3TWPA

Crystal structure of m. tuberculosis trpd in complex with an inhibitor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
346
structure length
346
Chain Sequence
b'PSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title The Substrate Capture Mechanism of Mycobacterium tuberculosis Anthranilate Phosphoribosyltransferase Provides a Mode for Inhibition.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/transferase inhibitor
total genus 120
structure length 346
sequence length 346
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 3twpA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 3twpA02
2J0FA 4OWOA 4YYYA 2WK5A 3QR9A 1ZVWA 4N8QA 4EADA 5BO3A 1OTPA 3R6CA 4N93A 5C7SA 2DSJA 1ZYKA 5EY3A 4ZOFA 3QSAA 4X5EA 4OWMA 4X5AA 2TPTA 4OWSA 1V8GA 4HKMA 4OWVA 4MUOA 4X5DA 4X5BA 2WK6A 4OWNA 1ZXYA 4YEKA 3R88A 4GA5A 1KGZA 5EP8A 4GTNA 4GKMA 5BYTA 4X5CA 1BRWA 4ZTVA 1O17A 5C1RA 1GXBA 1KHDA 1AZYA 4ZOJA 5C2LA 2GVQA 4EAFA 4XR5A 3QS8A 4IJ1A 4ZOKA 4X58A 4GA4A 4N5VA 1UOUA 5BNEA 4YI7A 4OWUA 4OWQA 3UU1A 3QQSA 2ELCA 4M0RA 1VQUA 3GBRA 3H5QA 5BO2A 4LHMA 4X46A 4GIUA 2BPQA 4X59A 4GA6A 3TWPA
chains in the Genus database with same CATH superfamily
2J0FA 4OWOA 4YYYA 2WK5A 3QR9A 1RRZA 1ZVWA 4N8QA 4EADA 5BO3A 1OTPA 3R6CA 4N93A 1RF8B 5C7SA 2DSJA 1ZYKA 5EY3A 4ZOFA 3QSAA 4X5EA 4OWMA 4X5AA 2TPTA 4OWSA 1V8GA 4HKMA 4OWVA 4MUOA 4X5DA 4X5BA 2WK6A 4OWNA 1ZXYA 4YEKA 3R88A 4GA5A 1KGZA 5EP8A 4GTNA 4GKMA 5BYTA 4X5CA 1BRWA 4ZTVA 1O17A 5C1RA 1GXBA 1KHDA 1AZYA 4ZOJA 5C2LA 2GVQA 4EAFA 4XR5A 3QS8A 4IJ1A 4ZOKA 4X58A 4F3FC 4GA4A 4N5VA 1UOUA 5BNEA 4YI7A 4OWUA 4OWQA 3UU1A 3QQSA 2ELCA 4M0RA 1VQUA 3GBRA 3H5QA 5BO2A 4LHMA 4X46A 4GIUA 2BPQA 4X59A 4GA6A 3TWPA
chains in the Genus database with same CATH topology
2J0FA 4OWOA 4YYYA 2WK5A 3QR9A 1ZVWA 4N8QA 4EADA 5BO3A 1OTPA 3R6CA 4N93A 5C7SA 2DSJA 1ZYKA 5EY3A 4ZOFA 3QSAA 4X5EA 4OWMA 4X5AA 2TPTA 4OWSA 1V8GA 4HKMA 4OWVA 4MUOA 4X5DA 4X5BA 2WK6A 4OWNA 1ZXYA 4YEKA 3R88A 4GA5A 1KGZA 5EP8A 4GTNA 4GKMA 5BYTA 4X5CA 1BRWA 4ZTVA 1O17A 5C1RA 1GXBA 1KHDA 1AZYA 4ZOJA 5C2LA 2GVQA 4EAFA 4XR5A 3QS8A 4IJ1A 4ZOKA 4X58A 4GA4A 4N5VA 1UOUA 5BNEA 4YI7A 4OWUA 4OWQA 3UU1A 3QQSA 2ELCA 4M0RA 1VQUA 3GBRA 3H5QA 5BO2A 4LHMA 4X46A 4GIUA 2BPQA 4X59A 4GA6A 3TWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0F A;  4OWO A;  4YYY A;  2WK5 A;  3QR9 A;  1ZVW A;  4N8Q A;  4EAD A;  5BO3 A;  1OTP A;  3R6C A;  4N93 A;  5C7S A;  2DSJ A;  1ZYK A;  5EY3 A;  4ZOF A;  3QSA A;  4X5E A;  4OWM A;  4X5A A;  2TPT A;  4OWS A;  1V8G A;  4HKM A;  4OWV A;  4MUO A;  4X5D A;  4X5B A;  2WK6 A;  4OWN A;  1ZXY A;  4YEK A;  3R88 A;  4GA5 A;  1KGZ A;  5EP8 A;  4GTN A;  4GKM A;  5BYT A;  4X5C A;  1BRW A;  4ZTV A;  1O17 A;  5C1R A;  1GXB A;  1KHD A;  1AZY A;  4ZOJ A;  5C2L A;  2GVQ A;  4EAF A;  4XR5 A;  3QS8 A;  4IJ1 A;  4ZOK A;  4X58 A;  4GA4 A;  4N5V A;  1UOU A;  5BNE A;  4YI7 A;  4OWU A;  4OWQ A;  3UU1 A;  3QQS A;  2ELC A;  4M0R A;  1VQU A;  3GBR A;  3H5Q A;  5BO2 A;  4LHM A;  4X46 A;  4GIU A;  2BPQ A;  4X59 A;  4GA6 A;  3TWP A; 
#chains in the Genus database with same CATH topology
 2J0F A;  4OWO A;  4YYY A;  2WK5 A;  3QR9 A;  1RRZ A;  1ZVW A;  4N8Q A;  4EAD A;  5BO3 A;  1OTP A;  3R6C A;  4N93 A;  1RF8 B;  5C7S A;  2DSJ A;  1ZYK A;  5EY3 A;  4ZOF A;  3QSA A;  4X5E A;  4OWM A;  4X5A A;  2TPT A;  4OWS A;  1V8G A;  4HKM A;  4OWV A;  4MUO A;  4X5D A;  4X5B A;  2WK6 A;  4OWN A;  1ZXY A;  4YEK A;  3R88 A;  4GA5 A;  1KGZ A;  5EP8 A;  4GTN A;  4GKM A;  5BYT A;  4X5C A;  1BRW A;  4ZTV A;  1O17 A;  5C1R A;  1GXB A;  1KHD A;  1AZY A;  4ZOJ A;  5C2L A;  2GVQ A;  4EAF A;  4XR5 A;  3QS8 A;  4IJ1 A;  4ZOK A;  4X58 A;  4F3F C;  4GA4 A;  4N5V A;  1UOU A;  5BNE A;  4YI7 A;  4OWU A;  4OWQ A;  3UU1 A;  3QQS A;  2ELC A;  4M0R A;  1VQU A;  3GBR A;  3H5Q A;  5BO2 A;  4LHM A;  4X46 A;  4GIU A;  2BPQ A;  4X59 A;  4GA6 A;  3TWP A; 
#chains in the Genus database with same CATH homology
 2J0F A;  4OWO A;  4YYY A;  2WK5 A;  3QR9 A;  1ZVW A;  4N8Q A;  4EAD A;  5BO3 A;  1OTP A;  3R6C A;  4N93 A;  5C7S A;  2DSJ A;  1ZYK A;  5EY3 A;  4ZOF A;  3QSA A;  4X5E A;  4OWM A;  4X5A A;  2TPT A;  4OWS A;  1V8G A;  4HKM A;  4OWV A;  4MUO A;  4X5D A;  4X5B A;  2WK6 A;  4OWN A;  1ZXY A;  4YEK A;  3R88 A;  4GA5 A;  1KGZ A;  5EP8 A;  4GTN A;  4GKM A;  5BYT A;  4X5C A;  1BRW A;  4ZTV A;  1O17 A;  5C1R A;  1GXB A;  1KHD A;  1AZY A;  4ZOJ A;  5C2L A;  2GVQ A;  4EAF A;  4XR5 A;  3QS8 A;  4IJ1 A;  4ZOK A;  4X58 A;  4GA4 A;  4N5V A;  1UOU A;  5BNE A;  4YI7 A;  4OWU A;  4OWQ A;  3UU1 A;  3QQS A;  2ELC A;  4M0R A;  1VQU A;  3GBR A;  3H5Q A;  5BO2 A;  4LHM A;  4X46 A;  4GIU A;  2BPQ A;  4X59 A;  4GA6 A;  3TWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...