5C0PA

The crystal structure of endo-arabinase from bacteroides thetaiotaomicron vpi-5482
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
284
structure length
284
Chain Sequence
ESFTIPVSSLRLRDPFILVDKKTSMYYLHFNNNLKIRVYKSKDLSTWKDEGYSFIAKSDFWGQQDFWAPDVYEYEGRYYLFTTFSNAGVKRGTSILVSDSPKGPFTPLVNKAITPSGWMCLDGSLYIDKEGNPWLLFCREWLETIDGEIYAQRLAKDLKTTEGDPYLLFKASEAPWVGSITSSGVTGNVTDAPFIYRLDDGKLIMLWSSFRKTDGKYAIGQAVSASGNVLGPWVQEPETLNSDDGGHAMVFKDLKGRLMISYHAPNSQTEHPVITPIYIKDGKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-arabinase
publication title The crystal structure of endo-arabinase from Bacteroides thetaiotaomicron VPI-5482
rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
total genus 69
structure length 284
sequence length 284
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 5c0pA00
2YFSA 3LIHA 5GLRA 3ZXLA 1WL7A 2VDTA 3LDRA 4QQSA 3UGGA 5AYCA 3P2NA 2X8SA 4N4BA 3C7EA 5JOWA 1PT2A 3AKIA 3BYKA 4O8PA 3OM4A 3PIJA 4AK6A 2EXIA 3QEEA 4FFGA 4FFFA 2QQUA 2AC1A 3WN2A 3R4ZA 5GLOA 3WN0A 3WPVA 3D60A 5FKCA 5FMDA 3BYJA 3AKFA 2EXKA 2X8TA 4U6DA 5AY9A 1W18A 3PIGA 5GLMA 3OM2A 3VT0A 4AK5A 3VSRA 3WN1A 1GYHA 4D47A 5A7VA 3QC2A 3WPUA 4UDKA 3VT1A 4O8NA 5JOXA 1YI7A 1Y7BA 5GLQA 3UGFA 4COTA 5AYDA 5FMBA 4MLGA 2B4WA 4KC8A 4KCAA 2ADEA 3OM5A 1GYEB 5FK8A 3WMZA 3UGHA 3R67A 4KCBA 3LEMA 5ANNA 3BYLA 2YFTA 3ZXKA 3VSSA 1Y9GA 3LF7A 3RWKX 4PVAA 5FK7A 3LV4A 4KMIA 1YIFA 5B6SA 3LIGA 4FFIA 4ONZA 1Y4WA 3KF3A 1Y9MA 3U14A 3WATA 2EXHA 3C7GA 4N2ZA 2ADDA 5GLLA 5JOYA 3LDKA 1ST8A 4U6BA 3C7HA 1OYGA 3QZ4A 1W2TA 4O8OA 2X8FA 4UDJA 3WASA 3ZXJA 1VKDA 3WPZA 4FFHA 3C2UA 2XQRA 5GLKA 3K1UA 5B6TA 3D5YA 1YRZA 2QQWA 1UYPA 5GLPA 3QEDA 4N2RA 2OXBA 3VT2A 3KF5A 5FIXA 5FKBA 3C7OA 2QQVA 3WAUA 4KC7A 3TAWA 3OM7A 4NOVA 3CU9A 1GYDB 5FLWA 5A7VB 5A8DA 3OM6A 4UDGA 3SC7X 3QEFA 3VSZA 3D5ZA 3WMYA 3C7FA 3D61A 4PVIA 2YFRA 5C0PA 4N1IA 3AKGA 3WPYA 3R4YA 3AKHA 4UDKE 4UDIA 5FMCA 4AK7A 2AEYA 3KSTA 5JOZA 3U75A 3LFIA 3VSFA 1UV4A 5A8CA 2EXJA 3BYNA 5GLNA 2AEZA 5AYEA 4EQVA 3NQHA
chains in the Genus database with same CATH superfamily
2YFSA 3LIHA 5GLRA 3ZXLA 1WL7A 2VDTA 3LDRA 4QQSA 3UGGA 5AYCA 3P2NA 2X8SA 4N4BA 3C7EA 5JOWA 1PT2A 3AKIA 3BYKA 4O8PA 3OM4A 3PIJA 4AK6A 2EXIA 3QEEA 4FFGA 4FFFA 2QQUA 2AC1A 3WN2A 3R4ZA 5GLOA 3WN0A 3WPVA 3D60A 5FKCA 5FMDA 3BYJA 3AKFA 2EXKA 2X8TA 4U6DA 5AY9A 1W18A 3PIGA 5GLMA 3OM2A 3VT0A 4AK5A 3VSRA 3WN1A 1GYHA 4D47A 5A7VA 3QC2A 3WPUA 4UDKA 3VT1A 4O8NA 5JOXA 1YI7A 1Y7BA 5GLQA 3UGFA 4COTA 5AYDA 5FMBA 4MLGA 2B4WA 4KC8A 4KCAA 2ADEA 3OM5A 1GYEB 5FK8A 3WMZA 3UGHA 3R67A 4KCBA 3LEMA 5ANNA 3BYLA 2YFTA 3ZXKA 3VSSA 1Y9GA 3LF7A 3RWKX 4PVAA 5FK7A 3LV4A 4KMIA 1YIFA 5B6SA 3LIGA 4FFIA 4ONZA 1Y4WA 3KF3A 1Y9MA 3U14A 3WATA 2EXHA 3C7GA 4N2ZA 2ADDA 5GLLA 5JOYA 3LDKA 1ST8A 4U6BA 5C2MA 3C7HA 1OYGA 3QZ4A 1W2TA 4O8OA 2X8FA 4UDJA 3WASA 3ZXJA 1VKDA 3WPZA 4FFHA 3C2UA 2XQRA 5GLKA 3K1UA 5B6TA 3D5YA 1YRZA 2QQWA 1UYPA 5GLPA 3QEDA 4N2RA 2OXBA 3VT2A 3KF5A 5FIXA 5FKBA 3C7OA 2QQVA 3WAUA 4KC7A 3TAWA 3OM7A 4NOVA 3CU9A 1GYDB 5FLWA 5A7VB 5A8DA 3OM6A 4UDGA 3SC7X 3QEFA 3VSZA 3D5ZA 3WMYA 3C7FA 3D61A 4PVIA 2YFRA 5C0PA 4N1IA 3AKGA 3WPYA 3R4YA 3AKHA 4UDKE 4UDIA 5FMCA 4AK7A 1TL2A 2AEYA 3KSTA 5JOZA 3U75A 3LFIA 3VSFA 1UV4A 5A8CA 2EXJA 3BYNA 5GLNA 2AEZA 5AYEA 4EQVA 3NQHA
chains in the Genus database with same CATH topology
2YFSA 3LIHA 5GLRA 3ZXLA 1WL7A 2VDTA 3LDRA 4QQSA 3UGGA 5AYCA 3P2NA 2X8SA 4N4BA 3C7EA 5JOWA 1PT2A 3AKIA 3BYKA 4O8PA 3OM4A 3PIJA 4AK6A 2EXIA 3QEEA 4FFGA 4FFFA 2QQUA 2AC1A 3WN2A 3R4ZA 5GLOA 3WN0A 3WPVA 3D60A 5FKCA 5FMDA 3BYJA 3AKFA 2EXKA 2X8TA 4U6DA 5AY9A 1W18A 3PIGA 5GLMA 3OM2A 3VT0A 4AK5A 3VSRA 3WN1A 1GYHA 4D47A 5A7VA 3QC2A 3WPUA 4UDKA 3VT1A 4O8NA 5JOXA 1YI7A 1Y7BA 5GLQA 3UGFA 4COTA 5AYDA 5FMBA 4MLGA 2B4WA 4KC8A 4KCAA 2ADEA 3OM5A 1GYEB 5FK8A 3WMZA 3UGHA 3R67A 4KCBA 3LEMA 5ANNA 3BYLA 2YFTA 3ZXKA 3VSSA 1Y9GA 3LF7A 3RWKX 4PVAA 5FK7A 3LV4A 4KMIA 1YIFA 5B6SA 3LIGA 4FFIA 4ONZA 1Y4WA 3KF3A 1Y9MA 3U14A 3WATA 2EXHA 3C7GA 4N2ZA 2ADDA 5GLLA 5JOYA 3LDKA 1ST8A 4U6BA 3C7HA 1OYGA 3QZ4A 1W2TA 4O8OA 2X8FA 4UDJA 3WASA 3ZXJA 1VKDA 3WPZA 4FFHA 3C2UA 2XQRA 5GLKA 3K1UA 5B6TA 3D5YA 1YRZA 2QQWA 1UYPA 5GLPA 3QEDA 4N2RA 2OXBA 3VT2A 3KF5A 5FIXA 5FKBA 3C7OA 2QQVA 3WAUA 4KC7A 3TAWA 3OM7A 4NOVA 3CU9A 1GYDB 5FLWA 5A7VB 5A8DA 3OM6A 4UDGA 3SC7X 3QEFA 3VSZA 3D5ZA 3WMYA 3C7FA 3D61A 4PVIA 2YFRA 5C0PA 4N1IA 3AKGA 3WPYA 3R4YA 3AKHA 4UDKE 4UDIA 5FMCA 4AK7A 2AEYA 3KSTA 5JOZA 3U75A 3LFIA 3VSFA 1UV4A 5A8CA 2EXJA 3BYNA 5GLNA 2AEZA 5AYEA 4EQVA 3NQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFS A;  3LIH A;  5GLR A;  3ZXL A;  1WL7 A;  2VDT A;  3LDR A;  4QQS A;  3UGG A;  5AYC A;  3P2N A;  2X8S A;  4N4B A;  3C7E A;  5JOW A;  1PT2 A;  3AKI A;  3BYK A;  4O8P A;  3OM4 A;  3PIJ A;  4AK6 A;  2EXI A;  3QEE A;  4FFG A;  4FFF A;  2QQU A;  2AC1 A;  3WN2 A;  3R4Z A;  5GLO A;  3WN0 A;  3WPV A;  3D60 A;  5FKC A;  5FMD A;  3BYJ A;  3AKF A;  2EXK A;  2X8T A;  4U6D A;  5AY9 A;  1W18 A;  3PIG A;  5GLM A;  3OM2 A;  3VT0 A;  4AK5 A;  3VSR A;  3WN1 A;  1GYH A;  4D47 A;  5A7V A;  3QC2 A;  3WPU A;  4UDK A;  3VT1 A;  4O8N A;  5JOX A;  1YI7 A;  1Y7B A;  5GLQ A;  3UGF A;  4COT A;  5AYD A;  5FMB A;  4MLG A;  2B4W A;  4KC8 A;  4KCA A;  2ADE A;  3OM5 A;  1GYE B;  5FK8 A;  3WMZ A;  3UGH A;  3R67 A;  4KCB A;  3LEM A;  5ANN A;  3BYL A;  2YFT A;  3ZXK A;  3VSS A;  1Y9G A;  3LF7 A;  3RWK X;  4PVA A;  5FK7 A;  3LV4 A;  4KMI A;  1YIF A;  5B6S A;  3LIG A;  4FFI A;  4ONZ A;  1Y4W A;  3KF3 A;  1Y9M A;  3U14 A;  3WAT A;  2EXH A;  3C7G A;  4N2Z A;  2ADD A;  5GLL A;  5JOY A;  3LDK A;  1ST8 A;  4U6B A;  3C7H A;  1OYG A;  3QZ4 A;  1W2T A;  4O8O A;  2X8F A;  4UDJ A;  3WAS A;  3ZXJ A;  1VKD A;  3WPZ A;  4FFH A;  3C2U A;  2XQR A;  5GLK A;  3K1U A;  5B6T A;  3D5Y A;  1YRZ A;  2QQW A;  1UYP A;  5GLP A;  3QED A;  4N2R A;  2OXB A;  3VT2 A;  3KF5 A;  5FIX A;  5FKB A;  3C7O A;  2QQV A;  3WAU A;  4KC7 A;  3TAW A;  3OM7 A;  4NOV A;  3CU9 A;  1GYD B;  5FLW A;  5A7V B;  5A8D A;  3OM6 A;  4UDG A;  3SC7 X;  3QEF A;  3VSZ A;  3D5Z A;  3WMY A;  3C7F A;  3D61 A;  4PVI A;  2YFR A;  5C0P A;  4N1I A;  3AKG A;  3WPY A;  3R4Y A;  3AKH A;  4UDK E;  4UDI A;  5FMC A;  4AK7 A;  2AEY A;  3KST A;  5JOZ A;  3U75 A;  3LFI A;  3VSF A;  1UV4 A;  5A8C A;  2EXJ A;  3BYN A;  5GLN A;  2AEZ A;  5AYE A;  4EQV A;  3NQH A; 
#chains in the Genus database with same CATH topology
 2YFS A;  3LIH A;  5GLR A;  3ZXL A;  1WL7 A;  2VDT A;  3LDR A;  4QQS A;  3UGG A;  5AYC A;  3P2N A;  2X8S A;  4N4B A;  3C7E A;  5JOW A;  1PT2 A;  3AKI A;  3BYK A;  4O8P A;  3OM4 A;  3PIJ A;  4AK6 A;  2EXI A;  3QEE A;  4FFG A;  4FFF A;  2QQU A;  2AC1 A;  3WN2 A;  3R4Z A;  5GLO A;  3WN0 A;  3WPV A;  3D60 A;  5FKC A;  5FMD A;  3BYJ A;  3AKF A;  2EXK A;  2X8T A;  4U6D A;  5AY9 A;  1W18 A;  3PIG A;  5GLM A;  3OM2 A;  3VT0 A;  4AK5 A;  3VSR A;  3WN1 A;  1GYH A;  4D47 A;  5A7V A;  3QC2 A;  3WPU A;  4UDK A;  3VT1 A;  4O8N A;  5JOX A;  1YI7 A;  1Y7B A;  5GLQ A;  3UGF A;  4COT A;  5AYD A;  5FMB A;  4MLG A;  2B4W A;  4KC8 A;  4KCA A;  2ADE A;  3OM5 A;  1GYE B;  5FK8 A;  3WMZ A;  3UGH A;  3R67 A;  4KCB A;  3LEM A;  5ANN A;  3BYL A;  2YFT A;  3ZXK A;  3VSS A;  1Y9G A;  3LF7 A;  3RWK X;  4PVA A;  5FK7 A;  3LV4 A;  4KMI A;  1YIF A;  5B6S A;  3LIG A;  4FFI A;  4ONZ A;  1Y4W A;  3KF3 A;  1Y9M A;  3U14 A;  3WAT A;  2EXH A;  3C7G A;  4N2Z A;  2ADD A;  5GLL A;  5JOY A;  3LDK A;  1ST8 A;  4U6B A;  5C2M A;  3C7H A;  1OYG A;  3QZ4 A;  1W2T A;  4O8O A;  2X8F A;  4UDJ A;  3WAS A;  3ZXJ A;  1VKD A;  3WPZ A;  4FFH A;  3C2U A;  2XQR A;  5GLK A;  3K1U A;  5B6T A;  3D5Y A;  1YRZ A;  2QQW A;  1UYP A;  5GLP A;  3QED A;  4N2R A;  2OXB A;  3VT2 A;  3KF5 A;  5FIX A;  5FKB A;  3C7O A;  2QQV A;  3WAU A;  4KC7 A;  3TAW A;  3OM7 A;  4NOV A;  3CU9 A;  1GYD B;  5FLW A;  5A7V B;  5A8D A;  3OM6 A;  4UDG A;  3SC7 X;  3QEF A;  3VSZ A;  3D5Z A;  3WMY A;  3C7F A;  3D61 A;  4PVI A;  2YFR A;  5C0P A;  4N1I A;  3AKG A;  3WPY A;  3R4Y A;  3AKH A;  4UDK E;  4UDI A;  5FMC A;  4AK7 A;  1TL2 A;  2AEY A;  3KST A;  5JOZ A;  3U75 A;  3LFI A;  3VSF A;  1UV4 A;  5A8C A;  2EXJ A;  3BYN A;  5GLN A;  2AEZ A;  5AYE A;  4EQV A;  3NQH A; 
#chains in the Genus database with same CATH homology
 2YFS A;  3LIH A;  5GLR A;  3ZXL A;  1WL7 A;  2VDT A;  3LDR A;  4QQS A;  3UGG A;  5AYC A;  3P2N A;  2X8S A;  4N4B A;  3C7E A;  5JOW A;  1PT2 A;  3AKI A;  3BYK A;  4O8P A;  3OM4 A;  3PIJ A;  4AK6 A;  2EXI A;  3QEE A;  4FFG A;  4FFF A;  2QQU A;  2AC1 A;  3WN2 A;  3R4Z A;  5GLO A;  3WN0 A;  3WPV A;  3D60 A;  5FKC A;  5FMD A;  3BYJ A;  3AKF A;  2EXK A;  2X8T A;  4U6D A;  5AY9 A;  1W18 A;  3PIG A;  5GLM A;  3OM2 A;  3VT0 A;  4AK5 A;  3VSR A;  3WN1 A;  1GYH A;  4D47 A;  5A7V A;  3QC2 A;  3WPU A;  4UDK A;  3VT1 A;  4O8N A;  5JOX A;  1YI7 A;  1Y7B A;  5GLQ A;  3UGF A;  4COT A;  5AYD A;  5FMB A;  4MLG A;  2B4W A;  4KC8 A;  4KCA A;  2ADE A;  3OM5 A;  1GYE B;  5FK8 A;  3WMZ A;  3UGH A;  3R67 A;  4KCB A;  3LEM A;  5ANN A;  3BYL A;  2YFT A;  3ZXK A;  3VSS A;  1Y9G A;  3LF7 A;  3RWK X;  4PVA A;  5FK7 A;  3LV4 A;  4KMI A;  1YIF A;  5B6S A;  3LIG A;  4FFI A;  4ONZ A;  1Y4W A;  3KF3 A;  1Y9M A;  3U14 A;  3WAT A;  2EXH A;  3C7G A;  4N2Z A;  2ADD A;  5GLL A;  5JOY A;  3LDK A;  1ST8 A;  4U6B A;  3C7H A;  1OYG A;  3QZ4 A;  1W2T A;  4O8O A;  2X8F A;  4UDJ A;  3WAS A;  3ZXJ A;  1VKD A;  3WPZ A;  4FFH A;  3C2U A;  2XQR A;  5GLK A;  3K1U A;  5B6T A;  3D5Y A;  1YRZ A;  2QQW A;  1UYP A;  5GLP A;  3QED A;  4N2R A;  2OXB A;  3VT2 A;  3KF5 A;  5FIX A;  5FKB A;  3C7O A;  2QQV A;  3WAU A;  4KC7 A;  3TAW A;  3OM7 A;  4NOV A;  3CU9 A;  1GYD B;  5FLW A;  5A7V B;  5A8D A;  3OM6 A;  4UDG A;  3SC7 X;  3QEF A;  3VSZ A;  3D5Z A;  3WMY A;  3C7F A;  3D61 A;  4PVI A;  2YFR A;  5C0P A;  4N1I A;  3AKG A;  3WPY A;  3R4Y A;  3AKH A;  4UDK E;  4UDI A;  5FMC A;  4AK7 A;  2AEY A;  3KST A;  5JOZ A;  3U75 A;  3LFI A;  3VSF A;  1UV4 A;  5A8C A;  2EXJ A;  3BYN A;  5GLN A;  2AEZ A;  5AYE A;  4EQV A;  3NQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...