5A7VB

The gh130 family of mannoside phosphorylases contains glycoside hydrolases that target beta-1,2 mannosidic linkages in candida mannan
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
359
structure length
359
Chain Sequence
KKNVLPDWAFGGFERPQGANPVISPIENTKFYCPMTQDYVAWESNDTFNPAATLHDGKIVVLYRAEDKSGVGIGHRTSRLGYATSSDGIHFKREKTPVFYPDNDTQKKLEWPGGCEDPRIAVTAEGLYVMTYTQWNRHIPRLAIATSRNLKDWTKHGPAFAKAYDGKFFNLGCKSGSILTEVVNGKQVIKKIDGKYFMYWGEEHVFAATSEDLVNWTPYVNTDGSLRKLFSPRDGHFDSQLTECGPPAIYTPKGIVLLYNGKNSASRGDKRYTANVYAAGQALFDANDPTRFITRLDEPFFRPMDSFEKSGQYVDGTVFIEGMVYYKDKWYLYYGCADSKVGMAIYNPKKPAAADPLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PUTATIVE GLYCOSIDASE PH117-RELATED
publication title The Gh130 Family of Mannoside Phosphorylases Contains Glycoside Hydrolases that Target Beta-1,2 Mannosidic Linkages in Candida Mannan
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 92
structure length 359
sequence length 359
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04041 Glyco_hydro_130 beta-1,4-mannooligosaccharide phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 5a7vB00
5ANNA 4D47A 4UDIA 5FMDA 5GLQA 4UDGA 3U75A 5JOYA 2AC1A 2QQVA 3D61A 5FMCA 5A8CA 1W2TA 2QQWA 2QQUA 2VDTA 4O8NA 4PVAA 4FFFA 3UGFA 3WMYA 2AEYA 1PT2A 2X8TA 3WMZA 5GLLA 5GLNA 4N1IA 4FFGA 3LDRA 3K1UA 2YFTA 3D5ZA 1GYDB 1WL7A 3D5YA 3ZXJA 5AYEA 3OM7A 5A7VB 2XQRA 3C7HA 5B6TA 3ZXKA 5A7VA 3QEDA 4NOVA 3KF5A 1Y4WA 1YI7A 5JOXA 1GYEB 3VSFA 3C7EA 5GLRA 3AKGA 3C7OA 5FKCA 3VT0A 4UDKA 5A8DA 5JOZA 5JOWA 4KMIA 4ONZA 4AK6A 3PIGA 3WPVA 1YIFA 2ADDA 3BYKA 4UDJA 1GYHA 5C0PA 2EXHA 2OXBA 4UDKE 3R4ZA 1ST8A 4KCBA 3UGHA 1YRZA 3WN2A 5FLWA 3WPYA 1OYGA 4FFIA 3OM2A 4EQVA 4N2RA 3CU9A 5GLMA 4FFHA 5AY9A 4PVIA 3U14A 3WN1A 1Y9MA 2YFSA 2YFRA 4KC7A 4KC8A 4AK5A 1VKDA 3WPUA 3AKIA 5B6SA 3LFIA 3QEEA 2X8FA 5FK8A 3VSRA 3LEMA 3WATA 4AK7A 3QEFA 2B4WA 3WPZA 3WASA 3LIHA 5GLPA 3QC2A 3AKFA 3VSZA 3LDKA 1W18A 3R4YA 3OM5A 3BYLA 5FK7A 5AYDA 3QZ4A 5FMBA 3LV4A 1UYPA 5AYCA 4KCAA 3KSTA 1Y9GA 5FIXA 3AKHA 3OM4A 3KF3A 3OM6A 2EXIA 3BYJA 3PIJA 3NQHA 1Y7BA 4U6BA 3TAWA 5FKBA 3SC7X 3VT1A 3VSSA 3C7GA 2EXKA 3C2UA 3UGGA 3VT2A 4N2ZA 3ZXLA 3WN0A 3LF7A 4N4BA 2EXJA 3WAUA 4COTA 4O8PA 3R67A 5GLOA 2ADEA 1UV4A 3RWKX 2AEZA 3BYNA 4O8OA 3C7FA 4U6DA 4MLGA 2X8SA 3P2NA 3D60A 3LIGA 4QQSA 5GLKA
chains in the Genus database with same CATH superfamily
5ANNA 4D47A 4UDIA 5FMDA 5GLQA 4UDGA 3U75A 5JOYA 2AC1A 2QQVA 3D61A 5FMCA 5A8CA 1W2TA 2QQWA 2QQUA 2VDTA 4O8NA 4PVAA 4FFFA 3UGFA 3WMYA 2AEYA 1PT2A 2X8TA 3WMZA 5GLLA 5GLNA 1TL2A 4N1IA 4FFGA 3LDRA 3K1UA 2YFTA 3D5ZA 1GYDB 1WL7A 3D5YA 3ZXJA 5AYEA 3OM7A 5A7VB 2XQRA 3C7HA 5B6TA 3ZXKA 5A7VA 3QEDA 4NOVA 3KF5A 1Y4WA 1YI7A 5JOXA 1GYEB 3VSFA 3C7EA 5GLRA 3AKGA 3C7OA 5FKCA 3VT0A 4UDKA 5A8DA 5JOZA 5JOWA 4KMIA 4ONZA 4AK6A 3PIGA 3WPVA 1YIFA 2ADDA 3BYKA 4UDJA 1GYHA 5C0PA 2EXHA 2OXBA 4UDKE 3R4ZA 1ST8A 4KCBA 3UGHA 1YRZA 3WN2A 5FLWA 3WPYA 5C2MA 1OYGA 4FFIA 3OM2A 4EQVA 4N2RA 3CU9A 5GLMA 4FFHA 5AY9A 4PVIA 3U14A 3WN1A 1Y9MA 2YFSA 2YFRA 4KC7A 4KC8A 4AK5A 1VKDA 3WPUA 3AKIA 5B6SA 3LFIA 3QEEA 2X8FA 5FK8A 3VSRA 3LEMA 3WATA 4AK7A 3QEFA 2B4WA 3WPZA 3WASA 3LIHA 5GLPA 3QC2A 3AKFA 3VSZA 3LDKA 1W18A 3R4YA 3OM5A 3BYLA 5FK7A 5AYDA 3QZ4A 5FMBA 3LV4A 1UYPA 5AYCA 4KCAA 3KSTA 1Y9GA 5FIXA 3AKHA 3OM4A 3KF3A 3OM6A 2EXIA 3BYJA 3PIJA 3NQHA 1Y7BA 4U6BA 3TAWA 5FKBA 3SC7X 3VT1A 3VSSA 3C7GA 2EXKA 3C2UA 3UGGA 3VT2A 4N2ZA 3ZXLA 3WN0A 3LF7A 4N4BA 2EXJA 3WAUA 4COTA 4O8PA 3R67A 5GLOA 2ADEA 1UV4A 3RWKX 2AEZA 3BYNA 4O8OA 3C7FA 4U6DA 4MLGA 2X8SA 3P2NA 3D60A 3LIGA 4QQSA 5GLKA
chains in the Genus database with same CATH topology
5ANNA 4D47A 4UDIA 5FMDA 5GLQA 4UDGA 3U75A 5JOYA 2AC1A 2QQVA 3D61A 5FMCA 5A8CA 1W2TA 2QQWA 2QQUA 2VDTA 4O8NA 4PVAA 4FFFA 3UGFA 3WMYA 2AEYA 1PT2A 2X8TA 3WMZA 5GLLA 5GLNA 4N1IA 4FFGA 3LDRA 3K1UA 2YFTA 3D5ZA 1GYDB 1WL7A 3D5YA 3ZXJA 5AYEA 3OM7A 5A7VB 2XQRA 3C7HA 5B6TA 3ZXKA 5A7VA 3QEDA 4NOVA 3KF5A 1Y4WA 1YI7A 5JOXA 1GYEB 3VSFA 3C7EA 5GLRA 3AKGA 3C7OA 5FKCA 3VT0A 4UDKA 5A8DA 5JOZA 5JOWA 4KMIA 4ONZA 4AK6A 3PIGA 3WPVA 1YIFA 2ADDA 3BYKA 4UDJA 1GYHA 5C0PA 2EXHA 2OXBA 4UDKE 3R4ZA 1ST8A 4KCBA 3UGHA 1YRZA 3WN2A 5FLWA 3WPYA 1OYGA 4FFIA 3OM2A 4EQVA 4N2RA 3CU9A 5GLMA 4FFHA 5AY9A 4PVIA 3U14A 3WN1A 1Y9MA 2YFSA 2YFRA 4KC7A 4KC8A 4AK5A 1VKDA 3WPUA 3AKIA 5B6SA 3LFIA 3QEEA 2X8FA 5FK8A 3VSRA 3LEMA 3WATA 4AK7A 3QEFA 2B4WA 3WPZA 3WASA 3LIHA 5GLPA 3QC2A 3AKFA 3VSZA 3LDKA 1W18A 3R4YA 3OM5A 3BYLA 5FK7A 5AYDA 3QZ4A 5FMBA 3LV4A 1UYPA 5AYCA 4KCAA 3KSTA 1Y9GA 5FIXA 3AKHA 3OM4A 3KF3A 3OM6A 2EXIA 3BYJA 3PIJA 3NQHA 1Y7BA 4U6BA 3TAWA 5FKBA 3SC7X 3VT1A 3VSSA 3C7GA 2EXKA 3C2UA 3UGGA 3VT2A 4N2ZA 3ZXLA 3WN0A 3LF7A 4N4BA 2EXJA 3WAUA 4COTA 4O8PA 3R67A 5GLOA 2ADEA 1UV4A 3RWKX 2AEZA 3BYNA 4O8OA 3C7FA 4U6DA 4MLGA 2X8SA 3P2NA 3D60A 3LIGA 4QQSA 5GLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ANN A;  4D47 A;  4UDI A;  5FMD A;  5GLQ A;  4UDG A;  3U75 A;  5JOY A;  2AC1 A;  2QQV A;  3D61 A;  5FMC A;  5A8C A;  1W2T A;  2QQW A;  2QQU A;  2VDT A;  4O8N A;  4PVA A;  4FFF A;  3UGF A;  3WMY A;  2AEY A;  1PT2 A;  2X8T A;  3WMZ A;  5GLL A;  5GLN A;  4N1I A;  4FFG A;  3LDR A;  3K1U A;  2YFT A;  3D5Z A;  1GYD B;  1WL7 A;  3D5Y A;  3ZXJ A;  5AYE A;  3OM7 A;  5A7V B;  2XQR A;  3C7H A;  5B6T A;  3ZXK A;  5A7V A;  3QED A;  4NOV A;  3KF5 A;  1Y4W A;  1YI7 A;  5JOX A;  1GYE B;  3VSF A;  3C7E A;  5GLR A;  3AKG A;  3C7O A;  5FKC A;  3VT0 A;  4UDK A;  5A8D A;  5JOZ A;  5JOW A;  4KMI A;  4ONZ A;  4AK6 A;  3PIG A;  3WPV A;  1YIF A;  2ADD A;  3BYK A;  4UDJ A;  1GYH A;  5C0P A;  2EXH A;  2OXB A;  4UDK E;  3R4Z A;  1ST8 A;  4KCB A;  3UGH A;  1YRZ A;  3WN2 A;  5FLW A;  3WPY A;  1OYG A;  4FFI A;  3OM2 A;  4EQV A;  4N2R A;  3CU9 A;  5GLM A;  4FFH A;  5AY9 A;  4PVI A;  3U14 A;  3WN1 A;  1Y9M A;  2YFS A;  2YFR A;  4KC7 A;  4KC8 A;  4AK5 A;  1VKD A;  3WPU A;  3AKI A;  5B6S A;  3LFI A;  3QEE A;  2X8F A;  5FK8 A;  3VSR A;  3LEM A;  3WAT A;  4AK7 A;  3QEF A;  2B4W A;  3WPZ A;  3WAS A;  3LIH A;  5GLP A;  3QC2 A;  3AKF A;  3VSZ A;  3LDK A;  1W18 A;  3R4Y A;  3OM5 A;  3BYL A;  5FK7 A;  5AYD A;  3QZ4 A;  5FMB A;  3LV4 A;  1UYP A;  5AYC A;  4KCA A;  3KST A;  1Y9G A;  5FIX A;  3AKH A;  3OM4 A;  3KF3 A;  3OM6 A;  2EXI A;  3BYJ A;  3PIJ A;  3NQH A;  1Y7B A;  4U6B A;  3TAW A;  5FKB A;  3SC7 X;  3VT1 A;  3VSS A;  3C7G A;  2EXK A;  3C2U A;  3UGG A;  3VT2 A;  4N2Z A;  3ZXL A;  3WN0 A;  3LF7 A;  4N4B A;  2EXJ A;  3WAU A;  4COT A;  4O8P A;  3R67 A;  5GLO A;  2ADE A;  1UV4 A;  3RWK X;  2AEZ A;  3BYN A;  4O8O A;  3C7F A;  4U6D A;  4MLG A;  2X8S A;  3P2N A;  3D60 A;  3LIG A;  4QQS A;  5GLK A; 
#chains in the Genus database with same CATH topology
 5ANN A;  4D47 A;  4UDI A;  5FMD A;  5GLQ A;  4UDG A;  3U75 A;  5JOY A;  2AC1 A;  2QQV A;  3D61 A;  5FMC A;  5A8C A;  1W2T A;  2QQW A;  2QQU A;  2VDT A;  4O8N A;  4PVA A;  4FFF A;  3UGF A;  3WMY A;  2AEY A;  1PT2 A;  2X8T A;  3WMZ A;  5GLL A;  5GLN A;  1TL2 A;  4N1I A;  4FFG A;  3LDR A;  3K1U A;  2YFT A;  3D5Z A;  1GYD B;  1WL7 A;  3D5Y A;  3ZXJ A;  5AYE A;  3OM7 A;  5A7V B;  2XQR A;  3C7H A;  5B6T A;  3ZXK A;  5A7V A;  3QED A;  4NOV A;  3KF5 A;  1Y4W A;  1YI7 A;  5JOX A;  1GYE B;  3VSF A;  3C7E A;  5GLR A;  3AKG A;  3C7O A;  5FKC A;  3VT0 A;  4UDK A;  5A8D A;  5JOZ A;  5JOW A;  4KMI A;  4ONZ A;  4AK6 A;  3PIG A;  3WPV A;  1YIF A;  2ADD A;  3BYK A;  4UDJ A;  1GYH A;  5C0P A;  2EXH A;  2OXB A;  4UDK E;  3R4Z A;  1ST8 A;  4KCB A;  3UGH A;  1YRZ A;  3WN2 A;  5FLW A;  3WPY A;  5C2M A;  1OYG A;  4FFI A;  3OM2 A;  4EQV A;  4N2R A;  3CU9 A;  5GLM A;  4FFH A;  5AY9 A;  4PVI A;  3U14 A;  3WN1 A;  1Y9M A;  2YFS A;  2YFR A;  4KC7 A;  4KC8 A;  4AK5 A;  1VKD A;  3WPU A;  3AKI A;  5B6S A;  3LFI A;  3QEE A;  2X8F A;  5FK8 A;  3VSR A;  3LEM A;  3WAT A;  4AK7 A;  3QEF A;  2B4W A;  3WPZ A;  3WAS A;  3LIH A;  5GLP A;  3QC2 A;  3AKF A;  3VSZ A;  3LDK A;  1W18 A;  3R4Y A;  3OM5 A;  3BYL A;  5FK7 A;  5AYD A;  3QZ4 A;  5FMB A;  3LV4 A;  1UYP A;  5AYC A;  4KCA A;  3KST A;  1Y9G A;  5FIX A;  3AKH A;  3OM4 A;  3KF3 A;  3OM6 A;  2EXI A;  3BYJ A;  3PIJ A;  3NQH A;  1Y7B A;  4U6B A;  3TAW A;  5FKB A;  3SC7 X;  3VT1 A;  3VSS A;  3C7G A;  2EXK A;  3C2U A;  3UGG A;  3VT2 A;  4N2Z A;  3ZXL A;  3WN0 A;  3LF7 A;  4N4B A;  2EXJ A;  3WAU A;  4COT A;  4O8P A;  3R67 A;  5GLO A;  2ADE A;  1UV4 A;  3RWK X;  2AEZ A;  3BYN A;  4O8O A;  3C7F A;  4U6D A;  4MLG A;  2X8S A;  3P2N A;  3D60 A;  3LIG A;  4QQS A;  5GLK A; 
#chains in the Genus database with same CATH homology
 5ANN A;  4D47 A;  4UDI A;  5FMD A;  5GLQ A;  4UDG A;  3U75 A;  5JOY A;  2AC1 A;  2QQV A;  3D61 A;  5FMC A;  5A8C A;  1W2T A;  2QQW A;  2QQU A;  2VDT A;  4O8N A;  4PVA A;  4FFF A;  3UGF A;  3WMY A;  2AEY A;  1PT2 A;  2X8T A;  3WMZ A;  5GLL A;  5GLN A;  4N1I A;  4FFG A;  3LDR A;  3K1U A;  2YFT A;  3D5Z A;  1GYD B;  1WL7 A;  3D5Y A;  3ZXJ A;  5AYE A;  3OM7 A;  5A7V B;  2XQR A;  3C7H A;  5B6T A;  3ZXK A;  5A7V A;  3QED A;  4NOV A;  3KF5 A;  1Y4W A;  1YI7 A;  5JOX A;  1GYE B;  3VSF A;  3C7E A;  5GLR A;  3AKG A;  3C7O A;  5FKC A;  3VT0 A;  4UDK A;  5A8D A;  5JOZ A;  5JOW A;  4KMI A;  4ONZ A;  4AK6 A;  3PIG A;  3WPV A;  1YIF A;  2ADD A;  3BYK A;  4UDJ A;  1GYH A;  5C0P A;  2EXH A;  2OXB A;  4UDK E;  3R4Z A;  1ST8 A;  4KCB A;  3UGH A;  1YRZ A;  3WN2 A;  5FLW A;  3WPY A;  1OYG A;  4FFI A;  3OM2 A;  4EQV A;  4N2R A;  3CU9 A;  5GLM A;  4FFH A;  5AY9 A;  4PVI A;  3U14 A;  3WN1 A;  1Y9M A;  2YFS A;  2YFR A;  4KC7 A;  4KC8 A;  4AK5 A;  1VKD A;  3WPU A;  3AKI A;  5B6S A;  3LFI A;  3QEE A;  2X8F A;  5FK8 A;  3VSR A;  3LEM A;  3WAT A;  4AK7 A;  3QEF A;  2B4W A;  3WPZ A;  3WAS A;  3LIH A;  5GLP A;  3QC2 A;  3AKF A;  3VSZ A;  3LDK A;  1W18 A;  3R4Y A;  3OM5 A;  3BYL A;  5FK7 A;  5AYD A;  3QZ4 A;  5FMB A;  3LV4 A;  1UYP A;  5AYC A;  4KCA A;  3KST A;  1Y9G A;  5FIX A;  3AKH A;  3OM4 A;  3KF3 A;  3OM6 A;  2EXI A;  3BYJ A;  3PIJ A;  3NQH A;  1Y7B A;  4U6B A;  3TAW A;  5FKB A;  3SC7 X;  3VT1 A;  3VSS A;  3C7G A;  2EXK A;  3C2U A;  3UGG A;  3VT2 A;  4N2Z A;  3ZXL A;  3WN0 A;  3LF7 A;  4N4B A;  2EXJ A;  3WAU A;  4COT A;  4O8P A;  3R67 A;  5GLO A;  2ADE A;  1UV4 A;  3RWK X;  2AEZ A;  3BYN A;  4O8O A;  3C7F A;  4U6D A;  4MLG A;  2X8S A;  3P2N A;  3D60 A;  3LIG A;  4QQS A;  5GLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...