5B6SA

Catalytic domain of coprinopsis cinerea gh62 alpha-l-arabinofuranosidase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
317
structure length
317
Chain Sequence
LPSSFRWSSSGPLIGPKSDSRRIQGIKDPSVVYHDGRWHVFASTAKTEGYNLVYISFTDWAQAGSASFYYLDQAPLGTGYRAAPQVFYFAPQRLWYLVYQNGNAAYSTNPDINNPAGWTAPRTFYSGMPAIIRNNIGNGHWVDMWVICDSSLCHLFSSDDNGHLYRSQTSLSNFPNGFNEPVIAMQDSNKNRLFEAANVYRIDGSNEYLLLHEAIGSDGRRWFRSWTSTSIAGPWRALADQESNPFARANNVAFTGNAWTRDISHGELIRSGNDQTLPISPCNLRYLYQGLDPNSGGDYNSLPWKLGLLTQTNSACA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 62 protein
publication title Structure of the Catalytic Domain of alpha-L-Arabinofuranosidase from Coprinopsis cinerea, CcAbf62A, Provides Insights into Structure-Function Relationships in Glycoside Hydrolase Family 62
pubmed doi rcsb
source organism Coprinopsis cinerea (strain okayama-7 / 130 / atcc mya-4618 / fgsc 9003)
total genus 81
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 5b6sA00
3VT0A 3VSRA 3D61A 3WPVA 5A7VB 3LDKA 3R4YA 4KMIA 4FFFA 3WPUA 4AK7A 4U6BA 5FMDA 4D47A 2QQWA 3AKGA 5GLMA 3P2NA 4N1IA 3KF3A 2YFSA 3QEEA 5B6TA 2QQVA 4NOVA 3QC2A 2EXIA 5JOYA 4UDIA 1W18A 1WL7A 5FMCA 4KC7A 3WASA 3WN0A 4FFGA 3OM2A 2ADDA 3LIHA 2YFRA 4FFHA 4N4BA 4UDGA 4KCAA 5AYEA 3QEDA 3SC7X 4FFIA 4QQSA 3R4ZA 2ADEA 2B4WA 3BYKA 5GLPA 4AK6A 4O8PA 5A7VA 3U14A 3UGHA 5AYCA 3LDRA 4ONZA 2EXHA 5GLNA 4KCBA 3D5YA 2YFTA 5GLKA 5AY9A 2AEYA 4PVIA 1Y4WA 3NQHA 3WN1A 4EQVA 3WMYA 3RWKX 3R67A 3BYJA 3C7FA 3BYNA 3D5ZA 5JOZA 2X8FA 4UDKE 5GLQA 3PIJA 3C7GA 3C7OA 4UDJA 2QQUA 1YI7A 3C7EA 4O8NA 3WMZA 3AKHA 5JOWA 4UDKA 3ZXLA 5GLLA 2XQRA 3UGFA 2OXBA 3KF5A 3KSTA 1UYPA 1Y9GA 4U6DA 3D60A 3LV4A 4COTA 3BYLA 1PT2A 3VSFA 4MLGA 1W2TA 3OM6A 3WPYA 3U75A 5FIXA 3WAUA 5B6SA 1Y7BA 5FK8A 2EXKA 4N2ZA 3WATA 3ZXJA 4AK5A 4PVAA 5A8CA 1UV4A 1YIFA 2AEZA 3AKFA 3OM5A 2EXJA 2VDTA 3OM7A 3C7HA 2AC1A 5JOXA 3AKIA 5C0PA 5FK7A 1GYEB 5A8DA 3VSZA 3OM4A 3QEFA 3LIGA 4O8OA 1ST8A 3ZXKA 1Y9MA 3LF7A 4N2RA 5FKCA 5FLWA 3C2UA 5ANNA 1VKDA 3K1UA 3WN2A 3VT1A 3PIGA 1OYGA 2X8TA 3CU9A 3VSSA 1YRZA 3WPZA 3LFIA 5FMBA 3TAWA 3LEMA 4KC8A 3VT2A 3QZ4A 5AYDA 2X8SA 5FKBA 3UGGA 1GYDB 5GLOA 5GLRA 1GYHA
chains in the Genus database with same CATH superfamily
3VT0A 3VSRA 3D61A 3WPVA 5A7VB 3LDKA 3R4YA 4KMIA 4FFFA 3WPUA 4AK7A 4U6BA 5FMDA 4D47A 2QQWA 3AKGA 5GLMA 3P2NA 4N1IA 3KF3A 2YFSA 3QEEA 5B6TA 2QQVA 4NOVA 3QC2A 2EXIA 5JOYA 4UDIA 1W18A 1WL7A 5FMCA 4KC7A 3WASA 3WN0A 4FFGA 3OM2A 2ADDA 3LIHA 2YFRA 4FFHA 4N4BA 4UDGA 4KCAA 5AYEA 3QEDA 5C2MA 3SC7X 4FFIA 4QQSA 3R4ZA 2ADEA 2B4WA 3BYKA 5GLPA 4AK6A 4O8PA 5A7VA 3U14A 3UGHA 5AYCA 3LDRA 4ONZA 2EXHA 5GLNA 4KCBA 3D5YA 2YFTA 5GLKA 5AY9A 2AEYA 4PVIA 1Y4WA 3NQHA 3WN1A 4EQVA 3WMYA 3RWKX 3R67A 3BYJA 3C7FA 3BYNA 3D5ZA 5JOZA 2X8FA 4UDKE 5GLQA 3PIJA 3C7GA 3C7OA 4UDJA 2QQUA 1TL2A 1YI7A 3C7EA 4O8NA 3WMZA 3AKHA 5JOWA 4UDKA 3ZXLA 5GLLA 2XQRA 3UGFA 2OXBA 3KF5A 3KSTA 1UYPA 1Y9GA 4U6DA 3D60A 3LV4A 4COTA 3BYLA 1PT2A 3VSFA 4MLGA 1W2TA 3OM6A 3WPYA 3U75A 5FIXA 3WAUA 5B6SA 1Y7BA 5FK8A 2EXKA 4N2ZA 3WATA 3ZXJA 4AK5A 4PVAA 5A8CA 1UV4A 1YIFA 2AEZA 3AKFA 3OM5A 2EXJA 3OM7A 2VDTA 3C7HA 2AC1A 5JOXA 3AKIA 5C0PA 5FK7A 1GYEB 5A8DA 3VSZA 3OM4A 3QEFA 3LIGA 4O8OA 1ST8A 3ZXKA 1Y9MA 3LF7A 4N2RA 5FKCA 5FLWA 3C2UA 5ANNA 1VKDA 3K1UA 3WN2A 3VT1A 3PIGA 1OYGA 2X8TA 3CU9A 3VSSA 1YRZA 3WPZA 3LFIA 5FMBA 3TAWA 3LEMA 4KC8A 3VT2A 3QZ4A 5AYDA 2X8SA 5FKBA 3UGGA 1GYDB 5GLOA 5GLRA 1GYHA
chains in the Genus database with same CATH topology
3VT0A 3VSRA 3D61A 3WPVA 5A7VB 3LDKA 3R4YA 4KMIA 4FFFA 3WPUA 4AK7A 4U6BA 5FMDA 4D47A 2QQWA 3AKGA 5GLMA 3P2NA 4N1IA 3KF3A 2YFSA 3QEEA 5B6TA 2QQVA 4NOVA 3QC2A 2EXIA 5JOYA 4UDIA 1W18A 1WL7A 5FMCA 4KC7A 3WASA 3WN0A 4FFGA 3OM2A 2ADDA 3LIHA 2YFRA 4FFHA 4N4BA 4UDGA 4KCAA 5AYEA 3QEDA 3SC7X 4FFIA 4QQSA 3R4ZA 2ADEA 2B4WA 3BYKA 5GLPA 4AK6A 4O8PA 5A7VA 3U14A 3UGHA 5AYCA 3LDRA 4ONZA 2EXHA 5GLNA 4KCBA 3D5YA 2YFTA 5GLKA 5AY9A 2AEYA 4PVIA 1Y4WA 3NQHA 3WN1A 4EQVA 3WMYA 3RWKX 3R67A 3BYJA 3C7FA 3BYNA 3D5ZA 5JOZA 2X8FA 4UDKE 5GLQA 3PIJA 3C7GA 3C7OA 4UDJA 2QQUA 1YI7A 3C7EA 4O8NA 3WMZA 3AKHA 5JOWA 4UDKA 3ZXLA 5GLLA 2XQRA 3UGFA 2OXBA 3KF5A 3KSTA 1UYPA 1Y9GA 4U6DA 3D60A 3LV4A 4COTA 3BYLA 1PT2A 3VSFA 4MLGA 1W2TA 3OM6A 3WPYA 3U75A 5FIXA 3WAUA 5B6SA 1Y7BA 5FK8A 2EXKA 4N2ZA 3WATA 3ZXJA 4AK5A 4PVAA 5A8CA 1UV4A 1YIFA 2AEZA 3AKFA 3OM5A 2EXJA 2VDTA 3OM7A 3C7HA 2AC1A 5JOXA 3AKIA 5C0PA 5FK7A 1GYEB 5A8DA 3VSZA 3OM4A 3QEFA 3LIGA 4O8OA 1ST8A 3ZXKA 1Y9MA 3LF7A 4N2RA 5FKCA 5FLWA 3C2UA 5ANNA 1VKDA 3K1UA 3WN2A 3VT1A 3PIGA 1OYGA 2X8TA 3CU9A 3VSSA 1YRZA 3WPZA 3LFIA 5FMBA 3TAWA 3LEMA 4KC8A 3VT2A 3QZ4A 5AYDA 2X8SA 5FKBA 3UGGA 1GYDB 5GLOA 5GLRA 1GYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VT0 A;  3VSR A;  3D61 A;  3WPV A;  5A7V B;  3LDK A;  3R4Y A;  4KMI A;  4FFF A;  3WPU A;  4AK7 A;  4U6B A;  5FMD A;  4D47 A;  2QQW A;  3AKG A;  5GLM A;  3P2N A;  4N1I A;  3KF3 A;  2YFS A;  3QEE A;  5B6T A;  2QQV A;  4NOV A;  3QC2 A;  2EXI A;  5JOY A;  4UDI A;  1W18 A;  1WL7 A;  5FMC A;  4KC7 A;  3WAS A;  3WN0 A;  4FFG A;  3OM2 A;  2ADD A;  3LIH A;  2YFR A;  4FFH A;  4N4B A;  4UDG A;  4KCA A;  5AYE A;  3QED A;  3SC7 X;  4FFI A;  4QQS A;  3R4Z A;  2ADE A;  2B4W A;  3BYK A;  5GLP A;  4AK6 A;  4O8P A;  5A7V A;  3U14 A;  3UGH A;  5AYC A;  3LDR A;  4ONZ A;  2EXH A;  5GLN A;  4KCB A;  3D5Y A;  2YFT A;  5GLK A;  5AY9 A;  2AEY A;  4PVI A;  1Y4W A;  3NQH A;  3WN1 A;  4EQV A;  3WMY A;  3RWK X;  3R67 A;  3BYJ A;  3C7F A;  3BYN A;  3D5Z A;  5JOZ A;  2X8F A;  4UDK E;  5GLQ A;  3PIJ A;  3C7G A;  3C7O A;  4UDJ A;  2QQU A;  1YI7 A;  3C7E A;  4O8N A;  3WMZ A;  3AKH A;  5JOW A;  4UDK A;  3ZXL A;  5GLL A;  2XQR A;  3UGF A;  2OXB A;  3KF5 A;  3KST A;  1UYP A;  1Y9G A;  4U6D A;  3D60 A;  3LV4 A;  4COT A;  3BYL A;  1PT2 A;  3VSF A;  4MLG A;  1W2T A;  3OM6 A;  3WPY A;  3U75 A;  5FIX A;  3WAU A;  5B6S A;  1Y7B A;  5FK8 A;  2EXK A;  4N2Z A;  3WAT A;  3ZXJ A;  4AK5 A;  4PVA A;  5A8C A;  1UV4 A;  1YIF A;  2AEZ A;  3AKF A;  3OM5 A;  2EXJ A;  2VDT A;  3OM7 A;  3C7H A;  2AC1 A;  5JOX A;  3AKI A;  5C0P A;  5FK7 A;  1GYE B;  5A8D A;  3VSZ A;  3OM4 A;  3QEF A;  3LIG A;  4O8O A;  1ST8 A;  3ZXK A;  1Y9M A;  3LF7 A;  4N2R A;  5FKC A;  5FLW A;  3C2U A;  5ANN A;  1VKD A;  3K1U A;  3WN2 A;  3VT1 A;  3PIG A;  1OYG A;  2X8T A;  3CU9 A;  3VSS A;  1YRZ A;  3WPZ A;  3LFI A;  5FMB A;  3TAW A;  3LEM A;  4KC8 A;  3VT2 A;  3QZ4 A;  5AYD A;  2X8S A;  5FKB A;  3UGG A;  1GYD B;  5GLO A;  5GLR A;  1GYH A; 
#chains in the Genus database with same CATH topology
 3VT0 A;  3VSR A;  3D61 A;  3WPV A;  5A7V B;  3LDK A;  3R4Y A;  4KMI A;  4FFF A;  3WPU A;  4AK7 A;  4U6B A;  5FMD A;  4D47 A;  2QQW A;  3AKG A;  5GLM A;  3P2N A;  4N1I A;  3KF3 A;  2YFS A;  3QEE A;  5B6T A;  2QQV A;  4NOV A;  3QC2 A;  2EXI A;  5JOY A;  4UDI A;  1W18 A;  1WL7 A;  5FMC A;  4KC7 A;  3WAS A;  3WN0 A;  4FFG A;  3OM2 A;  2ADD A;  3LIH A;  2YFR A;  4FFH A;  4N4B A;  4UDG A;  4KCA A;  5AYE A;  3QED A;  5C2M A;  3SC7 X;  4FFI A;  4QQS A;  3R4Z A;  2ADE A;  2B4W A;  3BYK A;  5GLP A;  4AK6 A;  4O8P A;  5A7V A;  3U14 A;  3UGH A;  5AYC A;  3LDR A;  4ONZ A;  2EXH A;  5GLN A;  4KCB A;  3D5Y A;  2YFT A;  5GLK A;  5AY9 A;  2AEY A;  4PVI A;  1Y4W A;  3NQH A;  3WN1 A;  4EQV A;  3WMY A;  3RWK X;  3R67 A;  3BYJ A;  3C7F A;  3BYN A;  3D5Z A;  5JOZ A;  2X8F A;  4UDK E;  5GLQ A;  3PIJ A;  3C7G A;  3C7O A;  4UDJ A;  2QQU A;  1TL2 A;  1YI7 A;  3C7E A;  4O8N A;  3WMZ A;  3AKH A;  5JOW A;  4UDK A;  3ZXL A;  5GLL A;  2XQR A;  3UGF A;  2OXB A;  3KF5 A;  3KST A;  1UYP A;  1Y9G A;  4U6D A;  3D60 A;  3LV4 A;  4COT A;  3BYL A;  1PT2 A;  3VSF A;  4MLG A;  1W2T A;  3OM6 A;  3WPY A;  3U75 A;  5FIX A;  3WAU A;  5B6S A;  1Y7B A;  5FK8 A;  2EXK A;  4N2Z A;  3WAT A;  3ZXJ A;  4AK5 A;  4PVA A;  5A8C A;  1UV4 A;  1YIF A;  2AEZ A;  3AKF A;  3OM5 A;  2EXJ A;  3OM7 A;  2VDT A;  3C7H A;  2AC1 A;  5JOX A;  3AKI A;  5C0P A;  5FK7 A;  1GYE B;  5A8D A;  3VSZ A;  3OM4 A;  3QEF A;  3LIG A;  4O8O A;  1ST8 A;  3ZXK A;  1Y9M A;  3LF7 A;  4N2R A;  5FKC A;  5FLW A;  3C2U A;  5ANN A;  1VKD A;  3K1U A;  3WN2 A;  3VT1 A;  3PIG A;  1OYG A;  2X8T A;  3CU9 A;  3VSS A;  1YRZ A;  3WPZ A;  3LFI A;  5FMB A;  3TAW A;  3LEM A;  4KC8 A;  3VT2 A;  3QZ4 A;  5AYD A;  2X8S A;  5FKB A;  3UGG A;  1GYD B;  5GLO A;  5GLR A;  1GYH A; 
#chains in the Genus database with same CATH homology
 3VT0 A;  3VSR A;  3D61 A;  3WPV A;  5A7V B;  3LDK A;  3R4Y A;  4KMI A;  4FFF A;  3WPU A;  4AK7 A;  4U6B A;  5FMD A;  4D47 A;  2QQW A;  3AKG A;  5GLM A;  3P2N A;  4N1I A;  3KF3 A;  2YFS A;  3QEE A;  5B6T A;  2QQV A;  4NOV A;  3QC2 A;  2EXI A;  5JOY A;  4UDI A;  1W18 A;  1WL7 A;  5FMC A;  4KC7 A;  3WAS A;  3WN0 A;  4FFG A;  3OM2 A;  2ADD A;  3LIH A;  2YFR A;  4FFH A;  4N4B A;  4UDG A;  4KCA A;  5AYE A;  3QED A;  3SC7 X;  4FFI A;  4QQS A;  3R4Z A;  2ADE A;  2B4W A;  3BYK A;  5GLP A;  4AK6 A;  4O8P A;  5A7V A;  3U14 A;  3UGH A;  5AYC A;  3LDR A;  4ONZ A;  2EXH A;  5GLN A;  4KCB A;  3D5Y A;  2YFT A;  5GLK A;  5AY9 A;  2AEY A;  4PVI A;  1Y4W A;  3NQH A;  3WN1 A;  4EQV A;  3WMY A;  3RWK X;  3R67 A;  3BYJ A;  3C7F A;  3BYN A;  3D5Z A;  5JOZ A;  2X8F A;  4UDK E;  5GLQ A;  3PIJ A;  3C7G A;  3C7O A;  4UDJ A;  2QQU A;  1YI7 A;  3C7E A;  4O8N A;  3WMZ A;  3AKH A;  5JOW A;  4UDK A;  3ZXL A;  5GLL A;  2XQR A;  3UGF A;  2OXB A;  3KF5 A;  3KST A;  1UYP A;  1Y9G A;  4U6D A;  3D60 A;  3LV4 A;  4COT A;  3BYL A;  1PT2 A;  3VSF A;  4MLG A;  1W2T A;  3OM6 A;  3WPY A;  3U75 A;  5FIX A;  3WAU A;  5B6S A;  1Y7B A;  5FK8 A;  2EXK A;  4N2Z A;  3WAT A;  3ZXJ A;  4AK5 A;  4PVA A;  5A8C A;  1UV4 A;  1YIF A;  2AEZ A;  3AKF A;  3OM5 A;  2EXJ A;  2VDT A;  3OM7 A;  3C7H A;  2AC1 A;  5JOX A;  3AKI A;  5C0P A;  5FK7 A;  1GYE B;  5A8D A;  3VSZ A;  3OM4 A;  3QEF A;  3LIG A;  4O8O A;  1ST8 A;  3ZXK A;  1Y9M A;  3LF7 A;  4N2R A;  5FKC A;  5FLW A;  3C2U A;  5ANN A;  1VKD A;  3K1U A;  3WN2 A;  3VT1 A;  3PIG A;  1OYG A;  2X8T A;  3CU9 A;  3VSS A;  1YRZ A;  3WPZ A;  3LFI A;  5FMB A;  3TAW A;  3LEM A;  4KC8 A;  3VT2 A;  3QZ4 A;  5AYD A;  2X8S A;  5FKB A;  3UGG A;  1GYD B;  5GLO A;  5GLR A;  1GYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...