5A8DA

The high resolution structure of a novel alpha-l-arabinofuranosidase (ctgh43) from clostridium thermocellum atcc 27405
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
302
structure length
302
Chain Sequence
SAADYPIFSQRFTADPAAVVYNGRLYIYCSHDSDATPGQSTYNIPDITCISTDDLKNWTDHGEVFNAKRDSRWASVSWAPSIVYRNNKFYLYYGNGGNGIGVAVSDSPTGPFKDPLPGPLVSWNTPGVQPAQNMWLFDPGVFVDDDGQAYMYFGGNGQNNIRVIKLGNDMISTVGSAMTMSAPRFFEAAYMHKYNGKYYFSYASDFSQGASKIEYMMSDKPTTGFQYKGVILPQPPDNYSNNNHHAIVEYKGNWYVVYHNRTVAKQRGLDPVYQRNVCIDQMFYNADGTIKQVVPTVDGLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Molecular determinants of substrate specificity revealed by the structure of Clostridium thermocellum arabinofuranosidase 43A from glycosyl hydrolase family 43 subfamily 16.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 79
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 5a8dA00
1Y7BA 3LDRA 1YI7A 4O8PA 4QQSA 4FFIA 5FLWA 4EQVA 1UYPA 5FIXA 4UDIA 1W18A 4KCBA 3KF3A 4KMIA 4AK7A 4KCAA 2AEYA 3LV4A 3QZ4A 5C0PA 3K1UA 3VT0A 5GLLA 2OXBA 3WPYA 3BYJA 3BYNA 1OYGA 4N4BA 3LFIA 5GLMA 1GYEB 3ZXKA 1ST8A 1GYHA 3OM5A 4MLGA 3LF7A 3WN1A 4FFFA 5FMBA 3C7HA 3WN2A 3OM2A 3VSSA 3VT2A 4ONZA 5GLKA 1UV4A 3WN0A 3BYKA 3D5YA 5GLOA 1YRZA 3UGHA 3C7GA 3ZXLA 1WL7A 3QEEA 1PT2A 2YFRA 3VSZA 3RWKX 5B6SA 2EXIA 4PVIA 3WPUA 3U14A 2X8FA 5A7VA 3C7FA 3WASA 3WMYA 3C7EA 1Y9GA 4UDJA 5GLQA 3PIGA 2AEZA 3UGFA 2EXHA 1GYDB 2XQRA 3WAUA 5JOYA 5GLRA 4KC8A 3C7OA 3R67A 3P2NA 5FKBA 1W2TA 3TAWA 4U6DA 4D47A 5A8DA 4O8NA 3VSFA 3OM6A 4N1IA 3WATA 3U75A 3D60A 4AK6A 2EXKA 2X8TA 5JOZA 3PIJA 3C2UA 3AKGA 3D5ZA 3VSRA 3LIHA 4FFGA 3BYLA 2ADDA 3R4YA 3KF5A 2QQWA 3R4ZA 3WPVA 5FK7A 2EXJA 4N2ZA 1VKDA 5A8CA 4UDKA 5AYCA 3WMZA 3VT1A 5AYEA 4KC7A 3QEFA 3AKFA 4COTA 3OM4A 3WPZA 2X8SA 3AKIA 5FK8A 5AYDA 3ZXJA 1YIFA 5AY9A 3SC7X 2YFTA 2B4WA 3LEMA 2YFSA 2AC1A 3QC2A 3QEDA 3KSTA 4AK5A 3NQHA 4O8OA 4NOVA 3AKHA 5GLNA 4U6BA 4PVAA 1Y4WA 5FKCA 5FMCA 2ADEA 5GLPA 2QQVA 5B6TA 5JOWA 5ANNA 2VDTA 4N2RA 5JOXA 2QQUA 1Y9MA 3D61A 3LIGA 3OM7A 4UDKE 4UDGA 3CU9A 4FFHA 5A7VB 3UGGA 5FMDA 3LDKA
chains in the Genus database with same CATH superfamily
1Y7BA 3LDRA 1YI7A 4O8PA 4QQSA 4FFIA 5FLWA 4EQVA 1UYPA 5FIXA 4UDIA 1W18A 4KCBA 3KF3A 4KMIA 4AK7A 4KCAA 2AEYA 3LV4A 3QZ4A 5C0PA 3K1UA 3VT0A 5GLLA 2OXBA 3WPYA 3BYJA 3BYNA 1OYGA 4N4BA 3LFIA 5GLMA 1GYEB 3ZXKA 1ST8A 1GYHA 3OM5A 4MLGA 3LF7A 3WN1A 4FFFA 5FMBA 3C7HA 3WN2A 3OM2A 3VSSA 3VT2A 4ONZA 5GLKA 1UV4A 3WN0A 3BYKA 3D5YA 5GLOA 1YRZA 3UGHA 3C7GA 3ZXLA 1WL7A 3QEEA 1PT2A 1TL2A 2YFRA 3VSZA 3RWKX 5B6SA 2EXIA 4PVIA 3WPUA 3U14A 2X8FA 5A7VA 3C7FA 3WASA 3WMYA 3C7EA 1Y9GA 5C2MA 4UDJA 5GLQA 3PIGA 2AEZA 3UGFA 2EXHA 1GYDB 2XQRA 3WAUA 5JOYA 5GLRA 4KC8A 3C7OA 3R67A 3P2NA 5FKBA 1W2TA 3TAWA 4U6DA 4D47A 5A8DA 4O8NA 3VSFA 3OM6A 4N1IA 3WATA 3U75A 3D60A 4AK6A 2EXKA 2X8TA 5JOZA 3PIJA 3C2UA 3AKGA 3D5ZA 3VSRA 3LIHA 4FFGA 3BYLA 2ADDA 3R4YA 3KF5A 2QQWA 3R4ZA 3WPVA 5FK7A 2EXJA 4N2ZA 1VKDA 5A8CA 4UDKA 5AYCA 3WMZA 3VT1A 5AYEA 4KC7A 3QEFA 3AKFA 4COTA 3OM4A 3WPZA 2X8SA 3AKIA 5FK8A 5AYDA 3ZXJA 1YIFA 5AY9A 3SC7X 2YFTA 2B4WA 3LEMA 2YFSA 2AC1A 3QC2A 3QEDA 3KSTA 4AK5A 3NQHA 4O8OA 4NOVA 3AKHA 5GLNA 4U6BA 4PVAA 1Y4WA 5FKCA 5FMCA 2ADEA 5GLPA 2QQVA 5B6TA 5JOWA 5ANNA 2VDTA 4N2RA 5JOXA 2QQUA 1Y9MA 3D61A 3LIGA 3OM7A 4UDKE 4UDGA 3CU9A 4FFHA 5A7VB 3UGGA 5FMDA 3LDKA
chains in the Genus database with same CATH topology
1Y7BA 3LDRA 1YI7A 4O8PA 4QQSA 4FFIA 5FLWA 4EQVA 1UYPA 5FIXA 4UDIA 1W18A 4KCBA 3KF3A 4KMIA 4AK7A 4KCAA 2AEYA 3LV4A 3QZ4A 5C0PA 3K1UA 3VT0A 5GLLA 2OXBA 3WPYA 3BYJA 3BYNA 1OYGA 4N4BA 3LFIA 5GLMA 1GYEB 3ZXKA 1ST8A 1GYHA 3OM5A 4MLGA 3LF7A 3WN1A 4FFFA 5FMBA 3C7HA 3WN2A 3OM2A 3VSSA 3VT2A 4ONZA 5GLKA 1UV4A 3WN0A 3BYKA 3D5YA 5GLOA 1YRZA 3UGHA 3C7GA 3ZXLA 1WL7A 3QEEA 1PT2A 2YFRA 3VSZA 3RWKX 5B6SA 2EXIA 4PVIA 3WPUA 3U14A 2X8FA 5A7VA 3C7FA 3WASA 3WMYA 3C7EA 1Y9GA 4UDJA 5GLQA 3PIGA 2AEZA 3UGFA 2EXHA 1GYDB 2XQRA 3WAUA 5JOYA 5GLRA 4KC8A 3C7OA 3R67A 3P2NA 5FKBA 1W2TA 3TAWA 4U6DA 4D47A 5A8DA 4O8NA 3VSFA 3OM6A 4N1IA 3WATA 3U75A 3D60A 4AK6A 2EXKA 2X8TA 5JOZA 3PIJA 3C2UA 3AKGA 3D5ZA 3VSRA 3LIHA 4FFGA 3BYLA 2ADDA 3R4YA 3KF5A 2QQWA 3R4ZA 3WPVA 5FK7A 2EXJA 4N2ZA 1VKDA 5A8CA 4UDKA 5AYCA 3WMZA 3VT1A 5AYEA 4KC7A 3QEFA 3AKFA 4COTA 3OM4A 3WPZA 2X8SA 3AKIA 5FK8A 5AYDA 3ZXJA 1YIFA 5AY9A 3SC7X 2YFTA 2B4WA 3LEMA 2YFSA 2AC1A 3QC2A 3QEDA 3KSTA 4AK5A 3NQHA 4O8OA 4NOVA 3AKHA 5GLNA 4U6BA 4PVAA 1Y4WA 5FKCA 5FMCA 2ADEA 5GLPA 2QQVA 5B6TA 5JOWA 5ANNA 2VDTA 4N2RA 5JOXA 2QQUA 1Y9MA 3D61A 3LIGA 3OM7A 4UDKE 4UDGA 3CU9A 4FFHA 5A7VB 3UGGA 5FMDA 3LDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y7B A;  3LDR A;  1YI7 A;  4O8P A;  4QQS A;  4FFI A;  5FLW A;  4EQV A;  1UYP A;  5FIX A;  4UDI A;  1W18 A;  4KCB A;  3KF3 A;  4KMI A;  4AK7 A;  4KCA A;  2AEY A;  3LV4 A;  3QZ4 A;  5C0P A;  3K1U A;  3VT0 A;  5GLL A;  2OXB A;  3WPY A;  3BYJ A;  3BYN A;  1OYG A;  4N4B A;  3LFI A;  5GLM A;  1GYE B;  3ZXK A;  1ST8 A;  1GYH A;  3OM5 A;  4MLG A;  3LF7 A;  3WN1 A;  4FFF A;  5FMB A;  3C7H A;  3WN2 A;  3OM2 A;  3VSS A;  3VT2 A;  4ONZ A;  5GLK A;  1UV4 A;  3WN0 A;  3BYK A;  3D5Y A;  5GLO A;  1YRZ A;  3UGH A;  3C7G A;  3ZXL A;  1WL7 A;  3QEE A;  1PT2 A;  2YFR A;  3VSZ A;  3RWK X;  5B6S A;  2EXI A;  4PVI A;  3WPU A;  3U14 A;  2X8F A;  5A7V A;  3C7F A;  3WAS A;  3WMY A;  3C7E A;  1Y9G A;  4UDJ A;  5GLQ A;  3PIG A;  2AEZ A;  3UGF A;  2EXH A;  1GYD B;  2XQR A;  3WAU A;  5JOY A;  5GLR A;  4KC8 A;  3C7O A;  3R67 A;  3P2N A;  5FKB A;  1W2T A;  3TAW A;  4U6D A;  4D47 A;  5A8D A;  4O8N A;  3VSF A;  3OM6 A;  4N1I A;  3WAT A;  3U75 A;  3D60 A;  4AK6 A;  2EXK A;  2X8T A;  5JOZ A;  3PIJ A;  3C2U A;  3AKG A;  3D5Z A;  3VSR A;  3LIH A;  4FFG A;  3BYL A;  2ADD A;  3R4Y A;  3KF5 A;  2QQW A;  3R4Z A;  3WPV A;  5FK7 A;  2EXJ A;  4N2Z A;  1VKD A;  5A8C A;  4UDK A;  5AYC A;  3WMZ A;  3VT1 A;  5AYE A;  4KC7 A;  3QEF A;  3AKF A;  4COT A;  3OM4 A;  3WPZ A;  2X8S A;  3AKI A;  5FK8 A;  5AYD A;  3ZXJ A;  1YIF A;  5AY9 A;  3SC7 X;  2YFT A;  2B4W A;  3LEM A;  2YFS A;  2AC1 A;  3QC2 A;  3QED A;  3KST A;  4AK5 A;  3NQH A;  4O8O A;  4NOV A;  3AKH A;  5GLN A;  4U6B A;  4PVA A;  1Y4W A;  5FKC A;  5FMC A;  2ADE A;  5GLP A;  2QQV A;  5B6T A;  5JOW A;  5ANN A;  2VDT A;  4N2R A;  5JOX A;  2QQU A;  1Y9M A;  3D61 A;  3LIG A;  3OM7 A;  4UDK E;  4UDG A;  3CU9 A;  4FFH A;  5A7V B;  3UGG A;  5FMD A;  3LDK A; 
#chains in the Genus database with same CATH topology
 1Y7B A;  3LDR A;  1YI7 A;  4O8P A;  4QQS A;  4FFI A;  5FLW A;  4EQV A;  1UYP A;  5FIX A;  4UDI A;  1W18 A;  4KCB A;  3KF3 A;  4KMI A;  4AK7 A;  4KCA A;  2AEY A;  3LV4 A;  3QZ4 A;  5C0P A;  3K1U A;  3VT0 A;  5GLL A;  2OXB A;  3WPY A;  3BYJ A;  3BYN A;  1OYG A;  4N4B A;  3LFI A;  5GLM A;  1GYE B;  3ZXK A;  1ST8 A;  1GYH A;  3OM5 A;  4MLG A;  3LF7 A;  3WN1 A;  4FFF A;  5FMB A;  3C7H A;  3WN2 A;  3OM2 A;  3VSS A;  3VT2 A;  4ONZ A;  5GLK A;  1UV4 A;  3WN0 A;  3BYK A;  3D5Y A;  5GLO A;  1YRZ A;  3UGH A;  3C7G A;  3ZXL A;  1WL7 A;  3QEE A;  1PT2 A;  1TL2 A;  2YFR A;  3VSZ A;  3RWK X;  5B6S A;  2EXI A;  4PVI A;  3WPU A;  3U14 A;  2X8F A;  5A7V A;  3C7F A;  3WAS A;  3WMY A;  3C7E A;  1Y9G A;  5C2M A;  4UDJ A;  5GLQ A;  3PIG A;  2AEZ A;  3UGF A;  2EXH A;  1GYD B;  2XQR A;  3WAU A;  5JOY A;  5GLR A;  4KC8 A;  3C7O A;  3R67 A;  3P2N A;  5FKB A;  1W2T A;  3TAW A;  4U6D A;  4D47 A;  5A8D A;  4O8N A;  3VSF A;  3OM6 A;  4N1I A;  3WAT A;  3U75 A;  3D60 A;  4AK6 A;  2EXK A;  2X8T A;  5JOZ A;  3PIJ A;  3C2U A;  3AKG A;  3D5Z A;  3VSR A;  3LIH A;  4FFG A;  3BYL A;  2ADD A;  3R4Y A;  3KF5 A;  2QQW A;  3R4Z A;  3WPV A;  5FK7 A;  2EXJ A;  4N2Z A;  1VKD A;  5A8C A;  4UDK A;  5AYC A;  3WMZ A;  3VT1 A;  5AYE A;  4KC7 A;  3QEF A;  3AKF A;  4COT A;  3OM4 A;  3WPZ A;  2X8S A;  3AKI A;  5FK8 A;  5AYD A;  3ZXJ A;  1YIF A;  5AY9 A;  3SC7 X;  2YFT A;  2B4W A;  3LEM A;  2YFS A;  2AC1 A;  3QC2 A;  3QED A;  3KST A;  4AK5 A;  3NQH A;  4O8O A;  4NOV A;  3AKH A;  5GLN A;  4U6B A;  4PVA A;  1Y4W A;  5FKC A;  5FMC A;  2ADE A;  5GLP A;  2QQV A;  5B6T A;  5JOW A;  5ANN A;  2VDT A;  4N2R A;  5JOX A;  2QQU A;  1Y9M A;  3D61 A;  3LIG A;  3OM7 A;  4UDK E;  4UDG A;  3CU9 A;  4FFH A;  5A7V B;  3UGG A;  5FMD A;  3LDK A; 
#chains in the Genus database with same CATH homology
 1Y7B A;  3LDR A;  1YI7 A;  4O8P A;  4QQS A;  4FFI A;  5FLW A;  4EQV A;  1UYP A;  5FIX A;  4UDI A;  1W18 A;  4KCB A;  3KF3 A;  4KMI A;  4AK7 A;  4KCA A;  2AEY A;  3LV4 A;  3QZ4 A;  5C0P A;  3K1U A;  3VT0 A;  5GLL A;  2OXB A;  3WPY A;  3BYJ A;  3BYN A;  1OYG A;  4N4B A;  3LFI A;  5GLM A;  1GYE B;  3ZXK A;  1ST8 A;  1GYH A;  3OM5 A;  4MLG A;  3LF7 A;  3WN1 A;  4FFF A;  5FMB A;  3C7H A;  3WN2 A;  3OM2 A;  3VSS A;  3VT2 A;  4ONZ A;  5GLK A;  1UV4 A;  3WN0 A;  3BYK A;  3D5Y A;  5GLO A;  1YRZ A;  3UGH A;  3C7G A;  3ZXL A;  1WL7 A;  3QEE A;  1PT2 A;  2YFR A;  3VSZ A;  3RWK X;  5B6S A;  2EXI A;  4PVI A;  3WPU A;  3U14 A;  2X8F A;  5A7V A;  3C7F A;  3WAS A;  3WMY A;  3C7E A;  1Y9G A;  4UDJ A;  5GLQ A;  3PIG A;  2AEZ A;  3UGF A;  2EXH A;  1GYD B;  2XQR A;  3WAU A;  5JOY A;  5GLR A;  4KC8 A;  3C7O A;  3R67 A;  3P2N A;  5FKB A;  1W2T A;  3TAW A;  4U6D A;  4D47 A;  5A8D A;  4O8N A;  3VSF A;  3OM6 A;  4N1I A;  3WAT A;  3U75 A;  3D60 A;  4AK6 A;  2EXK A;  2X8T A;  5JOZ A;  3PIJ A;  3C2U A;  3AKG A;  3D5Z A;  3VSR A;  3LIH A;  4FFG A;  3BYL A;  2ADD A;  3R4Y A;  3KF5 A;  2QQW A;  3R4Z A;  3WPV A;  5FK7 A;  2EXJ A;  4N2Z A;  1VKD A;  5A8C A;  4UDK A;  5AYC A;  3WMZ A;  3VT1 A;  5AYE A;  4KC7 A;  3QEF A;  3AKF A;  4COT A;  3OM4 A;  3WPZ A;  2X8S A;  3AKI A;  5FK8 A;  5AYD A;  3ZXJ A;  1YIF A;  5AY9 A;  3SC7 X;  2YFT A;  2B4W A;  3LEM A;  2YFS A;  2AC1 A;  3QC2 A;  3QED A;  3KST A;  4AK5 A;  3NQH A;  4O8O A;  4NOV A;  3AKH A;  5GLN A;  4U6B A;  4PVA A;  1Y4W A;  5FKC A;  5FMC A;  2ADE A;  5GLP A;  2QQV A;  5B6T A;  5JOW A;  5ANN A;  2VDT A;  4N2R A;  5JOX A;  2QQU A;  1Y9M A;  3D61 A;  3LIG A;  3OM7 A;  4UDK E;  4UDG A;  3CU9 A;  4FFH A;  5A7V B;  3UGG A;  5FMD A;  3LDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...