The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
12
|
sequence length |
100
|
structure length |
100
|
Chain Sequence |
GSIGLEAEIETTTDETDDGTNTVSHILNVLKDATPIEDVFSFNYPEGIEGPDIKYKKEHVKYTYGPTFLLQFKDKLNVKADAEWVQSTASKIVIPPGMGR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Ribosome loading onto the mRNA cap is driven by conformational coupling between eIF4G and eIF4E.
pubmed doi rcsb |
molecule tags |
Biosynthetic protein, translation
|
source organism |
Saccharomyces cerevisiae
|
molecule keywords |
Eukaryotic translation initiation factor 4E
|
total genus |
12
|
structure length |
100
|
sequence length |
100
|
ec nomenclature | |
pdb deposition date | 2003-11-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF12152 | eIF_4G1 | Eukaryotic translation initiation factor 4G1 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 | Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 |
#chains in the Genus database with same CATH superfamily 1RF8 B; #chains in the Genus database with same CATH topology 4F3F C; 4ZOJ A; 5BO2 A; 4GA6 A; 3TWP A; 1BRW A; 4EAF A; 4X5B A; 4M0R A; 4EAD A; 1ZVW A; 3H5Q A; 2ELC A; 4IJ1 A; 4OWM A; 1O17 A; 4X5E A; 1VQU A; 4OWV A; 4OWU A; 4OWS A; 4X5C A; 3R88 A; 1RF8 B; 4X5A A; 1AZY A; 5C1R A; 4ZOF A; 3UU1 A; 4YI7 A; 5BO3 A; 3R6C A; 1KHD A; 4GKM A; 4N93 A; 4X58 A; 4OWO A; 1GXB A; 1ZXY A; 2J0F A; 3GBR A; 4GA5 A; 2DSJ A; 5C7S A; 2GVQ A; 4OWQ A; 4XR5 A; 1ZYK A; 3QR9 A; 1V8G A; 4N8Q A; 1KGZ A; 3QSA A; 4YYY A; 2BPQ A; 2WK5 A; 5C2L A; 4X59 A; 5EY3 A; 1RRZ A; 4HKM A; 3QQS A; 4GA4 A; 4X5D A; 5EP8 A; 4ZOK A; 1OTP A; 1UOU A; 4GIU A; 4ZTV A; 4N5V A; 2WK6 A; 3QS8 A; 5BYT A; 4MUO A; 2TPT A; 4OWN A; 4LHM A; 5BNE A; 4X46 A; 4YEK A; 4GTN A; #chains in the Genus database with same CATH homology 1RF8 B; 4GA6 A; 4F3F C; 4GA5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...