5GLRA

Crystal structure of coxyl43, gh43 beta-xylosidase/alpha-arabinofuranosidase from a compostmicrobial metagenome in complex with l-arabinose and xylotriose, calcium-bound form
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
330
structure length
330
Chain Sequence
VPRGSHMEPLVTHIYTADPSAHVFDGKVYIYPSHDIDAGTPENDMGDHFDMRDYHVLSMNSIPGEVTDHGVALDIKDIPWAGRQLWAPDAASKDGKYYLYFPAKDKEDIFRIGVAVSDSPAGPFKPESEPIKGSYSIDPAVFKDDDGKYYMYFGGIWGGQLQRWTTGEYAGHDASKTDLEQDDAPAIGPRIALMSDDMLSFAEPVKEISIVDEQGNPILGGDHDRRFFEAAWMHKYNGTYYLSYSTGDTHYIVYATGDNPYGPFTYRGVILNPVIGWTNHHSIVEFNGKWYLFYHDSSLSGGKTHLRCIKVTELTHNADGTIETISPYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 43
publication title Crystal structure of metagenomic beta-xylosidase/ alpha-l-arabinofuranosidase activated by calcium.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 88
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 5glrA00
3WATA 3KF3A 3OM7A 4FFIA 3R4ZA 4O8PA 1UYPA 3LDRA 5GLOA 2QQWA 3QEFA 5FMBA 3RWKX 1Y9GA 1YIFA 3VT1A 5ANNA 3OM2A 2X8TA 3LIHA 5FMCA 5JOZA 3BYNA 1Y7BA 4AK7A 5GLQA 4U6DA 3AKFA 2X8FA 4EQVA 3VSSA 3D5YA 4O8NA 5AYDA 3AKIA 5AYEA 3OM5A 5GLLA 1YRZA 4NOVA 3ZXKA 3U14A 3WPZA 2QQUA 4UDGA 3C7GA 3C7OA 5A7VB 1UV4A 1Y9MA 4D47A 1W2TA 3VT0A 1GYEB 3C7EA 5FKCA 3PIGA 1VKDA 4UDKE 5FK8A 3R4YA 4FFGA 4FFHA 2AEYA 1OYGA 3WPUA 4N2ZA 3ZXLA 3WN2A 5AYCA 5GLRA 3D60A 3SC7X 3AKHA 4FFFA 5FKBA 5GLMA 2EXJA 3OM6A 4AK5A 3ZXJA 3NQHA 5JOYA 3VSRA 5A7VA 3LF7A 4KCAA 3C7FA 4O8OA 3C7HA 1Y4WA 5AY9A 3UGFA 2ADDA 2B4WA 2YFRA 5A8CA 4KMIA 5FIXA 4UDIA 5JOXA 3VSZA 3LFIA 4MLGA 5FK7A 3VSFA 4KC7A 1YI7A 3KF5A 3PIJA 2AC1A 2EXIA 2OXBA 4U6BA 3QC2A 5GLKA 5B6SA 5JOWA 4KC8A 4PVIA 3BYLA 3CU9A 3LDKA 4UDJA 3R67A 1W18A 3WMZA 3TAWA 3AKGA 3BYKA 5FLWA 1GYHA 4UDKA 4PVAA 4QQSA 1WL7A 2QQVA 4ONZA 3WPVA 1PT2A 5FMDA 3OM4A 3BYJA 3WAUA 3WN0A 3C2UA 1GYDB 3U75A 2EXHA 3WASA 3UGHA 3QEEA 3D5ZA 3WMYA 2YFTA 5GLPA 5C0PA 3QZ4A 3K1UA 3LIGA 3LV4A 4AK6A 3UGGA 2YFSA 3VT2A 5A8DA 2VDTA 3D61A 3P2NA 5GLNA 2ADEA 5B6TA 4KCBA 2EXKA 4N2RA 3WPYA 3QEDA 4N1IA 3WN1A 2X8SA 3LEMA 4COTA 3KSTA 2XQRA 4N4BA 2AEZA 1ST8A
chains in the Genus database with same CATH superfamily
3WATA 3KF3A 3OM7A 4FFIA 3R4ZA 4O8PA 1UYPA 3LDRA 5GLOA 2QQWA 3QEFA 5FMBA 3RWKX 1Y9GA 1YIFA 3VT1A 5ANNA 3OM2A 1TL2A 2X8TA 3LIHA 5FMCA 5JOZA 3BYNA 1Y7BA 4AK7A 5GLQA 4U6DA 3AKFA 2X8FA 4EQVA 3VSSA 3D5YA 4O8NA 5AYDA 3AKIA 5AYEA 3OM5A 5GLLA 1YRZA 4NOVA 3ZXKA 3U14A 3WPZA 2QQUA 4UDGA 3C7GA 3C7OA 5A7VB 1UV4A 1Y9MA 4D47A 1W2TA 3VT0A 1GYEB 3C7EA 5FKCA 3PIGA 1VKDA 4UDKE 5FK8A 3R4YA 4FFGA 4FFHA 2AEYA 1OYGA 3WPUA 4N2ZA 3ZXLA 3WN2A 5AYCA 5GLRA 3D60A 3SC7X 3AKHA 4FFFA 5FKBA 5GLMA 2EXJA 3OM6A 4AK5A 3ZXJA 3NQHA 5JOYA 5C2MA 3VSRA 5A7VA 3LF7A 4KCAA 3C7FA 4O8OA 3C7HA 1Y4WA 5AY9A 3UGFA 2ADDA 2B4WA 2YFRA 5A8CA 4KMIA 5FIXA 4UDIA 5JOXA 3VSZA 3LFIA 4MLGA 5FK7A 3VSFA 4KC7A 1YI7A 3KF5A 3PIJA 2AC1A 2EXIA 2OXBA 4U6BA 3QC2A 5GLKA 5B6SA 5JOWA 4KC8A 4PVIA 3BYLA 3CU9A 3LDKA 4UDJA 3R67A 1W18A 3WMZA 3TAWA 3AKGA 3BYKA 5FLWA 1GYHA 4UDKA 4PVAA 4QQSA 1WL7A 2QQVA 4ONZA 3WPVA 1PT2A 5FMDA 3OM4A 3BYJA 3WAUA 3WN0A 3C2UA 1GYDB 3U75A 2EXHA 3WASA 3UGHA 3QEEA 3D5ZA 3WMYA 2YFTA 5GLPA 5C0PA 3QZ4A 3K1UA 3LIGA 3LV4A 4AK6A 3UGGA 2YFSA 3VT2A 5A8DA 2VDTA 3D61A 3P2NA 5GLNA 2ADEA 5B6TA 4KCBA 2EXKA 4N2RA 3WPYA 3QEDA 4N1IA 3WN1A 2X8SA 3LEMA 4COTA 3KSTA 2XQRA 4N4BA 2AEZA 1ST8A
chains in the Genus database with same CATH topology
3WATA 3KF3A 3OM7A 4FFIA 3R4ZA 4O8PA 1UYPA 3LDRA 5GLOA 2QQWA 3QEFA 5FMBA 3RWKX 1Y9GA 1YIFA 3VT1A 5ANNA 3OM2A 2X8TA 3LIHA 5FMCA 5JOZA 3BYNA 1Y7BA 4AK7A 5GLQA 4U6DA 3AKFA 2X8FA 4EQVA 3VSSA 3D5YA 4O8NA 5AYDA 3AKIA 5AYEA 3OM5A 5GLLA 1YRZA 4NOVA 3ZXKA 3U14A 3WPZA 2QQUA 4UDGA 3C7GA 3C7OA 5A7VB 1UV4A 1Y9MA 4D47A 1W2TA 3VT0A 1GYEB 3C7EA 5FKCA 3PIGA 1VKDA 4UDKE 5FK8A 3R4YA 4FFGA 4FFHA 2AEYA 1OYGA 3WPUA 4N2ZA 3ZXLA 3WN2A 5AYCA 5GLRA 3D60A 3SC7X 3AKHA 4FFFA 5FKBA 5GLMA 2EXJA 3OM6A 4AK5A 3ZXJA 3NQHA 5JOYA 3VSRA 5A7VA 3LF7A 4KCAA 3C7FA 4O8OA 3C7HA 1Y4WA 5AY9A 3UGFA 2ADDA 2B4WA 2YFRA 5A8CA 4KMIA 5FIXA 4UDIA 5JOXA 3VSZA 3LFIA 4MLGA 5FK7A 3VSFA 4KC7A 1YI7A 3KF5A 3PIJA 2AC1A 2EXIA 2OXBA 4U6BA 3QC2A 5GLKA 5B6SA 5JOWA 4KC8A 4PVIA 3BYLA 3CU9A 3LDKA 4UDJA 3R67A 1W18A 3WMZA 3TAWA 3AKGA 3BYKA 5FLWA 1GYHA 4UDKA 4PVAA 4QQSA 1WL7A 2QQVA 4ONZA 3WPVA 1PT2A 5FMDA 3OM4A 3BYJA 3WAUA 3WN0A 3C2UA 1GYDB 3U75A 2EXHA 3WASA 3UGHA 3QEEA 3D5ZA 3WMYA 2YFTA 5GLPA 5C0PA 3QZ4A 3K1UA 3LIGA 3LV4A 4AK6A 3UGGA 2YFSA 3VT2A 5A8DA 2VDTA 3D61A 3P2NA 5GLNA 2ADEA 5B6TA 4KCBA 2EXKA 4N2RA 3WPYA 3QEDA 4N1IA 3WN1A 2X8SA 3LEMA 4COTA 3KSTA 2XQRA 4N4BA 2AEZA 1ST8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAT A;  3KF3 A;  3OM7 A;  4FFI A;  3R4Z A;  4O8P A;  1UYP A;  3LDR A;  5GLO A;  2QQW A;  3QEF A;  5FMB A;  3RWK X;  1Y9G A;  1YIF A;  3VT1 A;  5ANN A;  3OM2 A;  2X8T A;  3LIH A;  5FMC A;  5JOZ A;  3BYN A;  1Y7B A;  4AK7 A;  5GLQ A;  4U6D A;  3AKF A;  2X8F A;  4EQV A;  3VSS A;  3D5Y A;  4O8N A;  5AYD A;  3AKI A;  5AYE A;  3OM5 A;  5GLL A;  1YRZ A;  4NOV A;  3ZXK A;  3U14 A;  3WPZ A;  2QQU A;  4UDG A;  3C7G A;  3C7O A;  5A7V B;  1UV4 A;  1Y9M A;  4D47 A;  1W2T A;  3VT0 A;  1GYE B;  3C7E A;  5FKC A;  3PIG A;  1VKD A;  4UDK E;  5FK8 A;  3R4Y A;  4FFG A;  4FFH A;  2AEY A;  1OYG A;  3WPU A;  4N2Z A;  3ZXL A;  3WN2 A;  5AYC A;  5GLR A;  3D60 A;  3SC7 X;  3AKH A;  4FFF A;  5FKB A;  5GLM A;  2EXJ A;  3OM6 A;  4AK5 A;  3ZXJ A;  3NQH A;  5JOY A;  3VSR A;  5A7V A;  3LF7 A;  4KCA A;  3C7F A;  4O8O A;  3C7H A;  1Y4W A;  5AY9 A;  3UGF A;  2ADD A;  2B4W A;  2YFR A;  5A8C A;  4KMI A;  5FIX A;  4UDI A;  5JOX A;  3VSZ A;  3LFI A;  4MLG A;  5FK7 A;  3VSF A;  4KC7 A;  1YI7 A;  3KF5 A;  3PIJ A;  2AC1 A;  2EXI A;  2OXB A;  4U6B A;  3QC2 A;  5GLK A;  5B6S A;  5JOW A;  4KC8 A;  4PVI A;  3BYL A;  3CU9 A;  3LDK A;  4UDJ A;  3R67 A;  1W18 A;  3WMZ A;  3TAW A;  3AKG A;  3BYK A;  5FLW A;  1GYH A;  4UDK A;  4PVA A;  4QQS A;  1WL7 A;  2QQV A;  4ONZ A;  3WPV A;  1PT2 A;  5FMD A;  3OM4 A;  3BYJ A;  3WAU A;  3WN0 A;  3C2U A;  1GYD B;  3U75 A;  2EXH A;  3WAS A;  3UGH A;  3QEE A;  3D5Z A;  3WMY A;  2YFT A;  5GLP A;  5C0P A;  3QZ4 A;  3K1U A;  3LIG A;  3LV4 A;  4AK6 A;  3UGG A;  2YFS A;  3VT2 A;  5A8D A;  2VDT A;  3D61 A;  3P2N A;  5GLN A;  2ADE A;  5B6T A;  4KCB A;  2EXK A;  4N2R A;  3WPY A;  3QED A;  4N1I A;  3WN1 A;  2X8S A;  3LEM A;  4COT A;  3KST A;  2XQR A;  4N4B A;  2AEZ A;  1ST8 A; 
#chains in the Genus database with same CATH topology
 3WAT A;  3KF3 A;  3OM7 A;  4FFI A;  3R4Z A;  4O8P A;  1UYP A;  3LDR A;  5GLO A;  2QQW A;  3QEF A;  5FMB A;  3RWK X;  1Y9G A;  1YIF A;  3VT1 A;  5ANN A;  3OM2 A;  1TL2 A;  2X8T A;  3LIH A;  5FMC A;  5JOZ A;  3BYN A;  1Y7B A;  4AK7 A;  5GLQ A;  4U6D A;  3AKF A;  2X8F A;  4EQV A;  3VSS A;  3D5Y A;  4O8N A;  5AYD A;  3AKI A;  5AYE A;  3OM5 A;  5GLL A;  1YRZ A;  4NOV A;  3ZXK A;  3U14 A;  3WPZ A;  2QQU A;  4UDG A;  3C7G A;  3C7O A;  5A7V B;  1UV4 A;  1Y9M A;  4D47 A;  1W2T A;  3VT0 A;  1GYE B;  3C7E A;  5FKC A;  3PIG A;  1VKD A;  4UDK E;  5FK8 A;  3R4Y A;  4FFG A;  4FFH A;  2AEY A;  1OYG A;  3WPU A;  4N2Z A;  3ZXL A;  3WN2 A;  5AYC A;  5GLR A;  3D60 A;  3SC7 X;  3AKH A;  4FFF A;  5FKB A;  5GLM A;  2EXJ A;  3OM6 A;  4AK5 A;  3ZXJ A;  3NQH A;  5JOY A;  5C2M A;  3VSR A;  5A7V A;  3LF7 A;  4KCA A;  3C7F A;  4O8O A;  3C7H A;  1Y4W A;  5AY9 A;  3UGF A;  2ADD A;  2B4W A;  2YFR A;  5A8C A;  4KMI A;  5FIX A;  4UDI A;  5JOX A;  3VSZ A;  3LFI A;  4MLG A;  5FK7 A;  3VSF A;  4KC7 A;  1YI7 A;  3KF5 A;  3PIJ A;  2AC1 A;  2EXI A;  2OXB A;  4U6B A;  3QC2 A;  5GLK A;  5B6S A;  5JOW A;  4KC8 A;  4PVI A;  3BYL A;  3CU9 A;  3LDK A;  4UDJ A;  3R67 A;  1W18 A;  3WMZ A;  3TAW A;  3AKG A;  3BYK A;  5FLW A;  1GYH A;  4UDK A;  4PVA A;  4QQS A;  1WL7 A;  2QQV A;  4ONZ A;  3WPV A;  1PT2 A;  5FMD A;  3OM4 A;  3BYJ A;  3WAU A;  3WN0 A;  3C2U A;  1GYD B;  3U75 A;  2EXH A;  3WAS A;  3UGH A;  3QEE A;  3D5Z A;  3WMY A;  2YFT A;  5GLP A;  5C0P A;  3QZ4 A;  3K1U A;  3LIG A;  3LV4 A;  4AK6 A;  3UGG A;  2YFS A;  3VT2 A;  5A8D A;  2VDT A;  3D61 A;  3P2N A;  5GLN A;  2ADE A;  5B6T A;  4KCB A;  2EXK A;  4N2R A;  3WPY A;  3QED A;  4N1I A;  3WN1 A;  2X8S A;  3LEM A;  4COT A;  3KST A;  2XQR A;  4N4B A;  2AEZ A;  1ST8 A; 
#chains in the Genus database with same CATH homology
 3WAT A;  3KF3 A;  3OM7 A;  4FFI A;  3R4Z A;  4O8P A;  1UYP A;  3LDR A;  5GLO A;  2QQW A;  3QEF A;  5FMB A;  3RWK X;  1Y9G A;  1YIF A;  3VT1 A;  5ANN A;  3OM2 A;  2X8T A;  3LIH A;  5FMC A;  5JOZ A;  3BYN A;  1Y7B A;  4AK7 A;  5GLQ A;  4U6D A;  3AKF A;  2X8F A;  4EQV A;  3VSS A;  3D5Y A;  4O8N A;  5AYD A;  3AKI A;  5AYE A;  3OM5 A;  5GLL A;  1YRZ A;  4NOV A;  3ZXK A;  3U14 A;  3WPZ A;  2QQU A;  4UDG A;  3C7G A;  3C7O A;  5A7V B;  1UV4 A;  1Y9M A;  4D47 A;  1W2T A;  3VT0 A;  1GYE B;  3C7E A;  5FKC A;  3PIG A;  1VKD A;  4UDK E;  5FK8 A;  3R4Y A;  4FFG A;  4FFH A;  2AEY A;  1OYG A;  3WPU A;  4N2Z A;  3ZXL A;  3WN2 A;  5AYC A;  5GLR A;  3D60 A;  3SC7 X;  3AKH A;  4FFF A;  5FKB A;  5GLM A;  2EXJ A;  3OM6 A;  4AK5 A;  3ZXJ A;  3NQH A;  5JOY A;  3VSR A;  5A7V A;  3LF7 A;  4KCA A;  3C7F A;  4O8O A;  3C7H A;  1Y4W A;  5AY9 A;  3UGF A;  2ADD A;  2B4W A;  2YFR A;  5A8C A;  4KMI A;  5FIX A;  4UDI A;  5JOX A;  3VSZ A;  3LFI A;  4MLG A;  5FK7 A;  3VSF A;  4KC7 A;  1YI7 A;  3KF5 A;  3PIJ A;  2AC1 A;  2EXI A;  2OXB A;  4U6B A;  3QC2 A;  5GLK A;  5B6S A;  5JOW A;  4KC8 A;  4PVI A;  3BYL A;  3CU9 A;  3LDK A;  4UDJ A;  3R67 A;  1W18 A;  3WMZ A;  3TAW A;  3AKG A;  3BYK A;  5FLW A;  1GYH A;  4UDK A;  4PVA A;  4QQS A;  1WL7 A;  2QQV A;  4ONZ A;  3WPV A;  1PT2 A;  5FMD A;  3OM4 A;  3BYJ A;  3WAU A;  3WN0 A;  3C2U A;  1GYD B;  3U75 A;  2EXH A;  3WAS A;  3UGH A;  3QEE A;  3D5Z A;  3WMY A;  2YFT A;  5GLP A;  5C0P A;  3QZ4 A;  3K1U A;  3LIG A;  3LV4 A;  4AK6 A;  3UGG A;  2YFS A;  3VT2 A;  5A8D A;  2VDT A;  3D61 A;  3P2N A;  5GLN A;  2ADE A;  5B6T A;  4KCB A;  2EXK A;  4N2R A;  3WPY A;  3QED A;  4N1I A;  3WN1 A;  2X8S A;  3LEM A;  4COT A;  3KST A;  2XQR A;  4N4B A;  2AEZ A;  1ST8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...