5B6TA

Catalytic domain of coprinopsis cinerea gh62 alpha-l-arabinofuranosidase complexed with pb
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
317
structure length
317
Chain Sequence
LPSSFRWSSSGPLIGPKSDSRRIQGIKDPSVVYHDGRWHVFASTAKTEGYNLVYISFTDWAQAGSASFYYLDQAPLGTGYRAAPQVFYFAPQRLWYLVYQNGNAAYSTNPDINNPAGWTAPRTFYSGMPAIIRNNIGNGHWVDMWVICDSSLCHLFSSDDNGHLYRSQTSLSNFPNGFNEPVIAMQDSNKNRLFEAANVYRIDGSNEYLLLHEAIGSDGRRWFRSWTSTSIAGPWRALADQESNPFARANNVAFTGNAWTRDISHGELIRSGNDQTLPISPCNLRYLYQGLDPNSGGDYNSLPWKLGLLTQTNSACA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 62 protein
publication title Structure of the Catalytic Domain of alpha-L-Arabinofuranosidase from Coprinopsis cinerea, CcAbf62A, Provides Insights into Structure-Function Relationships in Glycoside Hydrolase Family 62
pubmed doi rcsb
source organism Coprinopsis cinerea (strain okayama-7 / 130 / atcc mya-4618 / fgsc 9003)
total genus 82
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 5b6tA00
3U14A 3R4ZA 3LEMA 5A7VA 3QEEA 3WPYA 4AK7A 2QQWA 3VT0A 3LIHA 1YIFA 3C7HA 3WPUA 3BYNA 3C2UA 3WN0A 3LF7A 3VSFA 5GLQA 4KCAA 5GLNA 3VSZA 4UDGA 3KSTA 4U6BA 4FFFA 3OM5A 4FFIA 5C0PA 5FK8A 3QEFA 5GLOA 1GYEB 3C7OA 2EXIA 4KC8A 4N1IA 2X8FA 1YRZA 1GYDB 3BYKA 4O8OA 3QZ4A 3R4YA 3VSSA 5FIXA 4KC7A 3OM4A 3TAWA 3LIGA 3VSRA 5B6SA 1Y9MA 4UDIA 1Y9GA 4PVIA 3WASA 3AKGA 3BYJA 3K1UA 3KF5A 5GLPA 2B4WA 5FLWA 3AKIA 1PT2A 3UGGA 3WMZA 5GLRA 3WMYA 2YFTA 5GLKA 4COTA 3OM7A 3WAUA 2ADDA 3AKFA 2EXKA 3WN2A 5FKCA 3CU9A 3KF3A 3LV4A 3ZXJA 2X8SA 2VDTA 1YI7A 5AYDA 3SC7X 5FMCA 5B6TA 4NOVA 3UGHA 3PIJA 3NQHA 5GLLA 2OXBA 4O8NA 5GLMA 3VT2A 4U6DA 1WL7A 3UGFA 5JOXA 4UDKA 1OYGA 1W2TA 2EXJA 3VT1A 5A8DA 3U75A 1W18A 4UDJA 3QC2A 5FKBA 2EXHA 2AEYA 3C7FA 4UDKE 1ST8A 3LFIA 3QEDA 3WN1A 2QQUA 3D61A 5JOZA 1VKDA 1Y4WA 5AYEA 4O8PA 1Y7BA 2YFSA 1GYHA 4N4BA 4QQSA 4ONZA 5FK7A 3D5ZA 4FFGA 5AYCA 5JOWA 1UYPA 3PIGA 2QQVA 4AK6A 3D5YA 5A8CA 5A7VB 2XQRA 3LDKA 2X8TA 3LDRA 3R67A 4KCBA 3BYLA 3C7GA 4N2RA 3D60A 3WPZA 3OM2A 3RWKX 3ZXLA 2AEZA 3C7EA 5JOYA 2ADEA 5FMBA 4MLGA 4EQVA 3P2NA 2AC1A 3WPVA 4FFHA 4KMIA 3WATA 4AK5A 1UV4A 5ANNA 2YFRA 4PVAA 4D47A 4N2ZA 5AY9A 5FMDA 3AKHA 3ZXKA 3OM6A
chains in the Genus database with same CATH superfamily
3U14A 3R4ZA 3LEMA 5A7VA 3QEEA 3WPYA 4AK7A 2QQWA 3VT0A 3LIHA 1YIFA 3C7HA 3WPUA 3BYNA 3C2UA 3WN0A 3LF7A 3VSFA 5GLQA 4KCAA 5GLNA 3VSZA 4UDGA 3KSTA 4U6BA 4FFFA 3OM5A 4FFIA 5C0PA 5FK8A 3QEFA 5GLOA 1GYEB 3C7OA 2EXIA 4KC8A 4N1IA 2X8FA 1YRZA 1GYDB 3BYKA 4O8OA 3QZ4A 3R4YA 3VSSA 5FIXA 4KC7A 3OM4A 3TAWA 5C2MA 3LIGA 3VSRA 5B6SA 1Y9MA 4UDIA 1Y9GA 4PVIA 3WASA 3AKGA 3BYJA 3K1UA 3KF5A 5GLPA 2B4WA 5FLWA 3AKIA 1PT2A 3UGGA 3WMZA 5GLRA 3WMYA 2YFTA 5GLKA 4COTA 3OM7A 3WAUA 2ADDA 3AKFA 2EXKA 3WN2A 5FKCA 3CU9A 3KF3A 3LV4A 3ZXJA 2X8SA 2VDTA 1YI7A 5AYDA 3SC7X 5FMCA 5B6TA 1TL2A 4NOVA 3UGHA 3PIJA 3NQHA 5GLLA 2OXBA 4O8NA 5GLMA 3VT2A 4U6DA 1WL7A 3UGFA 5JOXA 4UDKA 1OYGA 1W2TA 2EXJA 3VT1A 5A8DA 3U75A 1W18A 4UDJA 3QC2A 5FKBA 2EXHA 2AEYA 3C7FA 4UDKE 1ST8A 3LFIA 3QEDA 3WN1A 2QQUA 3D61A 5JOZA 1VKDA 1Y4WA 5AYEA 4O8PA 1Y7BA 2YFSA 1GYHA 4N4BA 4QQSA 4ONZA 5FK7A 3D5ZA 4FFGA 5AYCA 5JOWA 1UYPA 3PIGA 2QQVA 4AK6A 3D5YA 5A8CA 5A7VB 2XQRA 3LDKA 2X8TA 3LDRA 3R67A 4KCBA 3BYLA 3C7GA 4N2RA 3D60A 3WPZA 3OM2A 3RWKX 3ZXLA 2AEZA 3C7EA 5JOYA 2ADEA 5FMBA 4MLGA 4EQVA 3P2NA 2AC1A 3WPVA 4FFHA 4KMIA 3WATA 4AK5A 1UV4A 5ANNA 2YFRA 4PVAA 4D47A 4N2ZA 5AY9A 5FMDA 3AKHA 3ZXKA 3OM6A
chains in the Genus database with same CATH topology
3U14A 3R4ZA 3LEMA 5A7VA 3QEEA 3WPYA 4AK7A 2QQWA 3VT0A 3LIHA 1YIFA 3C7HA 3WPUA 3BYNA 3C2UA 3WN0A 3LF7A 3VSFA 5GLQA 4KCAA 5GLNA 3VSZA 4UDGA 3KSTA 4U6BA 4FFFA 3OM5A 4FFIA 5C0PA 5FK8A 3QEFA 5GLOA 1GYEB 3C7OA 2EXIA 4KC8A 4N1IA 2X8FA 1YRZA 1GYDB 3BYKA 4O8OA 3QZ4A 3R4YA 3VSSA 5FIXA 4KC7A 3OM4A 3TAWA 3LIGA 3VSRA 5B6SA 1Y9MA 4UDIA 1Y9GA 4PVIA 3WASA 3AKGA 3BYJA 3K1UA 3KF5A 5GLPA 2B4WA 5FLWA 3AKIA 1PT2A 3UGGA 3WMZA 5GLRA 3WMYA 2YFTA 5GLKA 4COTA 3OM7A 3WAUA 2ADDA 3AKFA 2EXKA 3WN2A 5FKCA 3CU9A 3KF3A 3LV4A 3ZXJA 2X8SA 2VDTA 1YI7A 5AYDA 3SC7X 5FMCA 5B6TA 4NOVA 3UGHA 3PIJA 3NQHA 5GLLA 2OXBA 4O8NA 5GLMA 3VT2A 4U6DA 1WL7A 3UGFA 5JOXA 4UDKA 1OYGA 1W2TA 2EXJA 3VT1A 5A8DA 3U75A 1W18A 4UDJA 3QC2A 5FKBA 2EXHA 2AEYA 3C7FA 4UDKE 1ST8A 3LFIA 3QEDA 3WN1A 2QQUA 3D61A 5JOZA 1VKDA 1Y4WA 5AYEA 4O8PA 1Y7BA 2YFSA 1GYHA 4N4BA 4QQSA 4ONZA 5FK7A 3D5ZA 4FFGA 5AYCA 5JOWA 1UYPA 3PIGA 2QQVA 4AK6A 3D5YA 5A8CA 5A7VB 2XQRA 3LDKA 2X8TA 3LDRA 3R67A 4KCBA 3BYLA 3C7GA 4N2RA 3D60A 3WPZA 3OM2A 3RWKX 3ZXLA 2AEZA 3C7EA 5JOYA 2ADEA 5FMBA 4MLGA 4EQVA 3P2NA 2AC1A 3WPVA 4FFHA 4KMIA 3WATA 4AK5A 1UV4A 5ANNA 2YFRA 4PVAA 4D47A 4N2ZA 5AY9A 5FMDA 3AKHA 3ZXKA 3OM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U14 A;  3R4Z A;  3LEM A;  5A7V A;  3QEE A;  3WPY A;  4AK7 A;  2QQW A;  3VT0 A;  3LIH A;  1YIF A;  3C7H A;  3WPU A;  3BYN A;  3C2U A;  3WN0 A;  3LF7 A;  3VSF A;  5GLQ A;  4KCA A;  5GLN A;  3VSZ A;  4UDG A;  3KST A;  4U6B A;  4FFF A;  3OM5 A;  4FFI A;  5C0P A;  5FK8 A;  3QEF A;  5GLO A;  1GYE B;  3C7O A;  2EXI A;  4KC8 A;  4N1I A;  2X8F A;  1YRZ A;  1GYD B;  3BYK A;  4O8O A;  3QZ4 A;  3R4Y A;  3VSS A;  5FIX A;  4KC7 A;  3OM4 A;  3TAW A;  3LIG A;  3VSR A;  5B6S A;  1Y9M A;  4UDI A;  1Y9G A;  4PVI A;  3WAS A;  3AKG A;  3BYJ A;  3K1U A;  3KF5 A;  5GLP A;  2B4W A;  5FLW A;  3AKI A;  1PT2 A;  3UGG A;  3WMZ A;  5GLR A;  3WMY A;  2YFT A;  5GLK A;  4COT A;  3OM7 A;  3WAU A;  2ADD A;  3AKF A;  2EXK A;  3WN2 A;  5FKC A;  3CU9 A;  3KF3 A;  3LV4 A;  3ZXJ A;  2X8S A;  2VDT A;  1YI7 A;  5AYD A;  3SC7 X;  5FMC A;  5B6T A;  4NOV A;  3UGH A;  3PIJ A;  3NQH A;  5GLL A;  2OXB A;  4O8N A;  5GLM A;  3VT2 A;  4U6D A;  1WL7 A;  3UGF A;  5JOX A;  4UDK A;  1OYG A;  1W2T A;  2EXJ A;  3VT1 A;  5A8D A;  3U75 A;  1W18 A;  4UDJ A;  3QC2 A;  5FKB A;  2EXH A;  2AEY A;  3C7F A;  4UDK E;  1ST8 A;  3LFI A;  3QED A;  3WN1 A;  2QQU A;  3D61 A;  5JOZ A;  1VKD A;  1Y4W A;  5AYE A;  4O8P A;  1Y7B A;  2YFS A;  1GYH A;  4N4B A;  4QQS A;  4ONZ A;  5FK7 A;  3D5Z A;  4FFG A;  5AYC A;  5JOW A;  1UYP A;  3PIG A;  2QQV A;  4AK6 A;  3D5Y A;  5A8C A;  5A7V B;  2XQR A;  3LDK A;  2X8T A;  3LDR A;  3R67 A;  4KCB A;  3BYL A;  3C7G A;  4N2R A;  3D60 A;  3WPZ A;  3OM2 A;  3RWK X;  3ZXL A;  2AEZ A;  3C7E A;  5JOY A;  2ADE A;  5FMB A;  4MLG A;  4EQV A;  3P2N A;  2AC1 A;  3WPV A;  4FFH A;  4KMI A;  3WAT A;  4AK5 A;  1UV4 A;  5ANN A;  2YFR A;  4PVA A;  4D47 A;  4N2Z A;  5AY9 A;  5FMD A;  3AKH A;  3ZXK A;  3OM6 A; 
#chains in the Genus database with same CATH topology
 3U14 A;  3R4Z A;  3LEM A;  5A7V A;  3QEE A;  3WPY A;  4AK7 A;  2QQW A;  3VT0 A;  3LIH A;  1YIF A;  3C7H A;  3WPU A;  3BYN A;  3C2U A;  3WN0 A;  3LF7 A;  3VSF A;  5GLQ A;  4KCA A;  5GLN A;  3VSZ A;  4UDG A;  3KST A;  4U6B A;  4FFF A;  3OM5 A;  4FFI A;  5C0P A;  5FK8 A;  3QEF A;  5GLO A;  1GYE B;  3C7O A;  2EXI A;  4KC8 A;  4N1I A;  2X8F A;  1YRZ A;  1GYD B;  3BYK A;  4O8O A;  3QZ4 A;  3R4Y A;  3VSS A;  5FIX A;  4KC7 A;  3OM4 A;  3TAW A;  5C2M A;  3LIG A;  3VSR A;  5B6S A;  1Y9M A;  4UDI A;  1Y9G A;  4PVI A;  3WAS A;  3AKG A;  3BYJ A;  3K1U A;  3KF5 A;  5GLP A;  2B4W A;  5FLW A;  3AKI A;  1PT2 A;  3UGG A;  3WMZ A;  5GLR A;  3WMY A;  2YFT A;  5GLK A;  4COT A;  3OM7 A;  3WAU A;  2ADD A;  3AKF A;  2EXK A;  3WN2 A;  5FKC A;  3CU9 A;  3KF3 A;  3LV4 A;  3ZXJ A;  2X8S A;  2VDT A;  1YI7 A;  5AYD A;  3SC7 X;  5FMC A;  5B6T A;  1TL2 A;  4NOV A;  3UGH A;  3PIJ A;  3NQH A;  5GLL A;  2OXB A;  4O8N A;  5GLM A;  3VT2 A;  4U6D A;  1WL7 A;  3UGF A;  5JOX A;  4UDK A;  1OYG A;  1W2T A;  2EXJ A;  3VT1 A;  5A8D A;  3U75 A;  1W18 A;  4UDJ A;  3QC2 A;  5FKB A;  2EXH A;  2AEY A;  3C7F A;  4UDK E;  1ST8 A;  3LFI A;  3QED A;  3WN1 A;  2QQU A;  3D61 A;  5JOZ A;  1VKD A;  1Y4W A;  5AYE A;  4O8P A;  1Y7B A;  2YFS A;  1GYH A;  4N4B A;  4QQS A;  4ONZ A;  5FK7 A;  3D5Z A;  4FFG A;  5AYC A;  5JOW A;  1UYP A;  3PIG A;  2QQV A;  4AK6 A;  3D5Y A;  5A8C A;  5A7V B;  2XQR A;  3LDK A;  2X8T A;  3LDR A;  3R67 A;  4KCB A;  3BYL A;  3C7G A;  4N2R A;  3D60 A;  3WPZ A;  3OM2 A;  3RWK X;  3ZXL A;  2AEZ A;  3C7E A;  5JOY A;  2ADE A;  5FMB A;  4MLG A;  4EQV A;  3P2N A;  2AC1 A;  3WPV A;  4FFH A;  4KMI A;  3WAT A;  4AK5 A;  1UV4 A;  5ANN A;  2YFR A;  4PVA A;  4D47 A;  4N2Z A;  5AY9 A;  5FMD A;  3AKH A;  3ZXK A;  3OM6 A; 
#chains in the Genus database with same CATH homology
 3U14 A;  3R4Z A;  3LEM A;  5A7V A;  3QEE A;  3WPY A;  4AK7 A;  2QQW A;  3VT0 A;  3LIH A;  1YIF A;  3C7H A;  3WPU A;  3BYN A;  3C2U A;  3WN0 A;  3LF7 A;  3VSF A;  5GLQ A;  4KCA A;  5GLN A;  3VSZ A;  4UDG A;  3KST A;  4U6B A;  4FFF A;  3OM5 A;  4FFI A;  5C0P A;  5FK8 A;  3QEF A;  5GLO A;  1GYE B;  3C7O A;  2EXI A;  4KC8 A;  4N1I A;  2X8F A;  1YRZ A;  1GYD B;  3BYK A;  4O8O A;  3QZ4 A;  3R4Y A;  3VSS A;  5FIX A;  4KC7 A;  3OM4 A;  3TAW A;  3LIG A;  3VSR A;  5B6S A;  1Y9M A;  4UDI A;  1Y9G A;  4PVI A;  3WAS A;  3AKG A;  3BYJ A;  3K1U A;  3KF5 A;  5GLP A;  2B4W A;  5FLW A;  3AKI A;  1PT2 A;  3UGG A;  3WMZ A;  5GLR A;  3WMY A;  2YFT A;  5GLK A;  4COT A;  3OM7 A;  3WAU A;  2ADD A;  3AKF A;  2EXK A;  3WN2 A;  5FKC A;  3CU9 A;  3KF3 A;  3LV4 A;  3ZXJ A;  2X8S A;  2VDT A;  1YI7 A;  5AYD A;  3SC7 X;  5FMC A;  5B6T A;  4NOV A;  3UGH A;  3PIJ A;  3NQH A;  5GLL A;  2OXB A;  4O8N A;  5GLM A;  3VT2 A;  4U6D A;  1WL7 A;  3UGF A;  5JOX A;  4UDK A;  1OYG A;  1W2T A;  2EXJ A;  3VT1 A;  5A8D A;  3U75 A;  1W18 A;  4UDJ A;  3QC2 A;  5FKB A;  2EXH A;  2AEY A;  3C7F A;  4UDK E;  1ST8 A;  3LFI A;  3QED A;  3WN1 A;  2QQU A;  3D61 A;  5JOZ A;  1VKD A;  1Y4W A;  5AYE A;  4O8P A;  1Y7B A;  2YFS A;  1GYH A;  4N4B A;  4QQS A;  4ONZ A;  5FK7 A;  3D5Z A;  4FFG A;  5AYC A;  5JOW A;  1UYP A;  3PIG A;  2QQV A;  4AK6 A;  3D5Y A;  5A8C A;  5A7V B;  2XQR A;  3LDK A;  2X8T A;  3LDR A;  3R67 A;  4KCB A;  3BYL A;  3C7G A;  4N2R A;  3D60 A;  3WPZ A;  3OM2 A;  3RWK X;  3ZXL A;  2AEZ A;  3C7E A;  5JOY A;  2ADE A;  5FMB A;  4MLG A;  4EQV A;  3P2N A;  2AC1 A;  3WPV A;  4FFH A;  4KMI A;  3WAT A;  4AK5 A;  1UV4 A;  5ANN A;  2YFR A;  4PVA A;  4D47 A;  4N2Z A;  5AY9 A;  5FMD A;  3AKH A;  3ZXK A;  3OM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...