KC8 A;  5A7V B;  5FIX A;  1PT2 A;  1WL7 A;  5GLO A;  3LFI A;  2AEY A;  3LV4 A;  4N2Z A;  5ANN A;  5FK8 A;  3SC7 X;  4UDK A;  3UGH A;  2X8F A;  3R4Y A;  3WN1 A;  4FFG A;  3VT0 A;  3WAU A;  3UGG A;  3C7G A;  5JOW A;  5JOZ A;  3OM6 A;  1VKD A;  3VT2 A;  3ZXK A;  4N4B A;  2EXH A;  3VT1 A;  5GLK A;  3BYL A;  3OM5 A;  5A7V A;  5C0P A;  3VSZ A;  3KF5 A;  3WPZ A;  2VDT A;  3KF3 A;  5FLW A;  4AK7 A;  3WPU A;  2OXB A;  2QQU A;  3C7H A;  5AYD A;  4O8O A;  4EQV A;  5B6T A;  3VSF A;  3AKG A;  4PVI A;  5FKC A;  3LF7 A;  1W2T A;  4KCB A;  4O8P A;  1GYH A;  4PVA A;  5FMD A;  3OM7 A;  2YFT A;  3D5Z A;  3D5Y A;  1GYD B;  3WAT A;  5GLR A;  2ADD A;  4UDG A;  3WN0 A;  3WPV A;  2QQW A;  3C7O A;  3OM4 A;  3RWK X;  1OYG A;  3LIH A;  3R67 A;  4KMI A;  1YI7 A;  3D61 A;  2B4W A;  5B6S A;  3UGF A;  3R4Z A;  5GLL A;  3QED A;  3BYJ A;  4O8N A;  2EXK A;  3QZ4 A;  4FFH A;  4UDK E;  5AYC A;  3P2N A;  5GLP A;  5AY9 A;  3C2U A;  3AKH A;  4KCA A;  5GLM A;  4QQS A;  3QC2 A;  3WPY A;  5FKB A;  4UDI A;  5JOX A;  2EXJ A;  3C7E A;  4KC7 A;  4U6D A;  4D47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...