5A8CA

The ultra high resolution structure of a novel alpha-l-arabinofuranosidase (ctgh43) from clostridium thermocellum atcc 27405 with bound trimethyl n-oxide (trs)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
299
structure length
299
Chain Sequence
ADYPIFSQRFTADPAAVVYNGRLYIYCSHDSDATPGQSTYNIPDITCISTDDLKNWTDHGEVFNAKRDSRWASVSWAPSIVYRNNKFYLYYGNGGNGIGVAVSDSPTGPFKDPLPGPLVSWNTPGVQPAQNMWLFDPGVFVDDDGQAYMYFGGNGQNNIRVIKLGNDMISTVGSAMTMSAPRFFEAAYMHKYNGKYYFSYASDFSQGASKIEYMMSDKPTTGFQYKGVILPQPPDNYSNNNHHAIVEYKGNWYVVYHNRTVAKQRGLDPVYQRNVCIDQMFYNADGTIKQVVPTVDGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Molecular determinants of substrate specificity revealed by the structure of Clostridium thermocellum arabinofuranosidase 43A from glycosyl hydrolase family 43 subfamily 16.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 81
structure length 299
sequence length 299
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 5a8cA00
3QEFA 4KC7A 3ZXKA 1UYPA 3LV4A 3WN1A 3KSTA 4N4BA 3ZXLA 4UDJA 3QC2A 1YI7A 1W2TA 3VT2A 3WMZA 4O8NA 3WATA 3K1UA 5B6TA 3PIJA 4KCBA 2YFSA 2YFTA 3C2UA 4KC8A 1Y7BA 3AKFA 3LF7A 1GYHA 1WL7A 2X8FA 3UGGA 3TAWA 5AYEA 5GLLA 3VSSA 3WPYA 4KCAA 4O8OA 5FLWA 4U6DA 4AK6A 2OXBA 3QEEA 5A7VB 3LEMA 2ADEA 2EXKA 2EXJA 5AY9A 4NOVA 3VSFA 3C7HA 3SC7X 4MLGA 3WAUA 3WPVA 3LDKA 4N1IA 5JOZA 5A8CA 2QQWA 3LDRA 4PVIA 4FFIA 3KF5A 4COTA 4U6BA 3LIHA 3D5YA 5ANNA 5GLKA 4QQSA 5A8DA 1PT2A 1YRZA 2ADDA 4FFFA 1UV4A 3QZ4A 5JOWA 5GLPA 3AKHA 3D5ZA 4FFGA 1Y9GA 4UDKE 5FMCA 1YIFA 5GLOA 3U14A 3VT0A 3ZXJA 3WPUA 1VKDA 2AC1A 2AEZA 5B6SA 3BYKA 4UDKA 5C0PA 2EXIA 5AYCA 3CU9A 3WN2A 3BYJA 3R4ZA 4O8PA 3OM7A 3KF3A 2QQUA 4FFHA 3WASA 5JOYA 1ST8A 4PVAA 5FMDA 3VT1A 1OYGA 1GYDB 3AKIA 5GLMA 3C7OA 4ONZA 1GYEB 3UGHA 2XQRA 3D60A 4D47A 2QQVA 3RWKX 5FKBA 3UGFA 3AKGA 3OM4A 5JOXA 3QEDA 5FK8A 3OM5A 3C7EA 2YFRA 5FIXA 3R4YA 3R67A 3PIGA 2B4WA 3BYLA 1Y9MA 3VSRA 5A7VA 4AK5A 5FK7A 4AK7A 2VDTA 3WPZA 4EQVA 2EXHA 4N2RA 3P2NA 3BYNA 4KMIA 1Y4WA 3NQHA 4UDIA 2X8SA 4UDGA 5GLRA 2X8TA 3LFIA 3VSZA 5GLQA 3WMYA 3OM6A 3OM2A 5FKCA 5GLNA 3WN0A 1W18A 3D61A 3C7GA 2AEYA 5FMBA 5AYDA 3U75A 4N2ZA 3LIGA 3C7FA
chains in the Genus database with same CATH superfamily
3QEFA 4KC7A 3ZXKA 1UYPA 3LV4A 3WN1A 3KSTA 4N4BA 3ZXLA 4UDJA 3QC2A 1YI7A 1W2TA 3VT2A 3WMZA 4O8NA 3WATA 3K1UA 5B6TA 3PIJA 4KCBA 2YFSA 2YFTA 5C2MA 3C2UA 4KC8A 1Y7BA 3AKFA 3LF7A 1GYHA 1WL7A 2X8FA 3UGGA 3TAWA 5AYEA 5GLLA 3VSSA 3WPYA 4KCAA 4O8OA 5FLWA 4U6DA 4AK6A 2OXBA 3QEEA 5A7VB 3LEMA 2ADEA 2EXKA 2EXJA 5AY9A 4NOVA 3VSFA 3C7HA 3SC7X 4MLGA 3WAUA 3WPVA 3LDKA 4N1IA 5JOZA 5A8CA 2QQWA 3LDRA 4PVIA 4FFIA 3KF5A 4COTA 4U6BA 3LIHA 3D5YA 5ANNA 5GLKA 4QQSA 5A8DA 1PT2A 1YRZA 2ADDA 4FFFA 1UV4A 3QZ4A 5JOWA 5GLPA 3AKHA 3D5ZA 4FFGA 1Y9GA 4UDKE 5FMCA 1YIFA 5GLOA 3U14A 3VT0A 3ZXJA 3WPUA 1VKDA 2AC1A 2AEZA 5B6SA 3BYKA 4UDKA 5C0PA 2EXIA 5AYCA 3CU9A 3WN2A 3BYJA 3R4ZA 4O8PA 3OM7A 3KF3A 2QQUA 4FFHA 3WASA 5JOYA 1ST8A 4PVAA 5FMDA 3VT1A 1OYGA 1GYDB 3AKIA 5GLMA 3C7OA 4ONZA 1GYEB 3UGHA 2XQRA 3D60A 4D47A 2QQVA 3RWKX 5FKBA 3UGFA 3AKGA 3OM4A 5JOXA 3QEDA 5FK8A 3OM5A 3C7EA 2YFRA 5FIXA 3R4YA 3R67A 3PIGA 2B4WA 3BYLA 1Y9MA 3VSRA 1TL2A 5A7VA 4AK5A 5FK7A 4AK7A 2VDTA 3WPZA 4EQVA 2EXHA 4N2RA 3P2NA 3BYNA 4KMIA 1Y4WA 3NQHA 4UDIA 2X8SA 4UDGA 5GLRA 2X8TA 3LFIA 3VSZA 5GLQA 3WMYA 3OM6A 3OM2A 5FKCA 5GLNA 3WN0A 1W18A 3D61A 3C7GA 2AEYA 5FMBA 5AYDA 3U75A 4N2ZA 3LIGA 3C7FA
chains in the Genus database with same CATH topology
3QEFA 4KC7A 3ZXKA 1UYPA 3LV4A 3WN1A 3KSTA 4N4BA 3ZXLA 4UDJA 3QC2A 1YI7A 1W2TA 3VT2A 3WMZA 4O8NA 3WATA 3K1UA 5B6TA 3PIJA 4KCBA 2YFSA 2YFTA 3C2UA 4KC8A 1Y7BA 3AKFA 3LF7A 1GYHA 1WL7A 2X8FA 3UGGA 3TAWA 5AYEA 5GLLA 3VSSA 3WPYA 4KCAA 4O8OA 5FLWA 4U6DA 4AK6A 2OXBA 3QEEA 5A7VB 3LEMA 2ADEA 2EXKA 2EXJA 5AY9A 4NOVA 3VSFA 3C7HA 3SC7X 4MLGA 3WAUA 3WPVA 3LDKA 4N1IA 5JOZA 5A8CA 2QQWA 3LDRA 4PVIA 4FFIA 3KF5A 4COTA 4U6BA 3LIHA 3D5YA 5ANNA 5GLKA 4QQSA 5A8DA 1PT2A 1YRZA 2ADDA 4FFFA 1UV4A 3QZ4A 5JOWA 5GLPA 3AKHA 3D5ZA 4FFGA 1Y9GA 4UDKE 5FMCA 1YIFA 5GLOA 3U14A 3VT0A 3ZXJA 3WPUA 1VKDA 2AC1A 2AEZA 5B6SA 3BYKA 4UDKA 5C0PA 2EXIA 5AYCA 3CU9A 3WN2A 3BYJA 3R4ZA 4O8PA 3OM7A 3KF3A 2QQUA 4FFHA 3WASA 5JOYA 1ST8A 4PVAA 5FMDA 3VT1A 1OYGA 1GYDB 3AKIA 5GLMA 3C7OA 4ONZA 1GYEB 3UGHA 2XQRA 3D60A 4D47A 2QQVA 3RWKX 5FKBA 3UGFA 3AKGA 3OM4A 5JOXA 3QEDA 5FK8A 3OM5A 3C7EA 2YFRA 5FIXA 3R4YA 3R67A 3PIGA 2B4WA 3BYLA 1Y9MA 3VSRA 5A7VA 4AK5A 5FK7A 4AK7A 2VDTA 3WPZA 4EQVA 2EXHA 4N2RA 3P2NA 3BYNA 4KMIA 1Y4WA 3NQHA 4UDIA 2X8SA 4UDGA 5GLRA 2X8TA 3LFIA 3VSZA 5GLQA 3WMYA 3OM6A 3OM2A 5FKCA 5GLNA 3WN0A 1W18A 3D61A 3C7GA 2AEYA 5FMBA 5AYDA 3U75A 4N2ZA 3LIGA 3C7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QEF A;  4KC7 A;  3ZXK A;  1UYP A;  3LV4 A;  3WN1 A;  3KST A;  4N4B A;  3ZXL A;  4UDJ A;  3QC2 A;  1YI7 A;  1W2T A;  3VT2 A;  3WMZ A;  4O8N A;  3WAT A;  3K1U A;  5B6T A;  3PIJ A;  4KCB A;  2YFS A;  2YFT A;  3C2U A;  4KC8 A;  1Y7B A;  3AKF A;  3LF7 A;  1GYH A;  1WL7 A;  2X8F A;  3UGG A;  3TAW A;  5AYE A;  5GLL A;  3VSS A;  3WPY A;  4KCA A;  4O8O A;  5FLW A;  4U6D A;  4AK6 A;  2OXB A;  3QEE A;  5A7V B;  3LEM A;  2ADE A;  2EXK A;  2EXJ A;  5AY9 A;  4NOV A;  3VSF A;  3C7H A;  3SC7 X;  4MLG A;  3WAU A;  3WPV A;  3LDK A;  4N1I A;  5JOZ A;  5A8C A;  2QQW A;  3LDR A;  4PVI A;  4FFI A;  3KF5 A;  4COT A;  4U6B A;  3LIH A;  3D5Y A;  5ANN A;  5GLK A;  4QQS A;  5A8D A;  1PT2 A;  1YRZ A;  2ADD A;  4FFF A;  1UV4 A;  3QZ4 A;  5JOW A;  5GLP A;  3AKH A;  3D5Z A;  4FFG A;  1Y9G A;  4UDK E;  5FMC A;  1YIF A;  5GLO A;  3U14 A;  3VT0 A;  3ZXJ A;  3WPU A;  1VKD A;  2AC1 A;  2AEZ A;  5B6S A;  3BYK A;  4UDK A;  5C0P A;  2EXI A;  5AYC A;  3CU9 A;  3WN2 A;  3BYJ A;  3R4Z A;  4O8P A;  3OM7 A;  3KF3 A;  2QQU A;  4FFH A;  3WAS A;  5JOY A;  1ST8 A;  4PVA A;  5FMD A;  3VT1 A;  1OYG A;  1GYD B;  3AKI A;  5GLM A;  3C7O A;  4ONZ A;  1GYE B;  3UGH A;  2XQR A;  3D60 A;  4D47 A;  2QQV A;  3RWK X;  5FKB A;  3UGF A;  3AKG A;  3OM4 A;  5JOX A;  3QED A;  5FK8 A;  3OM5 A;  3C7E A;  2YFR A;  5FIX A;  3R4Y A;  3R67 A;  3PIG A;  2B4W A;  3BYL A;  1Y9M A;  3VSR A;  5A7V A;  4AK5 A;  5FK7 A;  4AK7 A;  2VDT A;  3WPZ A;  4EQV A;  2EXH A;  4N2R A;  3P2N A;  3BYN A;  4KMI A;  1Y4W A;  3NQH A;  4UDI A;  2X8S A;  4UDG A;  5GLR A;  2X8T A;  3LFI A;  3VSZ A;  5GLQ A;  3WMY A;  3OM6 A;  3OM2 A;  5FKC A;  5GLN A;  3WN0 A;  1W18 A;  3D61 A;  3C7G A;  2AEY A;  5FMB A;  5AYD A;  3U75 A;  4N2Z A;  3LIG A;  3C7F A; 
#chains in the Genus database with same CATH topology
 3QEF A;  4KC7 A;  3ZXK A;  1UYP A;  3LV4 A;  3WN1 A;  3KST A;  4N4B A;  3ZXL A;  4UDJ A;  3QC2 A;  1YI7 A;  1W2T A;  3VT2 A;  3WMZ A;  4O8N A;  3WAT A;  3K1U A;  5B6T A;  3PIJ A;  4KCB A;  2YFS A;  2YFT A;  5C2M A;  3C2U A;  4KC8 A;  1Y7B A;  3AKF A;  3LF7 A;  1GYH A;  1WL7 A;  2X8F A;  3UGG A;  3TAW A;  5AYE A;  5GLL A;  3VSS A;  3WPY A;  4KCA A;  4O8O A;  5FLW A;  4U6D A;  4AK6 A;  2OXB A;  3QEE A;  5A7V B;  3LEM A;  2ADE A;  2EXK A;  2EXJ A;  5AY9 A;  4NOV A;  3VSF A;  3C7H A;  3SC7 X;  4MLG A;  3WAU A;  3WPV A;  3LDK A;  4N1I A;  5JOZ A;  5A8C A;  2QQW A;  3LDR A;  4PVI A;  4FFI A;  3KF5 A;  4COT A;  4U6B A;  3LIH A;  3D5Y A;  5ANN A;  5GLK A;  4QQS A;  5A8D A;  1PT2 A;  1YRZ A;  2ADD A;  4FFF A;  1UV4 A;  3QZ4 A;  5JOW A;  5GLP A;  3AKH A;  3D5Z A;  4FFG A;  1Y9G A;  4UDK E;  5FMC A;  1YIF A;  5GLO A;  3U14 A;  3VT0 A;  3ZXJ A;  3WPU A;  1VKD A;  2AC1 A;  2AEZ A;  5B6S A;  3BYK A;  4UDK A;  5C0P A;  2EXI A;  5AYC A;  3CU9 A;  3WN2 A;  3BYJ A;  3R4Z A;  4O8P A;  3OM7 A;  3KF3 A;  2QQU A;  4FFH A;  3WAS A;  5JOY A;  1ST8 A;  4PVA A;  5FMD A;  3VT1 A;  1OYG A;  1GYD B;  3AKI A;  5GLM A;  3C7O A;  4ONZ A;  1GYE B;  3UGH A;  2XQR A;  3D60 A;  4D47 A;  2QQV A;  3RWK X;  5FKB A;  3UGF A;  3AKG A;  3OM4 A;  5JOX A;  3QED A;  5FK8 A;  3OM5 A;  3C7E A;  2YFR A;  5FIX A;  3R4Y A;  3R67 A;  3PIG A;  2B4W A;  3BYL A;  1Y9M A;  3VSR A;  1TL2 A;  5A7V A;  4AK5 A;  5FK7 A;  4AK7 A;  2VDT A;  3WPZ A;  4EQV A;  2EXH A;  4N2R A;  3P2N A;  3BYN A;  4KMI A;  1Y4W A;  3NQH A;  4UDI A;  2X8S A;  4UDG A;  5GLR A;  2X8T A;  3LFI A;  3VSZ A;  5GLQ A;  3WMY A;  3OM6 A;  3OM2 A;  5FKC A;  5GLN A;  3WN0 A;  1W18 A;  3D61 A;  3C7G A;  2AEY A;  5FMB A;  5AYD A;  3U75 A;  4N2Z A;  3LIG A;  3C7F A; 
#chains in the Genus database with same CATH homology
 3QEF A;  4KC7 A;  3ZXK A;  1UYP A;  3LV4 A;  3WN1 A;  3KST A;  4N4B A;  3ZXL A;  4UDJ A;  3QC2 A;  1YI7 A;  1W2T A;  3VT2 A;  3WMZ A;  4O8N A;  3WAT A;  3K1U A;  5B6T A;  3PIJ A;  4KCB A;  2YFS A;  2YFT A;  3C2U A;  4KC8 A;  1Y7B A;  3AKF A;  3LF7 A;  1GYH A;  1WL7 A;  2X8F A;  3UGG A;  3TAW A;  5AYE A;  5GLL A;  3VSS A;  3WPY A;  4KCA A;  4O8O A;  5FLW A;  4U6D A;  4AK6 A;  2OXB A;  3QEE A;  5A7V B;  3LEM A;  2ADE A;  2EXK A;  2EXJ A;  5AY9 A;  4NOV A;  3VSF A;  3C7H A;  3SC7 X;  4MLG A;  3WAU A;  3WPV A;  3LDK A;  4N1I A;  5JOZ A;  5A8C A;  2QQW A;  3LDR A;  4PVI A;  4FFI A;  3KF5 A;  4COT A;  4U6B A;  3LIH A;  3D5Y A;  5ANN A;  5GLK A;  4QQS A;  5A8D A;  1PT2 A;  1YRZ A;  2ADD A;  4FFF A;  1UV4 A;  3QZ4 A;  5JOW A;  5GLP A;  3AKH A;  3D5Z A;  4FFG A;  1Y9G A;  4UDK E;  5FMC A;  1YIF A;  5GLO A;  3U14 A;  3VT0 A;  3ZXJ A;  3WPU A;  1VKD A;  2AC1 A;  2AEZ A;  5B6S A;  3BYK A;  4UDK A;  5C0P A;  2EXI A;  5AYC A;  3CU9 A;  3WN2 A;  3BYJ A;  3R4Z A;  4O8P A;  3OM7 A;  3KF3 A;  2QQU A;  4FFH A;  3WAS A;  5JOY A;  1ST8 A;  4PVA A;  5FMD A;  3VT1 A;  1OYG A;  1GYD B;  3AKI A;  5GLM A;  3C7O A;  4ONZ A;  1GYE B;  3UGH A;  2XQR A;  3D60 A;  4D47 A;  2QQV A;  3RWK X;  5FKB A;  3UGF A;  3AKG A;  3OM4 A;  5JOX A;  3QED A;  5FK8 A;  3OM5 A;  3C7E A;  2YFR A;  5FIX A;  3R4Y A;  3R67 A;  3PIG A;  2B4W A;  3BYL A;  1Y9M A;  3VSR A;  5A7V A;  4AK5 A;  5FK7 A;  4AK7 A;  2VDT A;  3WPZ A;  4EQV A;  2EXH A;  4N2R A;  3P2N A;  3BYN A;  4KMI A;  1Y4W A;  3NQH A;  4UDI A;  2X8S A;  4UDG A;  5GLR A;  2X8T A;  3LFI A;  3VSZ A;  5GLQ A;  3WMY A;  3OM6 A;  3OM2 A;  5FKC A;  5GLN A;  3WN0 A;  1W18 A;  3D61 A;  3C7G A;  2AEY A;  5FMB A;  5AYD A;  3U75 A;  4N2Z A;  3LIG A;  3C7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...