5GLKA

Crystal structure of coxyl43, gh43 beta-xylosidase/alpha-arabinofuranosidase from a compost microbial metagenome, calcium-free form.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
330
structure length
330
Chain Sequence
VPRGSHMEPLVTHIYTADPSAHVFDGKVYIYPSHDIDAGTPENDMGDHFDMRDYHVLSMNSIPGEVTDHGVALDIKDIPWAGRQLWAPDAASKDGKYYLYFPAKDKEDIFRIGVAVSDSPAGPFKPESEPIKGSYSIDPAVFKDDDGKYYMYFGGIWGGQLQRWTTGEYAGHDASKTDLEQDDAPAIGPRIALMSDDMLSFAEPVKEISIVDEQGNPILGGDHDRRFFEAAWMHKYNGTYYLSYSTGDTHYIVYATGDNPYGPFTYRGVILNPVIGWTNHHSIVEFNGKWYLFYHDSSLSGGKTHLRCIKVTELTHNADGTIETISPYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 43
publication title Crystal structure of metagenomic beta-xylosidase/ alpha-l-arabinofuranosidase activated by calcium.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 85
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 5glkA00
3OM5A 4N1IA 5GLMA 3VT1A 4D47A 3LEMA 3LF7A 4KMIA 4KCBA 5JOZA 1OYGA 3AKIA 3LIHA 3AKFA 1PT2A 4FFIA 3KSTA 5FKCA 3WPUA 3VSZA 3UGGA 4UDKA 3C7FA 5GLNA 5GLPA 4FFHA 2AEZA 3R67A 2X8FA 5GLKA 3LFIA 3WMZA 3C7EA 3U14A 5FMBA 3WAUA 3QZ4A 2VDTA 4NOVA 3C2UA 1W2TA 3RWKX 1VKDA 3LDRA 5AYEA 3OM6A 1Y9GA 3P2NA 4PVIA 5FLWA 3AKHA 4KC8A 3QEFA 3TAWA 4UDJA 1YRZA 1Y7BA 3BYJA 3WN2A 1UV4A 5AYDA 2YFRA 2EXIA 2QQVA 3BYNA 2AEYA 5FKBA 2EXJA 5A8DA 3VT0A 3VT2A 2YFTA 3R4ZA 4UDIA 3SC7X 4AK7A 3LDKA 2B4WA 3OM7A 3QEDA 5JOYA 3KF5A 1GYHA 3OM4A 3D5ZA 5GLRA 2ADDA 5B6TA 4U6BA 1GYEB 3ZXKA 3QC2A 4EQVA 3NQHA 1YI7A 4FFFA 2X8SA 3WN1A 4U6DA 1UYPA 5FMDA 4O8OA 4KCAA 2X8TA 1WL7A 4UDKE 3WASA 5JOWA 5FIXA 4N2ZA 5GLLA 4FFGA 2ADEA 3UGFA 3U75A 3UGHA 5A8CA 5C0PA 2QQWA 4O8NA 3D5YA 2XQRA 5FMCA 3OM2A 3WPYA 3LIGA 4N4BA 3D60A 1Y9MA 4QQSA 2EXHA 3ZXJA 3D61A 3C7OA 3VSRA 4AK5A 5AY9A 2QQUA 3C7HA 3C7GA 4MLGA 4ONZA 5A7VA 1Y4WA 5A7VB 3AKGA 1W18A 1ST8A 2AC1A 3KF3A 3VSSA 4COTA 3VSFA 3BYLA 3R4YA 3PIGA 3WPZA 3ZXLA 3WN0A 5GLQA 5GLOA 5FK7A 1GYDB 3K1UA 4N2RA 4UDGA 5B6SA 2OXBA 4PVAA 5AYCA 3CU9A 3LV4A 2EXKA 4O8PA 3PIJA 3WATA 3WMYA 5ANNA 4AK6A 3BYKA 1YIFA 3QEEA 3WPVA 4KC7A 5JOXA 5FK8A 2YFSA
chains in the Genus database with same CATH superfamily
3OM5A 4N1IA 5GLMA 3VT1A 4D47A 3LEMA 3LF7A 4KMIA 4KCBA 5JOZA 1OYGA 3AKIA 3LIHA 3AKFA 1PT2A 4FFIA 3KSTA 5FKCA 3WPUA 3VSZA 3UGGA 4UDKA 3C7FA 5GLNA 5GLPA 4FFHA 2AEZA 3R67A 2X8FA 5GLKA 3LFIA 3WMZA 3C7EA 3U14A 5FMBA 3WAUA 3QZ4A 2VDTA 4NOVA 3C2UA 1W2TA 3RWKX 1VKDA 3LDRA 5AYEA 3OM6A 1Y9GA 3P2NA 4PVIA 5FLWA 3AKHA 4KC8A 3QEFA 3TAWA 4UDJA 1YRZA 1Y7BA 3BYJA 3WN2A 1UV4A 5AYDA 2YFRA 2EXIA 2QQVA 3BYNA 2AEYA 5FKBA 2EXJA 5A8DA 3VT0A 3VT2A 2YFTA 3R4ZA 4UDIA 3SC7X 4AK7A 3LDKA 2B4WA 3OM7A 3QEDA 5JOYA 3KF5A 1GYHA 3OM4A 3D5ZA 5GLRA 2ADDA 5B6TA 4U6BA 1TL2A 1GYEB 3ZXKA 3QC2A 4EQVA 3NQHA 1YI7A 4FFFA 2X8SA 3WN1A 4U6DA 1UYPA 5FMDA 4O8OA 4KCAA 2X8TA 1WL7A 4UDKE 5C2MA 3WASA 5JOWA 5FIXA 4N2ZA 5GLLA 4FFGA 2ADEA 3UGFA 3U75A 3UGHA 5A8CA 5C0PA 2QQWA 4O8NA 3D5YA 2XQRA 5FMCA 3OM2A 3WPYA 3LIGA 4N4BA 3D60A 1Y9MA 4QQSA 2EXHA 3ZXJA 3D61A 3C7OA 3VSRA 4AK5A 5AY9A 2QQUA 3C7HA 3C7GA 4MLGA 4ONZA 5A7VA 1Y4WA 5A7VB 3AKGA 1W18A 1ST8A 2AC1A 3KF3A 3VSSA 4COTA 3VSFA 3BYLA 3R4YA 3PIGA 3WPZA 3ZXLA 3WN0A 5GLQA 5GLOA 5FK7A 1GYDB 3K1UA 4N2RA 4UDGA 5B6SA 2OXBA 4PVAA 5AYCA 3CU9A 3LV4A 2EXKA 4O8PA 3PIJA 3WATA 3WMYA 5ANNA 4AK6A 3BYKA 1YIFA 3QEEA 3WPVA 4KC7A 5JOXA 5FK8A 2YFSA
chains in the Genus database with same CATH topology
3OM5A 4N1IA 5GLMA 3VT1A 4D47A 3LEMA 3LF7A 4KMIA 4KCBA 5JOZA 1OYGA 3AKIA 3LIHA 3AKFA 1PT2A 4FFIA 3KSTA 5FKCA 3WPUA 3VSZA 3UGGA 4UDKA 3C7FA 5GLNA 5GLPA 4FFHA 2AEZA 3R67A 2X8FA 5GLKA 3LFIA 3WMZA 3C7EA 3U14A 5FMBA 3WAUA 3QZ4A 2VDTA 4NOVA 3C2UA 1W2TA 3RWKX 1VKDA 3LDRA 5AYEA 3OM6A 1Y9GA 3P2NA 4PVIA 5FLWA 3AKHA 4KC8A 3QEFA 3TAWA 4UDJA 1YRZA 1Y7BA 3BYJA 3WN2A 1UV4A 5AYDA 2YFRA 2EXIA 2QQVA 3BYNA 2AEYA 5FKBA 2EXJA 5A8DA 3VT0A 3VT2A 2YFTA 3R4ZA 4UDIA 3SC7X 4AK7A 3LDKA 2B4WA 3OM7A 3QEDA 5JOYA 3KF5A 1GYHA 3OM4A 3D5ZA 5GLRA 2ADDA 5B6TA 4U6BA 1GYEB 3ZXKA 3QC2A 4EQVA 3NQHA 1YI7A 4FFFA 2X8SA 3WN1A 4U6DA 1UYPA 5FMDA 4O8OA 4KCAA 2X8TA 1WL7A 4UDKE 3WASA 5JOWA 5FIXA 4N2ZA 5GLLA 4FFGA 2ADEA 3UGFA 3U75A 3UGHA 5A8CA 5C0PA 2QQWA 4O8NA 3D5YA 2XQRA 5FMCA 3OM2A 3WPYA 3LIGA 4N4BA 3D60A 1Y9MA 4QQSA 2EXHA 3ZXJA 3D61A 3C7OA 3VSRA 4AK5A 5AY9A 2QQUA 3C7HA 3C7GA 4MLGA 4ONZA 5A7VA 1Y4WA 5A7VB 3AKGA 1W18A 1ST8A 2AC1A 3KF3A 3VSSA 4COTA 3VSFA 3BYLA 3R4YA 3PIGA 3WPZA 3ZXLA 3WN0A 5GLQA 5GLOA 5FK7A 1GYDB 3K1UA 4N2RA 4UDGA 5B6SA 2OXBA 4PVAA 5AYCA 3CU9A 3LV4A 2EXKA 4O8PA 3PIJA 3WATA 3WMYA 5ANNA 4AK6A 3BYKA 1YIFA 3QEEA 3WPVA 4KC7A 5JOXA 5FK8A 2YFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OM5 A;  4N1I A;  5GLM A;  3VT1 A;  4D47 A;  3LEM A;  3LF7 A;  4KMI A;  4KCB A;  5JOZ A;  1OYG A;  3AKI A;  3LIH A;  3AKF A;  1PT2 A;  4FFI A;  3KST A;  5FKC A;  3WPU A;  3VSZ A;  3UGG A;  4UDK A;  3C7F A;  5GLN A;  5GLP A;  4FFH A;  2AEZ A;  3R67 A;  2X8F A;  5GLK A;  3LFI A;  3WMZ A;  3C7E A;  3U14 A;  5FMB A;  3WAU A;  3QZ4 A;  2VDT A;  4NOV A;  3C2U A;  1W2T A;  3RWK X;  1VKD A;  3LDR A;  5AYE A;  3OM6 A;  1Y9G A;  3P2N A;  4PVI A;  5FLW A;  3AKH A;  4KC8 A;  3QEF A;  3TAW A;  4UDJ A;  1YRZ A;  1Y7B A;  3BYJ A;  3WN2 A;  1UV4 A;  5AYD A;  2YFR A;  2EXI A;  2QQV A;  3BYN A;  2AEY A;  5FKB A;  2EXJ A;  5A8D A;  3VT0 A;  3VT2 A;  2YFT A;  3R4Z A;  4UDI A;  3SC7 X;  4AK7 A;  3LDK A;  2B4W A;  3OM7 A;  3QED A;  5JOY A;  3KF5 A;  1GYH A;  3OM4 A;  3D5Z A;  5GLR A;  2ADD A;  5B6T A;  4U6B A;  1GYE B;  3ZXK A;  3QC2 A;  4EQV A;  3NQH A;  1YI7 A;  4FFF A;  2X8S A;  3WN1 A;  4U6D A;  1UYP A;  5FMD A;  4O8O A;  4KCA A;  2X8T A;  1WL7 A;  4UDK E;  3WAS A;  5JOW A;  5FIX A;  4N2Z A;  5GLL A;  4FFG A;  2ADE A;  3UGF A;  3U75 A;  3UGH A;  5A8C A;  5C0P A;  2QQW A;  4O8N A;  3D5Y A;  2XQR A;  5FMC A;  3OM2 A;  3WPY A;  3LIG A;  4N4B A;  3D60 A;  1Y9M A;  4QQS A;  2EXH A;  3ZXJ A;  3D61 A;  3C7O A;  3VSR A;  4AK5 A;  5AY9 A;  2QQU A;  3C7H A;  3C7G A;  4MLG A;  4ONZ A;  5A7V A;  1Y4W A;  5A7V B;  3AKG A;  1W18 A;  1ST8 A;  2AC1 A;  3KF3 A;  3VSS A;  4COT A;  3VSF A;  3BYL A;  3R4Y A;  3PIG A;  3WPZ A;  3ZXL A;  3WN0 A;  5GLQ A;  5GLO A;  5FK7 A;  1GYD B;  3K1U A;  4N2R A;  4UDG A;  5B6S A;  2OXB A;  4PVA A;  5AYC A;  3CU9 A;  3LV4 A;  2EXK A;  4O8P A;  3PIJ A;  3WAT A;  3WMY A;  5ANN A;  4AK6 A;  3BYK A;  1YIF A;  3QEE A;  3WPV A;  4KC7 A;  5JOX A;  5FK8 A;  2YFS A; 
#chains in the Genus database with same CATH topology
 3OM5 A;  4N1I A;  5GLM A;  3VT1 A;  4D47 A;  3LEM A;  3LF7 A;  4KMI A;  4KCB A;  5JOZ A;  1OYG A;  3AKI A;  3LIH A;  3AKF A;  1PT2 A;  4FFI A;  3KST A;  5FKC A;  3WPU A;  3VSZ A;  3UGG A;  4UDK A;  3C7F A;  5GLN A;  5GLP A;  4FFH A;  2AEZ A;  3R67 A;  2X8F A;  5GLK A;  3LFI A;  3WMZ A;  3C7E A;  3U14 A;  5FMB A;  3WAU A;  3QZ4 A;  2VDT A;  4NOV A;  3C2U A;  1W2T A;  3RWK X;  1VKD A;  3LDR A;  5AYE A;  3OM6 A;  1Y9G A;  3P2N A;  4PVI A;  5FLW A;  3AKH A;  4KC8 A;  3QEF A;  3TAW A;  4UDJ A;  1YRZ A;  1Y7B A;  3BYJ A;  3WN2 A;  1UV4 A;  5AYD A;  2YFR A;  2EXI A;  2QQV A;  3BYN A;  2AEY A;  5FKB A;  2EXJ A;  5A8D A;  3VT0 A;  3VT2 A;  2YFT A;  3R4Z A;  4UDI A;  3SC7 X;  4AK7 A;  3LDK A;  2B4W A;  3OM7 A;  3QED A;  5JOY A;  3KF5 A;  1GYH A;  3OM4 A;  3D5Z A;  5GLR A;  2ADD A;  5B6T A;  4U6B A;  1TL2 A;  1GYE B;  3ZXK A;  3QC2 A;  4EQV A;  3NQH A;  1YI7 A;  4FFF A;  2X8S A;  3WN1 A;  4U6D A;  1UYP A;  5FMD A;  4O8O A;  4KCA A;  2X8T A;  1WL7 A;  4UDK E;  5C2M A;  3WAS A;  5JOW A;  5FIX A;  4N2Z A;  5GLL A;  4FFG A;  2ADE A;  3UGF A;  3U75 A;  3UGH A;  5A8C A;  5C0P A;  2QQW A;  4O8N A;  3D5Y A;  2XQR A;  5FMC A;  3OM2 A;  3WPY A;  3LIG A;  4N4B A;  3D60 A;  1Y9M A;  4QQS A;  2EXH A;  3ZXJ A;  3D61 A;  3C7O A;  3VSR A;  4AK5 A;  5AY9 A;  2QQU A;  3C7H A;  3C7G A;  4MLG A;  4ONZ A;  5A7V A;  1Y4W A;  5A7V B;  3AKG A;  1W18 A;  1ST8 A;  2AC1 A;  3KF3 A;  3VSS A;  4COT A;  3VSF A;  3BYL A;  3R4Y A;  3PIG A;  3WPZ A;  3ZXL A;  3WN0 A;  5GLQ A;  5GLO A;  5FK7 A;  1GYD B;  3K1U A;  4N2R A;  4UDG A;  5B6S A;  2OXB A;  4PVA A;  5AYC A;  3CU9 A;  3LV4 A;  2EXK A;  4O8P A;  3PIJ A;  3WAT A;  3WMY A;  5ANN A;  4AK6 A;  3BYK A;  1YIF A;  3QEE A;  3WPV A;  4KC7 A;  5JOX A;  5FK8 A;  2YFS A; 
#chains in the Genus database with same CATH homology
 3OM5 A;  4N1I A;  5GLM A;  3VT1 A;  4D47 A;  3LEM A;  3LF7 A;  4KMI A;  4KCB A;  5JOZ A;  1OYG A;  3AKI A;  3LIH A;  3AKF A;  1PT2 A;  4FFI A;  3KST A;  5FKC A;  3WPU A;  3VSZ A;  3UGG A;  4UDK A;  3C7F A;  5GLN A;  5GLP A;  4FFH A;  2AEZ A;  3R67 A;  2X8F A;  5GLK A;  3LFI A;  3WMZ A;  3C7E A;  3U14 A;  5FMB A;  3WAU A;  3QZ4 A;  2VDT A;  4NOV A;  3C2U A;  1W2T A;  3RWK X;  1VKD A;  3LDR A;  5AYE A;  3OM6 A;  1Y9G A;  3P2N A;  4PVI A;  5FLW A;  3AKH A;  4KC8 A;  3QEF A;  3TAW A;  4UDJ A;  1YRZ A;  1Y7B A;  3BYJ A;  3WN2 A;  1UV4 A;  5AYD A;  2YFR A;  2EXI A;  2QQV A;  3BYN A;  2AEY A;  5FKB A;  2EXJ A;  5A8D A;  3VT0 A;  3VT2 A;  2YFT A;  3R4Z A;  4UDI A;  3SC7 X;  4AK7 A;  3LDK A;  2B4W A;  3OM7 A;  3QED A;  5JOY A;  3KF5 A;  1GYH A;  3OM4 A;  3D5Z A;  5GLR A;  2ADD A;  5B6T A;  4U6B A;  1GYE B;  3ZXK A;  3QC2 A;  4EQV A;  3NQH A;  1YI7 A;  4FFF A;  2X8S A;  3WN1 A;  4U6D A;  1UYP A;  5FMD A;  4O8O A;  4KCA A;  2X8T A;  1WL7 A;  4UDK E;  3WAS A;  5JOW A;  5FIX A;  4N2Z A;  5GLL A;  4FFG A;  2ADE A;  3UGF A;  3U75 A;  3UGH A;  5A8C A;  5C0P A;  2QQW A;  4O8N A;  3D5Y A;  2XQR A;  5FMC A;  3OM2 A;  3WPY A;  3LIG A;  4N4B A;  3D60 A;  1Y9M A;  4QQS A;  2EXH A;  3ZXJ A;  3D61 A;  3C7O A;  3VSR A;  4AK5 A;  5AY9 A;  2QQU A;  3C7H A;  3C7G A;  4MLG A;  4ONZ A;  5A7V A;  1Y4W A;  5A7V B;  3AKG A;  1W18 A;  1ST8 A;  2AC1 A;  3KF3 A;  3VSS A;  4COT A;  3VSF A;  3BYL A;  3R4Y A;  3PIG A;  3WPZ A;  3ZXL A;  3WN0 A;  5GLQ A;  5GLO A;  5FK7 A;  1GYD B;  3K1U A;  4N2R A;  4UDG A;  5B6S A;  2OXB A;  4PVA A;  5AYC A;  3CU9 A;  3LV4 A;  2EXK A;  4O8P A;  3PIJ A;  3WAT A;  3WMY A;  5ANN A;  4AK6 A;  3BYK A;  1YIF A;  3QEE A;  3WPV A;  4KC7 A;  5JOX A;  5FK8 A;  2YFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...