4X5EA

Anthranilate phosphoribosyltransferase variant r194a from mycobacterium tuberculosis with pyrophosphate, mg2+ and anthranilate bound
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
348
structure length
345
Chain Sequence
b'VPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRALSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRAEIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Structures of Mycobacterium tuberculosis Anthranilate Phosphoribosyltransferase Variants Reveal the Conformational Changes That Facilitate Delivery of the Substrate to the Active Site.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 119
structure length 345
sequence length 348
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4x5eA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4x5eA02
2DSJA 5C7SA 1OTPA 4X5DA 5BO3A 4GA4A 5BNEA 5BO2A 3QQSA 2ELCA 1GXBA 2WK5A 4X5EA 4GKMA 1AZYA 3UU1A 5C2LA 4OWQA 4X5AA 3GBRA 5EY3A 1BRWA 1ZYKA 1UOUA 4IJ1A 4YYYA 4GA5A 4YEKA 3R88A 4XR5A 1ZXYA 1KHDA 4EAFA 3H5QA 5C1RA 1O17A 2WK6A 4OWMA 2TPTA 3TWPA 4GA6A 4X46A 4OWVA 4OWOA 4N5VA 4ZTVA 4ZOFA 4N8QA 1ZVWA 4X59A 4N93A 4YI7A 5EP8A 3QR9A 4MUOA 4X5BA 2BPQA 4LHMA 2J0FA 4X5CA 4ZOKA 3QS8A 1V8GA 2GVQA 4EADA 4GTNA 4OWSA 4HKMA 4OWNA 1KGZA 4M0RA 3QSAA 5BYTA 1VQUA 4GIUA 4X58A 3R6CA 4ZOJA 4OWUA
chains in the Genus database with same CATH superfamily
2DSJA 5C7SA 1OTPA 4X5DA 5BO3A 4GA4A 5BNEA 5BO2A 3QQSA 2ELCA 1GXBA 2WK5A 4X5EA 4GKMA 1AZYA 3UU1A 5C2LA 4OWQA 4X5AA 3GBRA 5EY3A 1BRWA 1ZYKA 1UOUA 4GA5A 4IJ1A 4YYYA 4YEKA 3R88A 4XR5A 1ZXYA 1KHDA 4EAFA 3H5QA 5C1RA 1O17A 2WK6A 4OWMA 2TPTA 3TWPA 4GA6A 4X46A 4OWVA 4OWOA 4N5VA 4ZTVA 4ZOFA 4N8QA 1ZVWA 4X59A 4N93A 4YI7A 1RF8B 5EP8A 3QR9A 4MUOA 4X5BA 2BPQA 4LHMA 2J0FA 1RRZA 4X5CA 4ZOKA 3QS8A 1V8GA 4F3FC 2GVQA 4EADA 4GTNA 4OWSA 4HKMA 4OWNA 1KGZA 4M0RA 3QSAA 5BYTA 1VQUA 4GIUA 4X58A 3R6CA 4ZOJA 4OWUA
chains in the Genus database with same CATH topology
2DSJA 5C7SA 1OTPA 4X5DA 5BO3A 4GA4A 5BNEA 5BO2A 3QQSA 2ELCA 1GXBA 2WK5A 4X5EA 4GKMA 1AZYA 3UU1A 5C2LA 4OWQA 4X5AA 3GBRA 5EY3A 1BRWA 1ZYKA 1UOUA 4IJ1A 4YYYA 4GA5A 4YEKA 3R88A 4XR5A 1ZXYA 1KHDA 4EAFA 3H5QA 5C1RA 1O17A 2WK6A 4OWMA 2TPTA 3TWPA 4GA6A 4X46A 4OWVA 4OWOA 4N5VA 4ZTVA 4ZOFA 4N8QA 1ZVWA 4X59A 4N93A 4YI7A 5EP8A 3QR9A 4MUOA 4X5BA 2BPQA 4LHMA 2J0FA 4X5CA 4ZOKA 3QS8A 1V8GA 2GVQA 4EADA 4GTNA 4OWSA 4HKMA 4OWNA 1KGZA 4M0RA 3QSAA 5BYTA 1VQUA 4GIUA 4X58A 3R6CA 4ZOJA 4OWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSJ A;  5C7S A;  1OTP A;  4X5D A;  5BO3 A;  4GA4 A;  5BNE A;  5BO2 A;  3QQS A;  2ELC A;  1GXB A;  2WK5 A;  4X5E A;  4GKM A;  1AZY A;  3UU1 A;  5C2L A;  4OWQ A;  4X5A A;  3GBR A;  5EY3 A;  1BRW A;  1ZYK A;  1UOU A;  4IJ1 A;  4YYY A;  4GA5 A;  4YEK A;  3R88 A;  4XR5 A;  1ZXY A;  1KHD A;  4EAF A;  3H5Q A;  5C1R A;  1O17 A;  2WK6 A;  4OWM A;  2TPT A;  3TWP A;  4GA6 A;  4X46 A;  4OWV A;  4OWO A;  4N5V A;  4ZTV A;  4ZOF A;  4N8Q A;  1ZVW A;  4X59 A;  4N93 A;  4YI7 A;  5EP8 A;  3QR9 A;  4MUO A;  4X5B A;  2BPQ A;  4LHM A;  2J0F A;  4X5C A;  4ZOK A;  3QS8 A;  1V8G A;  2GVQ A;  4EAD A;  4GTN A;  4OWS A;  4HKM A;  4OWN A;  1KGZ A;  4M0R A;  3QSA A;  5BYT A;  1VQU A;  4GIU A;  4X58 A;  3R6C A;  4ZOJ A;  4OWU A; 
#chains in the Genus database with same CATH topology
 2DSJ A;  5C7S A;  1OTP A;  4X5D A;  5BO3 A;  4GA4 A;  5BNE A;  5BO2 A;  3QQS A;  2ELC A;  1GXB A;  2WK5 A;  4X5E A;  4GKM A;  1AZY A;  3UU1 A;  5C2L A;  4OWQ A;  4X5A A;  3GBR A;  5EY3 A;  1BRW A;  1ZYK A;  1UOU A;  4GA5 A;  4IJ1 A;  4YYY A;  4YEK A;  3R88 A;  4XR5 A;  1ZXY A;  1KHD A;  4EAF A;  3H5Q A;  5C1R A;  1O17 A;  2WK6 A;  4OWM A;  2TPT A;  3TWP A;  4GA6 A;  4X46 A;  4OWV A;  4OWO A;  4N5V A;  4ZTV A;  4ZOF A;  4N8Q A;  1ZVW A;  4X59 A;  4N93 A;  4YI7 A;  1RF8 B;  5EP8 A;  3QR9 A;  4MUO A;  4X5B A;  2BPQ A;  4LHM A;  2J0F A;  1RRZ A;  4X5C A;  4ZOK A;  3QS8 A;  1V8G A;  4F3F C;  2GVQ A;  4EAD A;  4GTN A;  4OWS A;  4HKM A;  4OWN A;  1KGZ A;  4M0R A;  3QSA A;  5BYT A;  1VQU A;  4GIU A;  4X58 A;  3R6C A;  4ZOJ A;  4OWU A; 
#chains in the Genus database with same CATH homology
 2DSJ A;  5C7S A;  1OTP A;  4X5D A;  5BO3 A;  4GA4 A;  5BNE A;  5BO2 A;  3QQS A;  2ELC A;  1GXB A;  2WK5 A;  4X5E A;  4GKM A;  1AZY A;  3UU1 A;  5C2L A;  4OWQ A;  4X5A A;  3GBR A;  5EY3 A;  1BRW A;  1ZYK A;  1UOU A;  4IJ1 A;  4YYY A;  4GA5 A;  4YEK A;  3R88 A;  4XR5 A;  1ZXY A;  1KHD A;  4EAF A;  3H5Q A;  5C1R A;  1O17 A;  2WK6 A;  4OWM A;  2TPT A;  3TWP A;  4GA6 A;  4X46 A;  4OWV A;  4OWO A;  4N5V A;  4ZTV A;  4ZOF A;  4N8Q A;  1ZVW A;  4X59 A;  4N93 A;  4YI7 A;  5EP8 A;  3QR9 A;  4MUO A;  4X5B A;  2BPQ A;  4LHM A;  2J0F A;  4X5C A;  4ZOK A;  3QS8 A;  1V8G A;  2GVQ A;  4EAD A;  4GTN A;  4OWS A;  4HKM A;  4OWN A;  1KGZ A;  4M0R A;  3QSA A;  5BYT A;  1VQU A;  4GIU A;  4X58 A;  3R6C A;  4ZOJ A;  4OWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...